A0A146MIG6_SCHMA Loading...

V-type proton ATPase subunit

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane.

AlphaFold DB , UniProt , Accession A0A146MIG6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 83 aa.

						>A0A146MIG6_SCHMA|A0A146MIG6
MGYEVPLTVMTVFWLLVGCGGPLIVPKGPNRPLIQLMLATSSVFCYLFWLMSSMAQVNPLFGPILHRDTIRILQREWEPIRVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.6	Low	90.6	Very high	174 Å²	174	87.5 Å²	87.5	86%	0.857	49%	0.491	S	S	*	.				0	9	0	-56.7	-58.8	172.2	0	0	115.3	E4	M1-E4 WeakPolarHBondContact CA-OE1 3.14Å; M1-E4 PolarHBondContact N-OE1 3.09Å
2	G	83.9	Confident	91.2	Very high	64 Å²	64	86.3 Å²	86.3	66%	0.66	49%	0.487	S	S	*	.			trans	-79.9	-66.1	-178	0	0	0	0	0	113.2	P6	G2-P6 VanDerWaalsContact O-CD 3.3Å; G2-P6 WeakPolarHBondContact O-CD 3.38Å
3	Y	88.2	Confident	91.8	Very high	146 Å²	146	87.6 Å²	87.6	57%	0.573	48%	0.484	S	S	*	.	S	Bend	trans	-83.7	-18.6	-177.1	67.6	-91.3	0	0	0	113.6	V5 P6 L7	Y3-V5 PolarHBondContact O-N 3.34Å; Y3-P6 VanDerWaalsContact O-CD 3.26Å; Y3-P6 WeakPolarHBondContact O-CD 3.45Å; Y3-P6 VanDerWaalsContact O-CG 3.27Å; Y3-P6 WeakPolarHBondContact O-CG 3.47Å; Y3-L7 VanDerWaalsContact O-CB 3.3Å; Y3-L7 WeakPolarHBondContact O-CB 3.28Å; Y3-L7 PolarHBondContact O-N 3.22Å; Y3-L7 VanDerWaalsContact O-N 3.12Å
4	E	91.9	Very high	92.2	Very high	77 Å²	77	85.2 Å²	85.2	36%	0.36	46%	0.464	S	S	.	.	H	α-helix	trans	-63.4	-43.7	-176.4	-63.8	165.5	-110.4	0	0	111.5	M1 L7 T8	M1-E4 WeakPolarHBondContact CA-OE1 3.14Å; M1-E4 PolarHBondContact N-OE1 3.09Å; E4-L7 PolarHBondContact O-N 3.06Å; E4-T8 PolarHBondContact O-N 3.12Å; E4-T8 PolarHBondContact O-OG1 3.24Å; E4-T8 VanDerWaalsContact O-OG1 3.09Å
5	V	95.1	Very high	92.5	Very high	86 Å²	86	86.5 Å²	86.5	52%	0.521	47%	0.47	S	S	.	.	H	α-helix	trans	-58.8	-56.1	179.7	178	0	0	0	0	112	Y3 L7 T8 V9	Y3-V5 PolarHBondContact O-N 3.34Å; V5-L7 VanDerWaalsContact C-N 3.28Å; V5-L7 PolarHBondContact O-N 3.2Å; V5-T8 PolarHBondContact O-N 3.15Å; V5-V9 HydrophobicContact CG1-CG2 4.47Å; V5-V9 WeakPolarHBondContact O-CG2 3.47Å; V5-V9 PolarHBondContact O-N 2.83Å
6	P	95.2	Very high	92.8	Very high	56 Å²	56	88.4 Å²	88.4	36%	0.364	48%	0.478	S	S	.	.	H	α-helix	trans	-63.5	-35.4	178.5	22.7	-32	0	0	0	112.1	G2 Y3 M10 W49	G2-P6 VanDerWaalsContact O-CD 3.3Å; G2-P6 WeakPolarHBondContact O-CD 3.38Å; Y3-P6 VanDerWaalsContact O-CD 3.26Å; Y3-P6 WeakPolarHBondContact O-CD 3.45Å; Y3-P6 VanDerWaalsContact O-CG 3.27Å; Y3-P6 WeakPolarHBondContact O-CG 3.47Å; P6-M10 VanDerWaalsContact O-CB 3.26Å; P6-M10 WeakPolarHBondContact O-CB 3.35Å; P6-M10 VanDerWaalsContact O-CG 3.22Å; P6-M10 WeakPolarHBondContact O-CG 3.05Å; P6-M10 PolarHBondContact O-N 3.44Å; P6-W49 HydrophobicContact CB-CZ2 4.47Å
7	L	95.6	Very high	93.1	Very high	65 Å²	65	85.8 Å²	85.8	34%	0.34	47%	0.466	S	S	.	.	H	α-helix	trans	-60.6	-50.1	176.2	-171.6	69.4	0	0	0	112	Y3 E4 V5 T11 W49 L50	Y3-L7 VanDerWaalsContact O-CB 3.3Å; Y3-L7 WeakPolarHBondContact O-CB 3.28Å; Y3-L7 PolarHBondContact O-N 3.22Å; Y3-L7 VanDerWaalsContact O-N 3.12Å; E4-L7 PolarHBondContact O-N 3.06Å; V5-L7 VanDerWaalsContact C-N 3.28Å; V5-L7 PolarHBondContact O-N 3.2Å; L7-T11 VanDerWaalsContact O-CB 3.24Å; L7-T11 WeakPolarHBondContact O-CB 3.38Å; L7-T11 PolarHBondContact O-N 3.27Å; L7-T11 PolarHBondContact O-OG1 3.19Å; L7-W49 HydrophobicContact CD1-CH2 3.95Å; L7-W49 HydrophobicContact CD1-CZ3 4.04Å; L7-L50 HydrophobicContact CD1-CD1 3.85Å
8	T	96.3	Very high	93.3	Very high	89 Å²	89	81.7 Å²	81.7	55%	0.546	45%	0.447	S	S	.	.	H	α-helix	trans	-63.1	-48.2	178.6	-57.9	0	0	0	0	111.4	E4 V5 M10 T11 V12	E4-T8 PolarHBondContact O-N 3.12Å; E4-T8 PolarHBondContact O-OG1 3.24Å; E4-T8 VanDerWaalsContact O-OG1 3.09Å; V5-T8 PolarHBondContact O-N 3.15Å; T8-M10 PolarHBondContact O-N 3.44Å; T8-T11 PolarHBondContact O-N 2.78Å; T8-V12 HydrophobicContact CG2-CG2 4.47Å; T8-V12 WeakPolarHBondContact O-CG2 3.42Å; T8-V12 PolarHBondContact O-N 3.02Å
9	V	97.1	Very high	93.4	Very high	86 Å²	86	81.4 Å²	81.4	52%	0.521	45%	0.45	S	S	.	.	H	α-helix	trans	-61.7	-48.3	-177.8	171.9	0	0	0	0	111.3	V5 V12 F13	V5-V9 HydrophobicContact CG1-CG2 4.47Å; V5-V9 WeakPolarHBondContact O-CG2 3.47Å; V5-V9 PolarHBondContact O-N 2.83Å; V9-V12 PolarHBondContact O-N 3.2Å; V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.47Å; V9-F13 PolarHBondContact O-N 2.96Å
10	M	97	Very high	93.4	Very high	68 Å²	68	78.6 Å²	78.6	34%	0.335	44%	0.441	S	S	.	.	H	α-helix	trans	-69.3	-36.2	-177.8	-67.5	-64.6	-178.8	0	0	112.1	P6 T8 W14 W49	P6-M10 VanDerWaalsContact O-CB 3.26Å; P6-M10 WeakPolarHBondContact O-CB 3.35Å; P6-M10 VanDerWaalsContact O-CG 3.22Å; P6-M10 WeakPolarHBondContact O-CG 3.05Å; P6-M10 PolarHBondContact O-N 3.44Å; T8-M10 PolarHBondContact O-N 3.44Å; M10-W14 VanDerWaalsContact O-CD1 3.28Å; M10-W14 PolarHBondContact O-N 3.44Å; M10-W49 HydrophobicContact CB-CD2 4Å; M10-W49 HydrophobicContact CB-CE3 3.9Å; M10-W49 HydrophobicContact CB-CH2 3.79Å; M10-W49 HydrophobicContact CB-CZ2 3.82Å; M10-W49 HydrophobicContact CB-CZ3 3.79Å; M10-W49 HydrophobicContact CG-CD2 4.08Å; M10-W49 HydrophobicContact CG-CE3 4.47Å; M10-W49 HydrophobicContact CG-CH2 4.11Å; M10-W49 HydrophobicContact CG-CZ2 3.62Å; M10-W49 HydrophobicContact CG-CZ3 4.49Å
11	T	97.2	Very high	93.5	Very high	52 Å²	52	75.4 Å²	75.4	32%	0.319	43%	0.426	S	S	.	.	H	α-helix	trans	-63.9	-48.7	175.3	-55.9	0	0	0	0	110.9	L7 T8 F13 L15 Y46	L7-T11 VanDerWaalsContact O-CB 3.24Å; L7-T11 WeakPolarHBondContact O-CB 3.38Å; L7-T11 PolarHBondContact O-N 3.27Å; L7-T11 PolarHBondContact O-OG1 3.19Å; T8-T11 PolarHBondContact O-N 2.78Å; T11-F13 PolarHBondContact O-N 3.45Å; T11-L15 WeakPolarHBondContact O-CB 3.27Å; T11-L15 PolarHBondContact O-N 3.34Å; T11-Y46 PolarHBondContact OG1-OH 3.04Å
12	V	98	Very high	95.2	Very high	73 Å²	73	68 Å²	68	44%	0.442	39%	0.391	S	S	.	.	H	α-helix	trans	-63.6	-43.6	178.8	171.8	0	0	0	0	110.8	T8 V9 L15 L16	T8-V12 HydrophobicContact CG2-CG2 4.47Å; T8-V12 WeakPolarHBondContact O-CG2 3.42Å; T8-V12 PolarHBondContact O-N 3.02Å; V9-V12 PolarHBondContact O-N 3.2Å; V12-L15 PolarHBondContact O-N 2.91Å; V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 HydrophobicContact CG1-CG 4.33Å; V12-L16 WeakPolarHBondContact O-CB 3.28Å; V12-L16 VanDerWaalsContact O-CG 3.29Å; V12-L16 WeakPolarHBondContact O-CG 3.23Å; V12-L16 PolarHBondContact O-N 3.47Å
13	F	97.9	Very high	95.8	Very high	103 Å²	103	71.5 Å²	71.5	45%	0.452	39%	0.394	S	S	.	.	H	α-helix	trans	-57.1	-53.8	178.2	175	-96.3	0	0	0	111.7	V9 T11 L15 L16 V17	V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.47Å; V9-F13 PolarHBondContact O-N 2.96Å; T11-F13 PolarHBondContact O-N 3.45Å; F13-L15 VanDerWaalsContact C-N 3.35Å; F13-L15 PolarHBondContact O-N 2.83Å; F13-L16 PolarHBondContact O-N 2.91Å; F13-V17 HydrophobicContact CE1-CG2 4.17Å; F13-V17 HydrophobicContact CE2-CG2 4.45Å; F13-V17 HydrophobicContact CZ-CG2 4.1Å; F13-V17 WeakPolarHBondContact O-CG2 3.29Å; F13-V17 PolarHBondContact O-N 2.99Å
14	W	98	Very high	96.1	Very high	54 Å²	54	71.3 Å²	71.3	21%	0.205	40%	0.401	C	S	.	.	H	α-helix	trans	-71.4	-29.9	-178	-75.2	114.4	0	0	0	113.1	M10 V17 G18 C45 Y46	M10-W14 VanDerWaalsContact O-CD1 3.28Å; M10-W14 PolarHBondContact O-N 3.44Å; W14-V17 HydrophobicContact CE3-CB 4.13Å; W14-V17 HydrophobicContact CE3-CG1 4.23Å; W14-V17 HydrophobicContact CE3-CG2 4.42Å; W14-V17 HydrophobicContact CZ3-CB 4.49Å; W14-V17 HydrophobicContact CZ3-CG1 4.17Å; W14-V17 PolarHBondContact O-N 3.49Å; W14-G18 PolarHBondContact O-N 3.04Å; W14-C45 HydrophobicContact CD2-CB 4.28Å; W14-C45 HydrophobicContact CE3-CB 4.3Å; W14-C45 HydrophobicContact CH2-CB 3.37Å; W14-C45 HydrophobicContact CZ2-CB 3.35Å; W14-C45 HydrophobicContact CZ3-CB 3.87Å; W14-Y46 HydrophobicContact CB-CD2 4.1Å; W14-Y46 HydrophobicContact CB-CG 4.3Å; W14-Y46 AromaticContact CD1-CD2 3.86Å; W14-Y46 HydrophobicContact CG-CD2 4.26Å
15	L	96.6	Very high	96.3	Very high	105 Å²	105	68.3 Å²	68.3	55%	0.55	39%	0.388	S	S	.	.	H	α-helix	trans	-63.6	-42.3	170.8	-174.7	69	0	0	0	111.5	T11 V12 F13 G18 C19	T11-L15 WeakPolarHBondContact O-CB 3.27Å; T11-L15 PolarHBondContact O-N 3.34Å; V12-L15 PolarHBondContact O-N 2.91Å; F13-L15 VanDerWaalsContact C-N 3.35Å; F13-L15 PolarHBondContact O-N 2.83Å; L15-G18 PolarHBondContact O-N 3.38Å; L15-C19 VanDerWaalsContact O-CB 3.28Å; L15-C19 WeakPolarHBondContact O-CB 3.29Å; L15-C19 PolarHBondContact O-N 3.04Å
16	L	97.6	Very high	96.3	Very high	116 Å²	116	69.2 Å²	69.2	61%	0.607	40%	0.396	S	S	*	.	I	π-helix	trans	-65.1	-39.3	175.7	-72.6	173	0	0	0	111.8	V12 F13 G20 G21	V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 HydrophobicContact CG1-CG 4.33Å; V12-L16 WeakPolarHBondContact O-CB 3.28Å; V12-L16 VanDerWaalsContact O-CG 3.29Å; V12-L16 WeakPolarHBondContact O-CG 3.23Å; V12-L16 PolarHBondContact O-N 3.47Å; F13-L16 PolarHBondContact O-N 2.91Å; L16-G20 CarbonylContact O-C 3.46Å; L16-G20 WeakPolarHBondContact O-CA 3.3Å; L16-G20 PolarHBondContact O-N 3.24Å; L16-G21 PolarHBondContact O-N 3.33Å
17	V	97.4	Very high	96.2	Very high	44 Å²	44	76.4 Å²	76.4	27%	0.267	42%	0.422	S	S	.	.	I	π-helix	trans	-67.6	-46.1	175.7	176	0	0	0	0	111.2	F13 W14 G21 P22	F13-V17 HydrophobicContact CE1-CG2 4.17Å; F13-V17 HydrophobicContact CE2-CG2 4.45Å; F13-V17 HydrophobicContact CZ-CG2 4.1Å; F13-V17 WeakPolarHBondContact O-CG2 3.29Å; F13-V17 PolarHBondContact O-N 2.99Å; W14-V17 HydrophobicContact CE3-CB 4.13Å; W14-V17 HydrophobicContact CE3-CG1 4.23Å; W14-V17 HydrophobicContact CE3-CG2 4.42Å; W14-V17 HydrophobicContact CZ3-CB 4.49Å; W14-V17 HydrophobicContact CZ3-CG1 4.17Å; W14-V17 PolarHBondContact O-N 3.49Å; V17-G21 WeakPolarHBondContact O-CA 3.3Å; V17-G21 PolarHBondContact O-N 2.91Å; V17-P22 VanDerWaalsContact O-CD 3.3Å; V17-P22 WeakPolarHBondContact O-CD 3.33Å
18	G	96.7	Very high	96.2	Very high	13 Å²	13	75.3 Å²	75.3	13%	0.134	43%	0.425	C	S	.	.	I	π-helix	trans	-77.3	-31	-174.7	0	0	0	0	0	115	W14 L15 P22 S42	W14-G18 PolarHBondContact O-N 3.04Å; L15-G18 PolarHBondContact O-N 3.38Å; G18-P22 VanDerWaalsContact O-CD 3.3Å; G18-P22 WeakPolarHBondContact O-CD 3.35Å; G18-P22 VanDerWaalsContact O-CG 3.23Å; G18-P22 WeakPolarHBondContact O-CG 3.37Å; G18-S42 WeakPolarHBondContact CA-OG 3.24Å
19	C	94.6	Very high	96.2	Very high	75 Å²	75	77.3 Å²	77.3	51%	0.507	44%	0.44	S	S	.	.	I	π-helix	trans	-103.9	-47.3	177.2	-64.3	0	0	0	0	112	L15 L23	L15-C19 VanDerWaalsContact O-CB 3.28Å; L15-C19 WeakPolarHBondContact O-CB 3.29Å; L15-C19 PolarHBondContact O-N 3.04Å; C19-L23 WeakPolarHBondContact O-CD1 3.34Å; C19-L23 VanDerWaalsContact O-CG 3.28Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å
20	G	95.3	Very high	96.2	Very high	26 Å²	26	78.1 Å²	78.1	27%	0.268	44%	0.442	S	S	.	.	I	π-helix	trans	-70.7	-43.9	-179.4	0	0	0	0	0	112.8	L16 L23 I24	L16-G20 CarbonylContact O-C 3.46Å; L16-G20 WeakPolarHBondContact O-CA 3.3Å; L16-G20 PolarHBondContact O-N 3.24Å; G20-L23 WeakPolarHBondContact O-CB 3.43Å; G20-L23 PolarHBondContact O-N 3.45Å; G20-L23 VanDerWaalsContact O-N 3.09Å; G20-I24 PolarHBondContact O-N 2.96Å
21	G	95	Very high	96.1	Very high	12 Å²	12	78.8 Å²	78.8	12%	0.124	44%	0.44	C	S	.	.	H	α-helix	trans	-52.5	-54.4	178.8	0	0	0	0	0	113.2	L16 V17 L23 I24 V25	L16-G21 PolarHBondContact O-N 3.33Å; V17-G21 WeakPolarHBondContact O-CA 3.3Å; V17-G21 PolarHBondContact O-N 2.91Å; G21-L23 PolarHBondContact O-N 3.48Å; G21-I24 WeakPolarHBondContact O-CG1 3.18Å; G21-I24 PolarHBondContact O-N 3.02Å; G21-V25 WeakPolarHBondContact O-CG2 3.14Å
22	P	95.4	Very high	96.1	Very high	19 Å²	19	80.4 Å²	80.4	12%	0.123	45%	0.452	C	S	.	.	H	α-helix	trans	-58.4	-29.5	177.2	-31.9	39.4	0	0	0	115	V17 G18 Q35 L38	V17-P22 VanDerWaalsContact O-CD 3.3Å; V17-P22 WeakPolarHBondContact O-CD 3.33Å; G18-P22 VanDerWaalsContact O-CD 3.3Å; G18-P22 WeakPolarHBondContact O-CD 3.35Å; G18-P22 VanDerWaalsContact O-CG 3.23Å; G18-P22 WeakPolarHBondContact O-CG 3.37Å; P22-Q35 HydrophobicContact CB-CB 4.09Å; P22-Q35 HydrophobicContact CB-CG 3.95Å; P22-Q35 PolarHBondContact O-NE2 3.25Å; P22-L38 HydrophobicContact CG-CB 4.22Å
23	L	94.9	Very high	96.1	Very high	137 Å²	137	81.6 Å²	81.6	72%	0.717	46%	0.455	S	S	*	.	H	α-helix	trans	-72.7	-32.1	-179.1	-65.4	171.9	0	0	0	112.4	C19 G20 G21	C19-L23 WeakPolarHBondContact O-CD1 3.34Å; C19-L23 VanDerWaalsContact O-CG 3.28Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å; G20-L23 WeakPolarHBondContact O-CB 3.43Å; G20-L23 PolarHBondContact O-N 3.45Å; G20-L23 VanDerWaalsContact O-N 3.09Å; G21-L23 PolarHBondContact O-N 3.48Å
24	I	95.5	Very high	96	Very high	142 Å²	142	80.3 Å²	80.3	73%	0.728	45%	0.452	S	S	*	.	H	α-helix	trans	-88.6	-3.8	-178.3	63.8	168.2	0	0	0	114	G20 G21	G20-I24 PolarHBondContact O-N 2.96Å; G21-I24 WeakPolarHBondContact O-CG1 3.18Å; G21-I24 PolarHBondContact O-N 3.02Å
25	V	95.9	Very high	96	Very high	14 Å²	14	79.8 Å²	79.8	9%	0.085	45%	0.452	C	S	.	.			trans	-64.4	123.7	179.7	-177.4	0	0	0	0	110.4	G21 R31 I34 Q35 L38	G21-V25 WeakPolarHBondContact O-CG2 3.14Å; V25-R31 HydrophobicContact CB-CG 4.32Å; V25-R31 HydrophobicContact CG1-CB 4.36Å; V25-R31 HydrophobicContact CG1-CG 3.86Å; V25-R31 PolarHBondContact O-NE 2.83Å; V25-I34 HydrophobicContact CG1-CB 4.07Å; V25-I34 HydrophobicContact CG1-CD1 4.35Å; V25-I34 HydrophobicContact CG1-CG2 3.89Å; V25-I34 HydrophobicContact CG2-CG2 3.94Å; V25-Q35 HydrophobicContact CB-CG 4.17Å; V25-Q35 HydrophobicContact CG2-CG 3.97Å; V25-L38 HydrophobicContact CG2-CD1 3.81Å
26	P	95.4	Very high	96	Very high	105 Å²	105	79.7 Å²	79.7	68%	0.682	45%	0.451	S	S	*	.			trans	-64.6	155.2	-177.9	26	-34	0	0	0	112.1	G28	P26-G28 PolarHBondContact O-N 3.09Å
27	K	93.7	Very high	96	Very high	207 Å²	207	79.4 Å²	79.4	90%	0.9	45%	0.448	S	S	*	.	S	Bend	trans	-70.1	114	178.9	-64.2	-179.3	-177.1	177.4	0	109.3
28	G	94.9	Very high	96	Very high	41 Å²	41	80 Å²	80	42%	0.423	45%	0.45	S	S	.	.	S	Bend	trans	-159.4	171	176.6	0	0	0	0	0	111.3	P26 N30 R31	P26-G28 PolarHBondContact O-N 3.09Å; G28-N30 PolarHBondContact O-N 3.42Å; G28-N30 VanDerWaalsContact O-N 3.15Å; G28-R31 WeakPolarHBondContact O-CB 3.36Å; G28-R31 PolarHBondContact O-N 2.98Å; G28-R31 VanDerWaalsContact O-N 3.12Å
29	P	97	Very high	96	Very high	131 Å²	131	81 Å²	81	85%	0.851	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-35.2	-175.6	-25.5	33.8	0	0	0	113.3
30	N	96.6	Very high	96.2	Very high	104 Å²	104	80 Å²	80	56%	0.556	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.1	12.7	-175.2	-61.2	-21.9	0	0	0	113.7	G28 L33 I34	G28-N30 PolarHBondContact O-N 3.42Å; G28-N30 VanDerWaalsContact O-N 3.15Å; N30-L33 WeakPolarHBondContact O-CB 3.35Å; N30-L33 PolarHBondContact O-N 2.74Å; N30-I34 HydrophobicContact CB-CD1 4.46Å; N30-I34 WeakPolarHBondContact O-CG1 3.34Å; N30-I34 PolarHBondContact O-N 3.5Å
31	R	95.3	Very high	96.3	Very high	81 Å²	81	81.9 Å²	81.9	31%	0.306	46%	0.458	S	S	.	.	H	α-helix	trans	-55.7	-49.2	-175.2	175.6	172.9	-172.9	-92.8	5.5	113.3	V25 G28 L33 I34 Q35	V25-R31 HydrophobicContact CB-CG 4.32Å; V25-R31 HydrophobicContact CG1-CB 4.36Å; V25-R31 HydrophobicContact CG1-CG 3.86Å; V25-R31 PolarHBondContact O-NE 2.83Å; G28-R31 WeakPolarHBondContact O-CB 3.36Å; G28-R31 PolarHBondContact O-N 2.98Å; G28-R31 VanDerWaalsContact O-N 3.12Å; R31-L33 VanDerWaalsContact C-N 3.27Å; R31-L33 PolarHBondContact O-N 3.39Å; R31-I34 PolarHBondContact O-N 2.92Å; R31-Q35 HydrophobicContact CG-CG 4.28Å; R31-Q35 VanDerWaalsContact NH2-NE2 3.12Å; R31-Q35 VanDerWaalsContact O-CG 3.27Å; R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 2.87Å
32	P	96.5	Very high	96.4	Very high	87 Å²	87	81.8 Å²	81.8	57%	0.565	46%	0.455	S	S	*	.	H	α-helix	trans	-62.4	-35.7	-180	-22.1	34	0	0	0	112.8	Q35 L36	P32-Q35 PolarHBondContact O-N 2.9Å; P32-L36 WeakPolarHBondContact O-CB 3.22Å; P32-L36 PolarHBondContact O-N 3.49Å
33	L	97.5	Very high	96.5	Very high	98 Å²	98	84.5 Å²	84.5	51%	0.513	47%	0.471	S	S	.	.	H	α-helix	trans	-64.1	-48.2	177.1	-178.8	65.4	0	0	0	110.8	N30 R31 Q35 L36 M37	N30-L33 WeakPolarHBondContact O-CB 3.35Å; N30-L33 PolarHBondContact O-N 2.74Å; R31-L33 VanDerWaalsContact C-N 3.27Å; R31-L33 PolarHBondContact O-N 3.39Å; L33-Q35 VanDerWaalsContact C-N 3.33Å; L33-Q35 PolarHBondContact O-N 2.93Å; L33-L36 PolarHBondContact O-N 2.95Å; L33-M37 HydrophobicContact CG-SD 4.14Å; L33-M37 VanDerWaalsContact O-CG 3.25Å; L33-M37 WeakPolarHBondContact O-CG 3.2Å; L33-M37 PolarHBondContact O-N 3.26Å
34	I	97.5	Very high	96.7	Very high	75 Å²	75	84.7 Å²	84.7	39%	0.385	47%	0.466	S	S	.	.	H	α-helix	trans	-62	-42.7	177.9	-62.7	168.7	0	0	0	110.7	V25 N30 R31 L36 M37 L38	V25-I34 HydrophobicContact CG1-CB 4.07Å; V25-I34 HydrophobicContact CG1-CD1 4.35Å; V25-I34 HydrophobicContact CG1-CG2 3.89Å; V25-I34 HydrophobicContact CG2-CG2 3.94Å; N30-I34 HydrophobicContact CB-CD1 4.46Å; N30-I34 WeakPolarHBondContact O-CG1 3.34Å; N30-I34 PolarHBondContact O-N 3.5Å; R31-I34 PolarHBondContact O-N 2.92Å; I34-L36 PolarHBondContact O-N 3.39Å; I34-M37 PolarHBondContact O-N 3.26Å; I34-L38 HydrophobicContact CG2-CD1 4.15Å; I34-L38 WeakPolarHBondContact O-CG 3.3Å; I34-L38 PolarHBondContact O-N 3.4Å
35	Q	97.4	Very high	96.8	Very high	43 Å²	43	80.5 Å²	80.5	20%	0.201	45%	0.449	C	S	.	.	H	α-helix	trans	-61	-43.5	176.5	-71	179.7	-41.3	0	0	112.1	P22 V25 R31 P32 L33 L38 A39	P22-Q35 HydrophobicContact CB-CB 4.09Å; P22-Q35 HydrophobicContact CB-CG 3.95Å; P22-Q35 PolarHBondContact O-NE2 3.25Å; V25-Q35 HydrophobicContact CB-CG 4.17Å; V25-Q35 HydrophobicContact CG2-CG 3.97Å; R31-Q35 HydrophobicContact CG-CG 4.28Å; R31-Q35 VanDerWaalsContact NH2-NE2 3.12Å; R31-Q35 VanDerWaalsContact O-CG 3.27Å; R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 2.87Å; P32-Q35 PolarHBondContact O-N 2.9Å; L33-Q35 VanDerWaalsContact C-N 3.33Å; L33-Q35 PolarHBondContact O-N 2.93Å; Q35-L38 PolarHBondContact O-N 3.36Å; Q35-A39 WeakPolarHBondContact O-CB 3.26Å; Q35-A39 PolarHBondContact O-N 3.24Å
36	L	97	Very high	96.9	Very high	103 Å²	103	82.4 Å²	82.4	54%	0.539	46%	0.455	S	S	.	.	H	α-helix	trans	-63.6	-44.2	176.7	179.5	65.6	0	0	0	111.2	P32 L33 I34 A39 T40	P32-L36 WeakPolarHBondContact O-CB 3.22Å; P32-L36 PolarHBondContact O-N 3.49Å; L33-L36 PolarHBondContact O-N 2.95Å; I34-L36 PolarHBondContact O-N 3.39Å; L36-A39 PolarHBondContact O-N 2.73Å; L36-T40 HydrophobicContact CD1-CG2 3.78Å; L36-T40 HydrophobicContact CG-CG2 4.26Å; L36-T40 WeakPolarHBondContact O-CB 3.26Å; L36-T40 WeakPolarHBondContact O-CG2 3.3Å; L36-T40 PolarHBondContact O-N 3.45Å; L36-T40 PolarHBondContact O-OG1 2.77Å
37	M	97.6	Very high	97	Very high	110 Å²	110	80.9 Å²	80.9	54%	0.542	44%	0.441	S	S	.	.	H	α-helix	trans	-59.1	-49.3	176.8	-69.6	172.4	75.1	0	0	110.9	L33 I34 A39 T40 S41	L33-M37 HydrophobicContact CG-SD 4.14Å; L33-M37 VanDerWaalsContact O-CG 3.25Å; L33-M37 WeakPolarHBondContact O-CG 3.2Å; L33-M37 PolarHBondContact O-N 3.26Å; I34-M37 PolarHBondContact O-N 3.26Å; M37-A39 PolarHBondContact O-N 2.93Å; M37-T40 PolarHBondContact O-OG1 3.49Å; M37-S41 WeakPolarHBondContact O-CB 3.24Å; M37-S41 PolarHBondContact O-N 3.36Å; M37-S41 PolarHBondContact O-OG 2.64Å
38	L	97.5	Very high	97.2	Very high	56 Å²	56	78.2 Å²	78.2	29%	0.293	43%	0.43	S	S	.	.	H	α-helix	trans	-60	-47.3	177.5	-71.3	172.5	0	0	0	112.3	P22 V25 I34 Q35 S42	P22-L38 HydrophobicContact CG-CB 4.22Å; V25-L38 HydrophobicContact CG2-CD1 3.81Å; I34-L38 HydrophobicContact CG2-CD1 4.15Å; I34-L38 WeakPolarHBondContact O-CG 3.3Å; I34-L38 PolarHBondContact O-N 3.4Å; Q35-L38 PolarHBondContact O-N 3.36Å; L38-S42 WeakPolarHBondContact O-CB 3.32Å; L38-S42 PolarHBondContact O-N 2.97Å; L38-S42 PolarHBondContact O-OG 2.91Å
39	A	96.6	Very high	97.4	Very high	34 Å²	34	78.8 Å²	78.8	28%	0.281	42%	0.419	S	S	.	.	H	α-helix	trans	-62.4	-53	-179.7	0	0	0	0	0	111.3	Q35 L36 M37 S42 V43	Q35-A39 WeakPolarHBondContact O-CB 3.26Å; Q35-A39 PolarHBondContact O-N 3.24Å; L36-A39 PolarHBondContact O-N 2.73Å; M37-A39 PolarHBondContact O-N 2.93Å; A39-S42 PolarHBondContact O-N 3.17Å; A39-S42 PolarHBondContact O-OG 3.12Å; A39-V43 WeakPolarHBondContact O-CG2 3.16Å; A39-V43 PolarHBondContact O-N 2.97Å; A39-V43 VanDerWaalsContact O-N 3.12Å
40	T	97.5	Very high	97.3	Very high	56 Å²	56	74 Å²	74	34%	0.344	39%	0.386	S	S	.	.	H	α-helix	trans	-64.1	-43.9	-178.4	53.2	0	0	0	0	112.4	L36 M37 S42 V43 F44	L36-T40 HydrophobicContact CD1-CG2 3.78Å; L36-T40 HydrophobicContact CG-CG2 4.26Å; L36-T40 WeakPolarHBondContact O-CB 3.26Å; L36-T40 WeakPolarHBondContact O-CG2 3.3Å; L36-T40 PolarHBondContact O-N 3.45Å; L36-T40 PolarHBondContact O-OG1 2.77Å; M37-T40 PolarHBondContact O-OG1 3.49Å; T40-S42 VanDerWaalsContact C-N 3.34Å; T40-S42 PolarHBondContact O-N 3.01Å; T40-V43 PolarHBondContact O-N 3.07Å; T40-F44 WeakPolarHBondContact O-CD2 3.3Å; T40-F44 PolarHBondContact O-N 3.47Å; T40-F44 VanDerWaalsContact O-N 3.07Å
41	S	97.6	Very high	97.4	Very high	65 Å²	65	74.6 Å²	74.6	46%	0.455	39%	0.387	S	S	.	.	H	α-helix	trans	-59.3	-44.9	174.4	-65.6	0	0	0	0	111.6	M37 V43 F44 C45	M37-S41 WeakPolarHBondContact O-CB 3.24Å; M37-S41 PolarHBondContact O-N 3.36Å; M37-S41 PolarHBondContact O-OG 2.64Å; S41-V43 VanDerWaalsContact C-N 3.31Å; S41-V43 PolarHBondContact O-N 2.89Å; S41-F44 PolarHBondContact O-N 3.37Å; S41-C45 VanDerWaalsContact O-CB 3.3Å; S41-C45 WeakPolarHBondContact O-CB 3.27Å; S41-C45 PolarHBondContact O-N 3.3Å; S41-C45 PolarHBondContact O-SG 3.12Å
42	S	98	Very high	97.4	Very high	9 Å²	9	73.1 Å²	73.1	6%	0.063	39%	0.389	C	S	.	.	H	α-helix	trans	-60.1	-41.5	179.7	77.5	0	0	0	0	112.5	G18 L38 A39 T40 Y46	G18-S42 WeakPolarHBondContact CA-OG 3.24Å; L38-S42 WeakPolarHBondContact O-CB 3.32Å; L38-S42 PolarHBondContact O-N 2.97Å; L38-S42 PolarHBondContact O-OG 2.91Å; A39-S42 PolarHBondContact O-N 3.17Å; A39-S42 PolarHBondContact O-OG 3.12Å; T40-S42 VanDerWaalsContact C-N 3.34Å; T40-S42 PolarHBondContact O-N 3.01Å; S42-Y46 VanDerWaalsContact O-CB 3.24Å; S42-Y46 WeakPolarHBondContact O-CB 3.41Å; S42-Y46 PolarHBondContact O-N 3.32Å
43	V	97.8	Very high	97.3	Very high	76 Å²	76	70.7 Å²	70.7	46%	0.461	37%	0.374	S	S	.	.	H	α-helix	trans	-66.1	-50.6	-179.7	171.1	0	0	0	0	110.5	A39 T40 S41 Y46 L47	A39-V43 WeakPolarHBondContact O-CG2 3.16Å; A39-V43 PolarHBondContact O-N 2.97Å; A39-V43 VanDerWaalsContact O-N 3.12Å; T40-V43 PolarHBondContact O-N 3.07Å; S41-V43 VanDerWaalsContact C-N 3.31Å; S41-V43 PolarHBondContact O-N 2.89Å; V43-Y46 PolarHBondContact O-N 3.41Å; V43-L47 HydrophobicContact CG1-CD1 3.86Å; V43-L47 HydrophobicContact CG1-CG 4.42Å; V43-L47 WeakPolarHBondContact O-CB 3.28Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.41Å; V43-L47 PolarHBondContact O-N 3.05Å
44	F	98.2	Very high	97.1	Very high	141 Å²	141	71.5 Å²	71.5	62%	0.618	38%	0.376	S	S	*	.	H	α-helix	trans	-68.3	-38.7	-177.6	-70.4	-57.6	0	0	0	112.7	T40 S41 L47 F48	T40-F44 WeakPolarHBondContact O-CD2 3.3Å; T40-F44 PolarHBondContact O-N 3.47Å; T40-F44 VanDerWaalsContact O-N 3.07Å; S41-F44 PolarHBondContact O-N 3.37Å; F44-L47 PolarHBondContact O-N 3.47Å; F44-F48 VanDerWaalsContact O-CB 3.3Å; F44-F48 WeakPolarHBondContact O-CB 3.4Å; F44-F48 PolarHBondContact O-N 3.34Å
45	C	98	Very high	96.9	Very high	55 Å²	55	71.7 Å²	71.7	37%	0.372	39%	0.389	S	S	.	.	H	α-helix	trans	-65.6	-42.6	175.5	-68.6	0	0	0	0	111.8	W14 S41 W49	W14-C45 HydrophobicContact CD2-CB 4.28Å; W14-C45 HydrophobicContact CE3-CB 4.3Å; W14-C45 HydrophobicContact CH2-CB 3.37Å; W14-C45 HydrophobicContact CZ2-CB 3.35Å; W14-C45 HydrophobicContact CZ3-CB 3.87Å; S41-C45 VanDerWaalsContact O-CB 3.3Å; S41-C45 WeakPolarHBondContact O-CB 3.27Å; S41-C45 PolarHBondContact O-N 3.3Å; S41-C45 PolarHBondContact O-SG 3.12Å; C45-W49 WeakPolarHBondContact O-CB 3.3Å; C45-W49 PolarHBondContact O-N 2.77Å
46	Y	98.2	Very high	96.7	Very high	54 Å²	54	76.6 Å²	76.6	21%	0.212	41%	0.412	C	S	.	.	H	α-helix	trans	-63.4	-45.9	175.6	178.5	-107.4	0	0	0	111.7	T11 W14 S42 V43 W49 L50	T11-Y46 PolarHBondContact OG1-OH 3.04Å; W14-Y46 HydrophobicContact CB-CD2 4.1Å; W14-Y46 HydrophobicContact CB-CG 4.3Å; W14-Y46 AromaticContact CD1-CD2 3.86Å; W14-Y46 HydrophobicContact CG-CD2 4.26Å; S42-Y46 VanDerWaalsContact O-CB 3.24Å; S42-Y46 WeakPolarHBondContact O-CB 3.41Å; S42-Y46 PolarHBondContact O-N 3.32Å; V43-Y46 PolarHBondContact O-N 3.41Å; Y46-W49 HydrophobicContact CD2-CE3 4.14Å; Y46-W49 AromaticContact CE2-CE3 3.99Å; Y46-W49 HydrophobicContact CE2-CE3 3.99Å; Y46-W49 AromaticContact CE2-CZ3 3.95Å; Y46-W49 HydrophobicContact CE2-CZ3 3.95Å; Y46-W49 PolarHBondContact O-N 2.97Å; Y46-L50 HydrophobicContact CE1-CD2 3.91Å; Y46-L50 VanDerWaalsContact O-CB 3.26Å; Y46-L50 WeakPolarHBondContact O-CB 3.3Å; Y46-L50 PolarHBondContact O-N 3.47Å
47	L	97.6	Very high	96.5	Very high	72 Å²	72	75.1 Å²	75.1	38%	0.377	41%	0.408	S	S	.	.	H	α-helix	trans	-62.9	-44	178.6	-74.4	175.3	0	0	0	112.2	V43 F44 W49 L50 M51	V43-L47 HydrophobicContact CG1-CD1 3.86Å; V43-L47 HydrophobicContact CG1-CG 4.42Å; V43-L47 WeakPolarHBondContact O-CB 3.28Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.41Å; V43-L47 PolarHBondContact O-N 3.05Å; F44-L47 PolarHBondContact O-N 3.47Å; L47-W49 VanDerWaalsContact C-N 3.34Å; L47-W49 PolarHBondContact O-N 2.8Å; L47-L50 PolarHBondContact O-N 2.9Å; L47-M51 HydrophobicContact CB-CE 4.38Å; L47-M51 WeakPolarHBondContact O-CB 3.4Å; L47-M51 WeakPolarHBondContact O-CE 3.26Å; L47-M51 VanDerWaalsContact O-CG 3.3Å; L47-M51 WeakPolarHBondContact O-CG 3.42Å; L47-M51 PolarHBondContact O-N 3.4Å
48	F	98	Very high	96.3	Very high	152 Å²	152	76.5 Å²	76.5	67%	0.667	42%	0.417	S	S	*	.	H	α-helix	trans	-58.7	-47.1	176.5	179	-93.1	0	0	0	111.4	F44 S52	F44-F48 VanDerWaalsContact O-CB 3.3Å; F44-F48 WeakPolarHBondContact O-CB 3.4Å; F44-F48 PolarHBondContact O-N 3.34Å; F48-S52 WeakPolarHBondContact O-CB 3.45Å; F48-S52 PolarHBondContact O-N 2.82Å; F48-S52 VanDerWaalsContact O-N 3.17Å; F48-S52 PolarHBondContact O-OG 2.97Å
49	W	97.3	Very high	96.1	Very high	52 Å²	52	78.4 Å²	78.4	20%	0.197	43%	0.433	C	S	.	.	H	α-helix	trans	-63.4	-45.1	176.3	172.6	81.3	0	0	0	112.1	P6 L7 M10 C45 Y46 L47 S52 S53	P6-W49 HydrophobicContact CB-CZ2 4.47Å; L7-W49 HydrophobicContact CD1-CH2 3.95Å; L7-W49 HydrophobicContact CD1-CZ3 4.04Å; M10-W49 HydrophobicContact CB-CD2 4Å; M10-W49 HydrophobicContact CB-CE3 3.9Å; M10-W49 HydrophobicContact CB-CH2 3.79Å; M10-W49 HydrophobicContact CB-CZ2 3.82Å; M10-W49 HydrophobicContact CB-CZ3 3.79Å; M10-W49 HydrophobicContact CG-CD2 4.08Å; M10-W49 HydrophobicContact CG-CE3 4.47Å; M10-W49 HydrophobicContact CG-CH2 4.11Å; M10-W49 HydrophobicContact CG-CZ2 3.62Å; M10-W49 HydrophobicContact CG-CZ3 4.49Å; C45-W49 WeakPolarHBondContact O-CB 3.3Å; C45-W49 PolarHBondContact O-N 2.77Å; Y46-W49 HydrophobicContact CD2-CE3 4.14Å; Y46-W49 AromaticContact CE2-CE3 3.99Å; Y46-W49 HydrophobicContact CE2-CE3 3.99Å; Y46-W49 AromaticContact CE2-CZ3 3.95Å; Y46-W49 HydrophobicContact CE2-CZ3 3.95Å; Y46-W49 PolarHBondContact O-N 2.97Å; L47-W49 VanDerWaalsContact C-N 3.34Å; L47-W49 PolarHBondContact O-N 2.8Å; W49-S52 PolarHBondContact O-OG 2.83Å; W49-S53 PolarHBondContact NE1-OG 2.92Å; W49-S53 VanDerWaalsContact O-CB 3.28Å; W49-S53 WeakPolarHBondContact O-CB 3.45Å; W49-S53 PolarHBondContact O-N 3.31Å; W49-S53 PolarHBondContact O-OG 3.42Å
50	L	96.9	Very high	95.9	Very high	32 Å²	32	84.8 Å²	84.8	17%	0.168	46%	0.461	C	S	.	.	H	α-helix	trans	-64.1	-47.7	-177.4	-179.9	64.2	0	0	0	110.9	L7 Y46 L47 S53 M54	L7-L50 HydrophobicContact CD1-CD1 3.85Å; Y46-L50 HydrophobicContact CE1-CD2 3.91Å; Y46-L50 VanDerWaalsContact O-CB 3.26Å; Y46-L50 WeakPolarHBondContact O-CB 3.3Å; Y46-L50 PolarHBondContact O-N 3.47Å; L47-L50 PolarHBondContact O-N 2.9Å; L50-S53 PolarHBondContact O-N 3.06Å; L50-M54 HydrophobicContact CD1-CG 4.02Å; L50-M54 HydrophobicContact CD1-SD 4.12Å; L50-M54 HydrophobicContact CG-CE 4.48Å; L50-M54 HydrophobicContact CG-CG 4.32Å; L50-M54 HydrophobicContact CG-SD 4.13Å; L50-M54 WeakPolarHBondContact O-CB 3.48Å; L50-M54 VanDerWaalsContact O-CG 3.26Å; L50-M54 WeakPolarHBondContact O-CG 3.26Å; L50-M54 PolarHBondContact O-N 3.32Å
51	M	97.2	Very high	95.8	Very high	116 Å²	116	90.5 Å²	90.5	57%	0.571	48%	0.482	S	S	*	.	H	α-helix	trans	-62.8	-46	-179.8	-70	-173.7	-67.3	0	0	112	L47 S53 M54 A55	L47-M51 HydrophobicContact CB-CE 4.38Å; L47-M51 WeakPolarHBondContact O-CB 3.4Å; L47-M51 WeakPolarHBondContact O-CE 3.26Å; L47-M51 VanDerWaalsContact O-CG 3.3Å; L47-M51 WeakPolarHBondContact O-CG 3.42Å; L47-M51 PolarHBondContact O-N 3.4Å; M51-S53 VanDerWaalsContact C-N 3.3Å; M51-S53 PolarHBondContact O-N 3.33Å; M51-M54 PolarHBondContact O-N 3.17Å; M51-A55 WeakPolarHBondContact O-CB 3.3Å; M51-A55 PolarHBondContact O-N 2.88Å
52	S	95.4	Very high	95.5	Very high	49 Å²	49	90 Å²	90	34%	0.343	49%	0.486	S	S	.	.	H	α-helix	trans	-65.2	-33.7	178.3	55.4	0	0	0	0	112.9	F48 W49 Q56	F48-S52 WeakPolarHBondContact O-CB 3.45Å; F48-S52 PolarHBondContact O-N 2.82Å; F48-S52 VanDerWaalsContact O-N 3.17Å; F48-S52 PolarHBondContact O-OG 2.97Å; W49-S52 PolarHBondContact O-OG 2.83Å; S52-Q56 PolarHBondContact O-NE2 3.49Å
53	S	94.4	Very high	95.3	Very high	36 Å²	36	95 Å²	95	25%	0.252	52%	0.518	S	S	.	.	H	α-helix	trans	-72.7	-46.2	175.7	-58.7	0	0	0	0	111.6	W49 L50 M51 A55 Q56	W49-S53 PolarHBondContact NE1-OG 2.92Å; W49-S53 VanDerWaalsContact O-CB 3.28Å; W49-S53 WeakPolarHBondContact O-CB 3.45Å; W49-S53 PolarHBondContact O-N 3.31Å; W49-S53 PolarHBondContact O-OG 3.42Å; L50-S53 PolarHBondContact O-N 3.06Å; M51-S53 VanDerWaalsContact C-N 3.3Å; M51-S53 PolarHBondContact O-N 3.33Å; S53-A55 VanDerWaalsContact C-N 3.27Å; S53-A55 PolarHBondContact O-N 3.42Å; S53-Q56 PolarHBondContact O-N 2.84Å
54	M	92.9	Very high	95	Very high	115 Å²	115	99.6 Å²	99.6	57%	0.567	54%	0.539	S	S	*	.	H	α-helix	trans	-62.1	-34.8	179.3	-73.6	-167.3	-36.3	0	0	112.5	L50 M51 Q56 V57	L50-M54 HydrophobicContact CD1-CG 4.02Å; L50-M54 HydrophobicContact CD1-SD 4.12Å; L50-M54 HydrophobicContact CG-CE 4.48Å; L50-M54 HydrophobicContact CG-CG 4.32Å; L50-M54 HydrophobicContact CG-SD 4.13Å; L50-M54 WeakPolarHBondContact O-CB 3.48Å; L50-M54 VanDerWaalsContact O-CG 3.26Å; L50-M54 WeakPolarHBondContact O-CG 3.26Å; L50-M54 PolarHBondContact O-N 3.32Å; M51-M54 PolarHBondContact O-N 3.17Å; M54-Q56 PolarHBondContact O-N 3.06Å; M54-Q56 VanDerWaalsContact O-N 3.11Å; M54-V57 PolarHBondContact O-N 2.94Å
55	A	94.1	Very high	94.8	Very high	79 Å²	79	96.6 Å²	96.6	65%	0.653	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-22.5	176	0	0	0	0	0	113.3	M51 S53	M51-A55 WeakPolarHBondContact O-CB 3.3Å; M51-A55 PolarHBondContact O-N 2.88Å; S53-A55 VanDerWaalsContact C-N 3.27Å; S53-A55 PolarHBondContact O-N 3.42Å
56	Q	93.4	Very high	94.6	Very high	146 Å²	146	100.1 Å²	100.1	68%	0.682	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.1	-3	-176.1	-66.4	174	72.2	0	0	113.8	S52 S53 M54 N58 P59	S52-Q56 PolarHBondContact O-NE2 3.49Å; S53-Q56 PolarHBondContact O-N 2.84Å; M54-Q56 PolarHBondContact O-N 3.06Å; M54-Q56 VanDerWaalsContact O-N 3.11Å; Q56-N58 VanDerWaalsContact C-N 3.35Å; Q56-N58 PolarHBondContact O-N 2.91Å; Q56-P59 WeakPolarHBondContact O-CD 3.46Å
57	V	91.9	Very high	94.3	Very high	73 Å²	73	107.4 Å²	107.4	44%	0.442	57%	0.566	S	S	.	*	S	Bend	trans	-68.2	-34.9	-175.5	178	0	0	0	0	112	M54	M54-V57 PolarHBondContact O-N 2.94Å
58	N	93.1	Very high	94.2	Very high	139 Å²	139	109 Å²	109	74%	0.743	58%	0.576	S	S	*	*	S	Bend	trans	-132.1	76.2	177	-64.4	-73.6	0	0	0	109.9	Q56	Q56-N58 VanDerWaalsContact C-N 3.35Å; Q56-N58 PolarHBondContact O-N 2.91Å
59	P	93.3	Very high	94	Very high	95 Å²	95	104.9 Å²	104.9	62%	0.617	56%	0.563	S	S	*	*			trans	-71.2	136	-175.9	29.8	-32.4	0	0	0	110.5	Q56	Q56-P59 WeakPolarHBondContact O-CD 3.46Å
60	L	94.1	Very high	93.7	Very high	169 Å²	169	105.9 Å²	105.9	89%	0.885	57%	0.571	S	S	*	*	S	Bend	trans	-82.1	-24.7	177.3	-65	174.3	0	0	0	112.8
61	F	93.5	Very high	93.4	Very high	176 Å²	176	113.6 Å²	113.6	77%	0.772	60%	0.598	S	S	*	*			trans	-141.3	148	-177	49.4	-95.7	0	0	0	110.6
62	G	92	Very high	93.1	Very high	53 Å²	53	113.1 Å²	113.1	55%	0.546	60%	0.597	S	S	.	*			trans	-97.6	170.5	173.8	0	0	0	0	0	112.6
63	P	93.2	Very high	92.9	Very high	114 Å²	114	113.2 Å²	113.2	74%	0.74	59%	0.593	S	S	*	*			trans	-68.4	138.7	175.4	28.7	-34	0	0	0	111.7	L65	P63-L65 HydrophobicContact CB-CD1 3.96Å; P63-L65 HydrophobicContact CG-CD1 3.92Å
64	I	92.7	Very high	92.6	Very high	174 Å²	174	118 Å²	118	89%	0.892	61%	0.612	S	S	*	*			trans	-98.5	109.5	176.1	-56.1	172.9	0	0	0	108.2
65	L	93.1	Very high	92.4	Very high	78 Å²	78	122.5 Å²	122.5	41%	0.408	62%	0.622	S	S	.	*			trans	-113	148.6	-174	-67.2	124.2	0	0	0	112.1	P63 T69 I70	P63-L65 HydrophobicContact CB-CD1 3.96Å; P63-L65 HydrophobicContact CG-CD1 3.92Å; L65-T69 HydrophobicContact CD2-CG2 3.6Å; L65-I70 HydrophobicContact CB-CD1 4.23Å; L65-I70 HydrophobicContact CB-CG1 3.79Å
66	H	94.1	Very high	92.3	Very high	128 Å²	128	124.6 Å²	124.6	59%	0.593	62%	0.619	S	S	*	*			trans	-71.4	152.8	172.8	-162.3	73.4	0	0	0	111.1	D68 T69 I70	H66-D68 VanDerWaalsContact C-N 3.27Å; H66-D68 IonicContact CD2-OD2 3.62Å; H66-D68 IonicContact NE2-OD2 3.8Å; H66-D68 PolarHBondContact O-N 3.33Å; H66-T69 WeakPolarHBondContact O-CB 3.44Å; H66-T69 PolarHBondContact O-N 2.96Å; H66-I70 WeakPolarHBondContact O-CG1 3.46Å; H66-I70 PolarHBondContact O-N 2.79Å
67	R	92	Very high	92.1	Very high	207 Å²	207	125.8 Å²	125.8	78%	0.781	62%	0.617	S	S	*	*	H	α-helix	trans	-56.8	-40.6	-176.1	-66.8	-179.6	-177.5	-102.1	0.9	112.5	I70 R71	R67-I70 PolarHBondContact O-N 3.31Å; R67-R71 PolarHBondContact O-N 2.98Å
68	D	95.1	Very high	91.3	Very high	106 Å²	106	130.9 Å²	130.9	57%	0.567	64%	0.636	S	S	*	*	H	α-helix	trans	-65.1	-41	178.1	-60.4	-28.4	0	0	0	111.9	H66 I70 R71 I72	H66-D68 VanDerWaalsContact C-N 3.27Å; H66-D68 IonicContact CD2-OD2 3.62Å; H66-D68 IonicContact NE2-OD2 3.8Å; H66-D68 PolarHBondContact O-N 3.33Å; D68-I70 VanDerWaalsContact C-N 3.35Å; D68-I70 PolarHBondContact O-N 3Å; D68-R71 PolarHBondContact O-N 3.24Å; D68-I72 WeakPolarHBondContact O-CG1 3.39Å; D68-I72 PolarHBondContact O-N 3.45Å
69	T	93.8	Very high	89.8	Confident	66 Å²	66	129.2 Å²	129.2	41%	0.405	63%	0.633	S	S	.	*	H	α-helix	trans	-63.5	-41.8	175.5	-46.5	0	0	0	0	111.3	L65 H66 R71 I72 L73	L65-T69 HydrophobicContact CD2-CG2 3.6Å; H66-T69 WeakPolarHBondContact O-CB 3.44Å; H66-T69 PolarHBondContact O-N 2.96Å; T69-R71 VanDerWaalsContact C-N 3.32Å; T69-R71 PolarHBondContact O-N 3.33Å; T69-I72 PolarHBondContact O-N 3.11Å; T69-L73 WeakPolarHBondContact O-CB 3.4Å; T69-L73 PolarHBondContact O-N 3.34Å
70	I	91.3	Very high	88.3	Confident	72 Å²	72	129.7 Å²	129.7	37%	0.369	63%	0.629	S	S	.	*	H	α-helix	trans	-60.8	-43.3	175.6	-65.4	168.6	0	0	0	110.3	L65 H66 R67 D68 I72 L73 Q74	L65-I70 HydrophobicContact CB-CD1 4.23Å; L65-I70 HydrophobicContact CB-CG1 3.79Å; H66-I70 WeakPolarHBondContact O-CG1 3.46Å; H66-I70 PolarHBondContact O-N 2.79Å; R67-I70 PolarHBondContact O-N 3.31Å; D68-I70 VanDerWaalsContact C-N 3.35Å; D68-I70 PolarHBondContact O-N 3Å; I70-I72 PolarHBondContact O-N 2.9Å; I70-L73 PolarHBondContact O-N 3.01Å; I70-Q74 HydrophobicContact CG2-CG 4.44Å; I70-Q74 WeakPolarHBondContact O-CG 3.42Å; I70-Q74 PolarHBondContact O-N 3.47Å
71	R	90	Very high	86.4	Confident	194 Å²	194	132.9 Å²	132.9	73%	0.732	63%	0.629	S	S	*	*	H	α-helix	trans	-64	-39.7	179.4	-169.5	177.1	-177.8	112.4	0	112.4	R67 D68 T69 R75	R67-R71 PolarHBondContact O-N 2.98Å; D68-R71 PolarHBondContact O-N 3.24Å; T69-R71 VanDerWaalsContact C-N 3.32Å; T69-R71 PolarHBondContact O-N 3.33Å; R71-R75 PolarHBondContact O-N 3.46Å
72	I	92	Very high	84.7	Confident	106 Å²	106	130.1 Å²	130.1	54%	0.544	63%	0.627	S	S	.	*	H	α-helix	trans	-66.1	-46.2	174.3	-66.1	166.3	0	0	0	109.9	D68 T69 I70 Q74 R75 E76	D68-I72 WeakPolarHBondContact O-CG1 3.39Å; D68-I72 PolarHBondContact O-N 3.45Å; T69-I72 PolarHBondContact O-N 3.11Å; I70-I72 PolarHBondContact O-N 2.9Å; I72-Q74 VanDerWaalsContact C-N 3.3Å; I72-Q74 PolarHBondContact O-N 3.25Å; I72-R75 WeakPolarHBondContact O-CB 3.35Å; I72-R75 PolarHBondContact O-N 2.95Å; I72-E76 HydrophobicContact CG2-CG 3.96Å; I72-E76 WeakPolarHBondContact O-CG 3.43Å; I72-E76 PolarHBondContact O-N 2.98Å
73	L	91.4	Very high	82.4	Confident	52 Å²	52	139 Å²	139	27%	0.272	66%	0.66	S	S	.	*	H	α-helix	trans	-58.4	-43.2	-179.8	-158	85	0	0	0	111.7	T69 I70 R75 E76 W77 I80	T69-L73 WeakPolarHBondContact O-CB 3.4Å; T69-L73 PolarHBondContact O-N 3.34Å; I70-L73 PolarHBondContact O-N 3.01Å; L73-R75 PolarHBondContact O-N 3.24Å; L73-E76 PolarHBondContact O-N 3.06Å; L73-W77 HydrophobicContact CD1-CD2 3.99Å; L73-W77 HydrophobicContact CD1-CE3 4.14Å; L73-W77 HydrophobicContact CD1-CG 4.45Å; L73-W77 HydrophobicContact CD1-CZ2 4.5Å; L73-W77 HydrophobicContact CD1-CZ3 4.45Å; L73-W77 HydrophobicContact CG-CD2 4.38Å; L73-W77 HydrophobicContact CG-CE3 4.41Å; L73-W77 WeakPolarHBondContact O-CB 3.46Å; L73-W77 PolarHBondContact O-N 3.49Å; L73-I80 HydrophobicContact CD2-CD1 3.91Å
74	Q	86.9	Confident	81.8	Confident	135 Å²	135	140.2 Å²	140.2	63%	0.631	66%	0.656	S	S	*	*	H	α-helix	trans	-65.1	-25.1	176.6	-73.9	178.5	-34.1	0	0	113.9	I70 I72	I70-Q74 HydrophobicContact CG2-CG 4.44Å; I70-Q74 WeakPolarHBondContact O-CG 3.42Å; I70-Q74 PolarHBondContact O-N 3.47Å; I72-Q74 VanDerWaalsContact C-N 3.3Å; I72-Q74 PolarHBondContact O-N 3.25Å
75	R	88.7	Confident	81.2	Confident	210 Å²	210	138.4 Å²	138.4	79%	0.792	64%	0.644	S	S	*	*	H	α-helix	trans	-83.8	-44.3	178.2	-179.3	-175.5	178.6	-177	-1.4	111.6	R71 I72 L73	R71-R75 PolarHBondContact O-N 3.46Å; I72-R75 WeakPolarHBondContact O-CB 3.35Å; I72-R75 PolarHBondContact O-N 2.95Å; L73-R75 PolarHBondContact O-N 3.24Å
76	E	92.1	Very high	80.6	Confident	124 Å²	124	141.8 Å²	141.8	58%	0.579	66%	0.657	S	S	*	*	H	α-helix	trans	-87.6	-31	-170.3	-61.1	-55.8	148.8	0	0	112.8	I72 L73	I72-E76 HydrophobicContact CG2-CG 3.96Å; I72-E76 WeakPolarHBondContact O-CG 3.43Å; I72-E76 PolarHBondContact O-N 2.98Å; L73-E76 PolarHBondContact O-N 3.06Å
77	W	90.2	Very high	79.8	Confident	171 Å²	171	142.6 Å²	142.6	65%	0.648	66%	0.66	S	S	*	*	S	Bend	trans	-103.9	141.3	179.4	-66.1	14.9	0	0	0	108.9	L73	L73-W77 HydrophobicContact CD1-CD2 3.99Å; L73-W77 HydrophobicContact CD1-CE3 4.14Å; L73-W77 HydrophobicContact CD1-CG 4.45Å; L73-W77 HydrophobicContact CD1-CZ2 4.5Å; L73-W77 HydrophobicContact CD1-CZ3 4.45Å; L73-W77 HydrophobicContact CG-CD2 4.38Å; L73-W77 HydrophobicContact CG-CE3 4.41Å; L73-W77 WeakPolarHBondContact O-CB 3.46Å; L73-W77 PolarHBondContact O-N 3.49Å
78	E	75.2	Confident	79	Confident	180 Å²	180	138.6 Å²	138.6	84%	0.841	65%	0.653	S	S	*	*			trans	-50.6	144.8	176.3	-83.2	-160.9	165.2	0	0	110.7	I80	E78-I80 PolarHBondContact O-N 3.25Å
79	P	61.8	Low	78	Confident	103 Å²	103	140.7 Å²	140.7	67%	0.669	66%	0.659	S	S	*	*			trans	-54.8	112.1	-171.7	19.7	-30.9	0	0	0	109.8	R81	P79-R81 VanDerWaalsContact C-N 3.29Å; P79-R81 PolarHBondContact O-N 3.32Å
80	I	61.1	Low	76.8	Confident	106 Å²	106	146.1 Å²	146.1	54%	0.544	68%	0.677	S	S	.	*			trans	-61.9	94.3	173.5	-61.5	167.6	0	0	0	105.8	L73 E78 V82	L73-I80 HydrophobicContact CD2-CD1 3.91Å; E78-I80 PolarHBondContact O-N 3.25Å; I80-V82 HydrophobicContact CB-CG2 4.47Å; I80-V82 HydrophobicContact CG2-CG2 3.25Å; I80-V82 PolarHBondContact O-N 2.99Å
81	R	55.3	Low	75.7	Confident	236 Å²	236	151.8 Å²	151.8	89%	0.891	70%	0.7	S	S	*	*			trans	-71.1	61.4	-177.2	-63.9	-164	-151	-156.5	6.4	112.2	P79	P79-R81 VanDerWaalsContact C-N 3.29Å; P79-R81 PolarHBondContact O-N 3.32Å
82	V	56.6	Low	74.5	Confident	118 Å²	118	148.3 Å²	148.3	72%	0.715	70%	0.698	S	S	*	*			trans	-126.5	30.5	172.5	-79.9	0	0	0	0	112	I80	I80-V82 HydrophobicContact CB-CG2 4.47Å; I80-V82 HydrophobicContact CG2-CG2 3.25Å; I80-V82 PolarHBondContact O-N 2.99Å
83	L	43.1	Very low	72.9	Confident	238 Å²	238	152.1 Å²	152.1	100%	1.246	71%	0.712	S	S	*	*			trans	-121.7	0	152.1	-69.6	173.2	0	0	0	108.7

Retrieved 83 of 83 residues in 18.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).