A0A146MIG6_SCHMA Loading...

V-type proton ATPase subunit

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A146MIG6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 83 aa.

						>A0A146MIG6_SCHMA|A0A146MIG6
MGYEVPLTVMTVFWLLVGCGGPLIVPKGPNRPLIQLMLATSSVFCYLFWLMSSMAQVNPLFGPILHRDTIRILQREWEPIRVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.6	Low	90.6	Very high	174 Å²	174	87.5 Å²	87.5	86%	0.857	49%	0.491	S	S	*	.				0	9	0	-56.7	-58.8	172.2	0	0	115.3	E4	M1-E4 WeakPolarHBondContact CA-OE1 3.14Å; M1-E4 PolarHBondContact N-OE1 3.09Å
2	G	83.9	Confident	91.2	Very high	64 Å²	64	86.3 Å²	86.3	66%	0.66	49%	0.487	S	S	*	.			trans	-79.9	-66.1	-178	0	0	0	0	0	113.2	P6	G2-P6 VanDerWaalsContact O-CD 3.3Å; G2-P6 WeakPolarHBondContact O-CD 3.38Å
3	Y	88.2	Confident	91.8	Very high	146 Å²	146	87.6 Å²	87.6	57%	0.573	48%	0.484	S	S	*	.	S	Bend	trans	-83.7	-18.6	-177.1	67.6	-91.3	0	0	0	113.6	V5 P6 L7	Y3-V5 PolarHBondContact O-N 3.34Å; Y3-P6 VanDerWaalsContact O-CD 3.26Å; Y3-P6 WeakPolarHBondContact O-CD 3.45Å; Y3-P6 VanDerWaalsContact O-CG 3.27Å; Y3-P6 WeakPolarHBondContact O-CG 3.47Å; Y3-L7 VanDerWaalsContact O-CB 3.3Å; Y3-L7 WeakPolarHBondContact O-CB 3.28Å; Y3-L7 PolarHBondContact O-N 3.22Å; Y3-L7 VanDerWaalsContact O-N 3.12Å
4	E	91.9	Very high	92.2	Very high	77 Å²	77	85.2 Å²	85.2	36%	0.36	46%	0.464	S	S	.	.	H	α-helix	trans	-63.4	-43.7	-176.4	-63.8	165.5	-110.4	0	0	111.5	M1 L7 T8	M1-E4 WeakPolarHBondContact CA-OE1 3.14Å; M1-E4 PolarHBondContact N-OE1 3.09Å; E4-L7 PolarHBondContact O-N 3.06Å; E4-T8 PolarHBondContact O-N 3.12Å; E4-T8 PolarHBondContact O-OG1 3.24Å; E4-T8 VanDerWaalsContact O-OG1 3.09Å
5	V	95.1	Very high	92.5	Very high	86 Å²	86	86.5 Å²	86.5	52%	0.521	47%	0.47	S	S	.	.	H	α-helix	trans	-58.8	-56.1	179.7	178	0	0	0	0	112	Y3 L7 T8 V9	Y3-V5 PolarHBondContact O-N 3.34Å; V5-L7 VanDerWaalsContact C-N 3.28Å; V5-L7 PolarHBondContact O-N 3.2Å; V5-T8 PolarHBondContact O-N 3.15Å; V5-V9 HydrophobicContact CG1-CG2 4.47Å; V5-V9 WeakPolarHBondContact O-CG2 3.47Å; V5-V9 PolarHBondContact O-N 2.83Å
6	P	95.2	Very high	92.8	Very high	56 Å²	56	88.4 Å²	88.4	36%	0.364	48%	0.478	S	S	.	.	H	α-helix	trans	-63.5	-35.4	178.5	22.7	-32	0	0	0	112.1	G2 Y3 M10 W49	G2-P6 VanDerWaalsContact O-CD 3.3Å; G2-P6 WeakPolarHBondContact O-CD 3.38Å; Y3-P6 VanDerWaalsContact O-CD 3.26Å; Y3-P6 WeakPolarHBondContact O-CD 3.45Å; Y3-P6 VanDerWaalsContact O-CG 3.27Å; Y3-P6 WeakPolarHBondContact O-CG 3.47Å; P6-M10 VanDerWaalsContact O-CB 3.26Å; P6-M10 WeakPolarHBondContact O-CB 3.35Å; P6-M10 VanDerWaalsContact O-CG 3.22Å; P6-M10 WeakPolarHBondContact O-CG 3.05Å; P6-M10 PolarHBondContact O-N 3.44Å; P6-W49 HydrophobicContact CB-CZ2 4.47Å
7	L	95.6	Very high	93.1	Very high	65 Å²	65	85.8 Å²	85.8	34%	0.34	47%	0.466	S	S	.	.	H	α-helix	trans	-60.6	-50.1	176.2	-171.6	69.4	0	0	0	112	Y3 E4 V5 T11 W49 L50	Y3-L7 VanDerWaalsContact O-CB 3.3Å; Y3-L7 WeakPolarHBondContact O-CB 3.28Å; Y3-L7 PolarHBondContact O-N 3.22Å; Y3-L7 VanDerWaalsContact O-N 3.12Å; E4-L7 PolarHBondContact O-N 3.06Å; V5-L7 VanDerWaalsContact C-N 3.28Å; V5-L7 PolarHBondContact O-N 3.2Å; L7-T11 VanDerWaalsContact O-CB 3.24Å; L7-T11 WeakPolarHBondContact O-CB 3.38Å; L7-T11 PolarHBondContact O-N 3.27Å; L7-T11 PolarHBondContact O-OG1 3.19Å; L7-W49 HydrophobicContact CD1-CH2 3.95Å; L7-W49 HydrophobicContact CD1-CZ3 4.04Å; L7-L50 HydrophobicContact CD1-CD1 3.85Å
8	T	96.3	Very high	93.3	Very high	89 Å²	89	81.7 Å²	81.7	55%	0.546	45%	0.447	S	S	.	.	H	α-helix	trans	-63.1	-48.2	178.6	-57.9	0	0	0	0	111.4	E4 V5 M10 T11 V12	E4-T8 PolarHBondContact O-N 3.12Å; E4-T8 PolarHBondContact O-OG1 3.24Å; E4-T8 VanDerWaalsContact O-OG1 3.09Å; V5-T8 PolarHBondContact O-N 3.15Å; T8-M10 PolarHBondContact O-N 3.44Å; T8-T11 PolarHBondContact O-N 2.78Å; T8-V12 HydrophobicContact CG2-CG2 4.47Å; T8-V12 WeakPolarHBondContact O-CG2 3.42Å; T8-V12 PolarHBondContact O-N 3.02Å
9	V	97.1	Very high	93.4	Very high	86 Å²	86	81.4 Å²	81.4	52%	0.521	45%	0.45	S	S	.	.	H	α-helix	trans	-61.7	-48.3	-177.8	171.9	0	0	0	0	111.3	V5 V12 F13	V5-V9 HydrophobicContact CG1-CG2 4.47Å; V5-V9 WeakPolarHBondContact O-CG2 3.47Å; V5-V9 PolarHBondContact O-N 2.83Å; V9-V12 PolarHBondContact O-N 3.2Å; V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.47Å; V9-F13 PolarHBondContact O-N 2.96Å
10	M	97	Very high	93.4	Very high	68 Å²	68	78.6 Å²	78.6	34%	0.335	44%	0.441	S	S	.	.	H	α-helix	trans	-69.3	-36.2	-177.8	-67.5	-64.6	-178.8	0	0	112.1	P6 T8 W14 W49	P6-M10 VanDerWaalsContact O-CB 3.26Å; P6-M10 WeakPolarHBondContact O-CB 3.35Å; P6-M10 VanDerWaalsContact O-CG 3.22Å; P6-M10 WeakPolarHBondContact O-CG 3.05Å; P6-M10 PolarHBondContact O-N 3.44Å; T8-M10 PolarHBondContact O-N 3.44Å; M10-W14 VanDerWaalsContact O-CD1 3.28Å; M10-W14 PolarHBondContact O-N 3.44Å; M10-W49 HydrophobicContact CB-CD2 4Å; M10-W49 HydrophobicContact CB-CE3 3.9Å; M10-W49 HydrophobicContact CB-CH2 3.79Å; M10-W49 HydrophobicContact CB-CZ2 3.82Å; M10-W49 HydrophobicContact CB-CZ3 3.79Å; M10-W49 HydrophobicContact CG-CD2 4.08Å; M10-W49 HydrophobicContact CG-CE3 4.47Å; M10-W49 HydrophobicContact CG-CH2 4.11Å; M10-W49 HydrophobicContact CG-CZ2 3.62Å; M10-W49 HydrophobicContact CG-CZ3 4.49Å
11	T	97.2	Very high	93.5	Very high	52 Å²	52	75.4 Å²	75.4	32%	0.319	43%	0.426	S	S	.	.	H	α-helix	trans	-63.9	-48.7	175.3	-55.9	0	0	0	0	110.9	L7 T8 F13 L15 Y46	L7-T11 VanDerWaalsContact O-CB 3.24Å; L7-T11 WeakPolarHBondContact O-CB 3.38Å; L7-T11 PolarHBondContact O-N 3.27Å; L7-T11 PolarHBondContact O-OG1 3.19Å; T8-T11 PolarHBondContact O-N 2.78Å; T11-F13 PolarHBondContact O-N 3.45Å; T11-L15 WeakPolarHBondContact O-CB 3.27Å; T11-L15 PolarHBondContact O-N 3.34Å; T11-Y46 PolarHBondContact OG1-OH 3.04Å
12	V	98	Very high	95.2	Very high	73 Å²	73	68 Å²	68	44%	0.442	39%	0.391	S	S	.	.	H	α-helix	trans	-63.6	-43.6	178.8	171.8	0	0	0	0	110.8	T8 V9 L15 L16	T8-V12 HydrophobicContact CG2-CG2 4.47Å; T8-V12 WeakPolarHBondContact O-CG2 3.42Å; T8-V12 PolarHBondContact O-N 3.02Å; V9-V12 PolarHBondContact O-N 3.2Å; V12-L15 PolarHBondContact O-N 2.91Å; V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 HydrophobicContact CG1-CG 4.33Å; V12-L16 WeakPolarHBondContact O-CB 3.28Å; V12-L16 VanDerWaalsContact O-CG 3.29Å; V12-L16 WeakPolarHBondContact O-CG 3.23Å; V12-L16 PolarHBondContact O-N 3.47Å
13	F	97.9	Very high	95.8	Very high	103 Å²	103	71.5 Å²	71.5	45%	0.452	39%	0.394	S	S	.	.	H	α-helix	trans	-57.1	-53.8	178.2	175	-96.3	0	0	0	111.7	V9 T11 L15 L16 V17	V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.47Å; V9-F13 PolarHBondContact O-N 2.96Å; T11-F13 PolarHBondContact O-N 3.45Å; F13-L15 VanDerWaalsContact C-N 3.35Å; F13-L15 PolarHBondContact O-N 2.83Å; F13-L16 PolarHBondContact O-N 2.91Å; F13-V17 HydrophobicContact CE1-CG2 4.17Å; F13-V17 HydrophobicContact CE2-CG2 4.45Å; F13-V17 HydrophobicContact CZ-CG2 4.1Å; F13-V17 WeakPolarHBondContact O-CG2 3.29Å; F13-V17 PolarHBondContact O-N 2.99Å
14	W	98	Very high	96.1	Very high	54 Å²	54	71.3 Å²	71.3	21%	0.205	40%	0.401	C	S	.	.	H	α-helix	trans	-71.4	-29.9	-178	-75.2	114.4	0	0	0	113.1	M10 V17 G18 C45 Y46	M10-W14 VanDerWaalsContact O-CD1 3.28Å; M10-W14 PolarHBondContact O-N 3.44Å; W14-V17 HydrophobicContact CE3-CB 4.13Å; W14-V17 HydrophobicContact CE3-CG1 4.23Å; W14-V17 HydrophobicContact CE3-CG2 4.42Å; W14-V17 HydrophobicContact CZ3-CB 4.49Å; W14-V17 HydrophobicContact CZ3-CG1 4.17Å; W14-V17 PolarHBondContact O-N 3.49Å; W14-G18 PolarHBondContact O-N 3.04Å; W14-C45 HydrophobicContact CD2-CB 4.28Å; W14-C45 HydrophobicContact CE3-CB 4.3Å; W14-C45 HydrophobicContact CH2-CB 3.37Å; W14-C45 HydrophobicContact CZ2-CB 3.35Å; W14-C45 HydrophobicContact CZ3-CB 3.87Å; W14-Y46 HydrophobicContact CB-CD2 4.1Å; W14-Y46 HydrophobicContact CB-CG 4.3Å; W14-Y46 AromaticContact CD1-CD2 3.86Å; W14-Y46 HydrophobicContact CG-CD2 4.26Å
15	L	96.6	Very high	96.3	Very high	105 Å²	105	68.3 Å²	68.3	55%	0.55	39%	0.388	S	S	.	.	H	α-helix	trans	-63.6	-42.3	170.8	-174.7	69	0	0	0	111.5	T11 V12 F13 G18 C19	T11-L15 WeakPolarHBondContact O-CB 3.27Å; T11-L15 PolarHBondContact O-N 3.34Å; V12-L15 PolarHBondContact O-N 2.91Å; F13-L15 VanDerWaalsContact C-N 3.35Å; F13-L15 PolarHBondContact O-N 2.83Å; L15-G18 PolarHBondContact O-N 3.38Å; L15-C19 VanDerWaalsContact O-CB 3.28Å; L15-C19 WeakPolarHBondContact O-CB 3.29Å; L15-C19 PolarHBondContact O-N 3.04Å
16	L	97.6	Very high	96.3	Very high	116 Å²	116	69.2 Å²	69.2	61%	0.607	40%	0.396	S	S	*	.	I	π-helix	trans	-65.1	-39.3	175.7	-72.6	173	0	0	0	111.8	V12 F13 G20 G21	V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 HydrophobicContact CG1-CG 4.33Å; V12-L16 WeakPolarHBondContact O-CB 3.28Å; V12-L16 VanDerWaalsContact O-CG 3.29Å; V12-L16 WeakPolarHBondContact O-CG 3.23Å; V12-L16 PolarHBondContact O-N 3.47Å; F13-L16 PolarHBondContact O-N 2.91Å; L16-G20 CarbonylContact O-C 3.46Å; L16-G20 WeakPolarHBondContact O-CA 3.3Å; L16-G20 PolarHBondContact O-N 3.24Å; L16-G21 PolarHBondContact O-N 3.33Å
17	V	97.4	Very high	96.2	Very high	44 Å²	44	76.4 Å²	76.4	27%	0.267	42%	0.422	S	S	.	.	I	π-helix	trans	-67.6	-46.1	175.7	176	0	0	0	0	111.2	F13 W14 G21 P22	F13-V17 HydrophobicContact CE1-CG2 4.17Å; F13-V17 HydrophobicContact CE2-CG2 4.45Å; F13-V17 HydrophobicContact CZ-CG2 4.1Å; F13-V17 WeakPolarHBondContact O-CG2 3.29Å; F13-V17 PolarHBondContact O-N 2.99Å; W14-V17 HydrophobicContact CE3-CB 4.13Å; W14-V17 HydrophobicContact CE3-CG1 4.23Å; W14-V17 HydrophobicContact CE3-CG2 4.42Å; W14-V17 HydrophobicContact CZ3-CB 4.49Å; W14-V17 HydrophobicContact CZ3-CG1 4.17Å; W14-V17 PolarHBondContact O-N 3.49Å; V17-G21 WeakPolarHBondContact O-CA 3.3Å; V17-G21 PolarHBondContact O-N 2.91Å; V17-P22 VanDerWaalsContact O-CD 3.3Å; V17-P22 WeakPolarHBondContact O-CD 3.33Å
18	G	96.7	Very high	96.2	Very high	13 Å²	13	75.3 Å²	75.3	13%	0.134	43%	0.425	C	S	.	.	I	π-helix	trans	-77.3	-31	-174.7	0	0	0	0	0	115	W14 L15 P22 S42	W14-G18 PolarHBondContact O-N 3.04Å; L15-G18 PolarHBondContact O-N 3.38Å; G18-P22 VanDerWaalsContact O-CD 3.3Å; G18-P22 WeakPolarHBondContact O-CD 3.35Å; G18-P22 VanDerWaalsContact O-CG 3.23Å; G18-P22 WeakPolarHBondContact O-CG 3.37Å; G18-S42 WeakPolarHBondContact CA-OG 3.24Å
19	C	94.6	Very high	96.2	Very high	75 Å²	75	77.3 Å²	77.3	51%	0.507	44%	0.44	S	S	.	.	I	π-helix	trans	-103.9	-47.3	177.2	-64.3	0	0	0	0	112	L15 L23	L15-C19 VanDerWaalsContact O-CB 3.28Å; L15-C19 WeakPolarHBondContact O-CB 3.29Å; L15-C19 PolarHBondContact O-N 3.04Å; C19-L23 WeakPolarHBondContact O-CD1 3.34Å; C19-L23 VanDerWaalsContact O-CG 3.28Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å
20	G	95.3	Very high	96.2	Very high	26 Å²	26	78.1 Å²	78.1	27%	0.268	44%	0.442	S	S	.	.	I	π-helix	trans	-70.7	-43.9	-179.4	0	0	0	0	0	112.8	L16 L23 I24	L16-G20 CarbonylContact O-C 3.46Å; L16-G20 WeakPolarHBondContact O-CA 3.3Å; L16-G20 PolarHBondContact O-N 3.24Å; G20-L23 WeakPolarHBondContact O-CB 3.43Å; G20-L23 PolarHBondContact O-N 3.45Å; G20-L23 VanDerWaalsContact O-N 3.09Å; G20-I24 PolarHBondContact O-N 2.96Å
21	G	95	Very high	96.1	Very high	12 Å²	12	78.8 Å²	78.8	12%	0.124	44%	0.44	C	S	.	.	H	α-helix	trans	-52.5	-54.4	178.8	0	0	0	0	0	113.2	L16 V17 L23 I24 V25	L16-G21 PolarHBondContact O-N 3.33Å; V17-G21 WeakPolarHBondContact O-CA 3.3Å; V17-G21 PolarHBondContact O-N 2.91Å; G21-L23 PolarHBondContact O-N 3.48Å; G21-I24 WeakPolarHBondContact O-CG1 3.18Å; G21-I24 PolarHBondContact O-N 3.02Å; G21-V25 WeakPolarHBondContact O-CG2 3.14Å
22	P	95.4	Very high	96.1	Very high	19 Å²	19	80.4 Å²	80.4	12%	0.123	45%	0.452	C	S	.	.	H	α-helix	trans	-58.4	-29.5	177.2	-31.9	39.4	0	0	0	115	V17 G18 Q35 L38	V17-P22 VanDerWaalsContact O-CD 3.3Å; V17-P22 WeakPolarHBondContact O-CD 3.33Å; G18-P22 VanDerWaalsContact O-CD 3.3Å; G18-P22 WeakPolarHBondContact O-CD 3.35Å; G18-P22 VanDerWaalsContact O-CG 3.23Å; G18-P22 WeakPolarHBondContact O-CG 3.37Å; P22-Q35 HydrophobicContact CB-CB 4.09Å; P22-Q35 HydrophobicContact CB-CG 3.95Å; P22-Q35 PolarHBondContact O-NE2 3.25Å; P22-L38 HydrophobicContact CG-CB 4.22Å
23	L	94.9	Very high	96.1	Very high	137 Å²	137	81.6 Å²	81.6	72%	0.717	46%	0.455	S	S	*	.	H	α-helix	trans	-72.7	-32.1	-179.1	-65.4	171.9	0	0	0	112.4	C19 G20 G21	C19-L23 WeakPolarHBondContact O-CD1 3.34Å; C19-L23 VanDerWaalsContact O-CG 3.28Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å; G20-L23 WeakPolarHBondContact O-CB 3.43Å; G20-L23 PolarHBondContact O-N 3.45Å; G20-L23 VanDerWaalsContact O-N 3.09Å; G21-L23 PolarHBondContact O-N 3.48Å
24	I	95.5	Very high	96	Very high	142 Å²	142	80.3 Å²	80.3	73%	0.728	45%	0.452	S	S	*	.	H	α-helix	trans	-88.6	-3.8	-178.3	63.8	168.2	0	0	0	114	G20 G21	G20-I24 PolarHBondContact O-N 2.96Å; G21-I24 WeakPolarHBondContact O-CG1 3.18Å; G21-I24 PolarHBondContact O-N 3.02Å
25	V	95.9	Very high	96	Very high	14 Å²	14	79.8 Å²	79.8	9%	0.085	45%	0.452	C	S	.	.			trans	-64.4	123.7	179.7	-177.4	0	0	0	0	110.4	G21 R31 I34 Q35 L38	G21-V25 WeakPolarHBondContact O-CG2 3.14Å; V25-R31 HydrophobicContact CB-CG 4.32Å; V25-R31 HydrophobicContact CG1-CB 4.36Å; V25-R31 HydrophobicContact CG1-CG 3.86Å; V25-R31 PolarHBondContact O-NE 2.83Å; V25-I34 HydrophobicContact CG1-CB 4.07Å; V25-I34 HydrophobicContact CG1-CD1 4.35Å; V25-I34 HydrophobicContact CG1-CG2 3.89Å; V25-I34 HydrophobicContact CG2-CG2 3.94Å; V25-Q35 HydrophobicContact CB-CG 4.17Å; V25-Q35 HydrophobicContact CG2-CG 3.97Å; V25-L38 HydrophobicContact CG2-CD1 3.81Å
26	P	95.4	Very high	96	Very high	105 Å²	105	79.7 Å²	79.7	68%	0.682	45%	0.451	S	S	*	.			trans	-64.6	155.2	-177.9	26	-34	0	0	0	112.1	G28	P26-G28 PolarHBondContact O-N 3.09Å
27	K	93.7	Very high	96	Very high	207 Å²	207	79.4 Å²	79.4	90%	0.9	45%	0.448	S	S	*	.	S	Bend	trans	-70.1	114	178.9	-64.2	-179.3	-177.1	177.4	0	109.3
28	G	94.9	Very high	96	Very high	41 Å²	41	80 Å²	80	42%	0.423	45%	0.45	S	S	.	.	S	Bend	trans	-159.4	171	176.6	0	0	0	0	0	111.3	P26 N30 R31	P26-G28 PolarHBondContact O-N 3.09Å; G28-N30 PolarHBondContact O-N 3.42Å; G28-N30 VanDerWaalsContact O-N 3.15Å; G28-R31 WeakPolarHBondContact O-CB 3.36Å; G28-R31 PolarHBondContact O-N 2.98Å; G28-R31 VanDerWaalsContact O-N 3.12Å
29	P	97	Very high	96	Very high	131 Å²	131	81 Å²	81	85%	0.851	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-35.2	-175.6	-25.5	33.8	0	0	0	113.3
30	N	96.6	Very high	96.2	Very high	104 Å²	104	80 Å²	80	56%	0.556	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.1	12.7	-175.2	-61.2	-21.9	0	0	0	113.7	G28 L33 I34	G28-N30 PolarHBondContact O-N 3.42Å; G28-N30 VanDerWaalsContact O-N 3.15Å; N30-L33 WeakPolarHBondContact O-CB 3.35Å; N30-L33 PolarHBondContact O-N 2.74Å; N30-I34 HydrophobicContact CB-CD1 4.46Å; N30-I34 WeakPolarHBondContact O-CG1 3.34Å; N30-I34 PolarHBondContact O-N 3.5Å
31	R	95.3	Very high	96.3	Very high	81 Å²	81	81.9 Å²	81.9	31%	0.306	46%	0.458	S	S	.	.	H	α-helix	trans	-55.7	-49.2	-175.2	175.6	172.9	-172.9	-92.8	5.5	113.3	V25 G28 L33 I34 Q35	V25-R31 HydrophobicContact CB-CG 4.32Å; V25-R31 HydrophobicContact CG1-CB 4.36Å; V25-R31 HydrophobicContact CG1-CG 3.86Å; V25-R31 PolarHBondContact O-NE 2.83Å; G28-R31 WeakPolarHBondContact O-CB 3.36Å; G28-R31 PolarHBondContact O-N 2.98Å; G28-R31 VanDerWaalsContact O-N 3.12Å; R31-L33 VanDerWaalsContact C-N 3.27Å; R31-L33 PolarHBondContact O-N 3.39Å; R31-I34 PolarHBondContact O-N 2.92Å; R31-Q35 HydrophobicContact CG-CG 4.28Å; R31-Q35 VanDerWaalsContact NH2-NE2 3.12Å; R31-Q35 VanDerWaalsContact O-CG 3.27Å; R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 2.87Å
32	P	96.5	Very high	96.4	Very high	87 Å²	87	81.8 Å²	81.8	57%	0.565	46%	0.455	S	S	*	.	H	α-helix	trans	-62.4	-35.7	-180	-22.1	34	0	0	0	112.8	Q35 L36	P32-Q35 PolarHBondContact O-N 2.9Å; P32-L36 WeakPolarHBondContact O-CB 3.22Å; P32-L36 PolarHBondContact O-N 3.49Å
33	L	97.5	Very high	96.5	Very high	98 Å²	98	84.5 Å²	84.5	51%	0.513	47%	0.471	S	S	.	.	H	α-helix	trans	-64.1	-48.2	177.1	-178.8	65.4	0	0	0	110.8	N30 R31 Q35 L36 M37	N30-L33 WeakPolarHBondContact O-CB 3.35Å; N30-L33 PolarHBondContact O-N 2.74Å; R31-L33 VanDerWaalsContact C-N 3.27Å; R31-L33 PolarHBondContact O-N 3.39Å; L33-Q35 VanDerWaalsContact C-N 3.33Å; L33-Q35 PolarHBondContact O-N 2.93Å; L33-L36 PolarHBondContact O-N 2.95Å; L33-M37 HydrophobicContact CG-SD 4.14Å; L33-M37 VanDerWaalsContact O-CG 3.25Å; L33-M37 WeakPolarHBondContact O-CG 3.2Å; L33-M37 PolarHBondContact O-N 3.26Å
34	I	97.5	Very high	96.7	Very high	75 Å²	75	84.7 Å²	84.7	39%	0.385	47%	0.466	S	S	.	.	H	α-helix	trans	-62	-42.7	177.9	-62.7	168.7	0	0	0	110.7	V25 N30 R31 L36 M37 L38	V25-I34 HydrophobicContact CG1-CB 4.07Å; V25-I34 HydrophobicContact CG1-CD1 4.35Å; V25-I34 HydrophobicContact CG1-CG2 3.89Å; V25-I34 HydrophobicContact CG2-CG2 3.94Å; N30-I34 HydrophobicContact CB-CD1 4.46Å; N30-I34 WeakPolarHBondContact O-CG1 3.34Å; N30-I34 PolarHBondContact O-N 3.5Å; R31-I34 PolarHBondContact O-N 2.92Å; I34-L36 PolarHBondContact O-N 3.39Å; I34-M37 PolarHBondContact O-N 3.26Å; I34-L38 HydrophobicContact CG2-CD1 4.15Å; I34-L38 WeakPolarHBondContact O-CG 3.3Å; I34-L38 PolarHBondContact O-N 3.4Å
35	Q	97.4	Very high	96.8	Very high	43 Å²	43	80.5 Å²	80.5	20%	0.201	45%	0.449	C	S	.	.	H	α-helix	trans	-61	-43.5	176.5	-71	179.7	-41.3	0	0	112.1	P22 V25 R31 P32 L33 L38 A39	P22-Q35 HydrophobicContact CB-CB 4.09Å; P22-Q35 HydrophobicContact CB-CG 3.95Å; P22-Q35 PolarHBondContact O-NE2 3.25Å; V25-Q35 HydrophobicContact CB-CG 4.17Å; V25-Q35 HydrophobicContact CG2-CG 3.97Å; R31-Q35 HydrophobicContact CG-CG 4.28Å; R31-Q35 VanDerWaalsContact NH2-NE2 3.12Å; R31-Q35 VanDerWaalsContact O-CG 3.27Å; R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 2.87Å; P32-Q35 PolarHBondContact O-N 2.9Å; L33-Q35 VanDerWaalsContact C-N 3.33Å; L33-Q35 PolarHBondContact O-N 2.93Å; Q35-L38 PolarHBondContact O-N 3.36Å; Q35-A39 WeakPolarHBondContact O-CB 3.26Å; Q35-A39 PolarHBondContact O-N 3.24Å
36	L	97	Very high	96.9	Very high	103 Å²	103	82.4 Å²	82.4	54%	0.539	46%	0.455	S	S	.	.	H	α-helix	trans	-63.6	-44.2	176.7	179.5	65.6	0	0	0	111.2	P32 L33 I34 A39 T40	P32-L36 WeakPolarHBondContact O-CB 3.22Å; P32-L36 PolarHBondContact O-N 3.49Å; L33-L36 PolarHBondContact O-N 2.95Å; I34-L36 PolarHBondContact O-N 3.39Å; L36-A39 PolarHBondContact O-N 2.73Å; L36-T40 HydrophobicContact CD1-CG2 3.78Å; L36-T40 HydrophobicContact CG-CG2 4.26Å; L36-T40 WeakPolarHBondContact O-CB 3.26Å; L36-T40 WeakPolarHBondContact O-CG2 3.3Å; L36-T40 PolarHBondContact O-N 3.45Å; L36-T40 PolarHBondContact O-OG1 2.77Å
37	M	97.6	Very high	97	Very high	110 Å²	110	80.9 Å²	80.9	54%	0.542	44%	0.441	S	S	.	.	H	α-helix	trans	-59.1	-49.3	176.8	-69.6	172.4	75.1	0	0	110.9	L33 I34 A39 T40 S41	L33-M37 HydrophobicContact CG-SD 4.14Å; L33-M37 VanDerWaalsContact O-CG 3.25Å; L33-M37 WeakPolarHBondContact O-CG 3.2Å; L33-M37 PolarHBondContact O-N 3.26Å; I34-M37 PolarHBondContact O-N 3.26Å; M37-A39 PolarHBondContact O-N 2.93Å; M37-T40 PolarHBondContact O-OG1 3.49Å; M37-S41 WeakPolarHBondContact O-CB 3.24Å; M37-S41 PolarHBondContact O-N 3.36Å; M37-S41 PolarHBondContact O-OG 2.64Å
38	L	97.5	Very high	97.2	Very high	56 Å²	56	78.2 Å²	78.2	29%	0.293	43%	0.43	S	S	.	.	H	α-helix	trans	-60	-47.3	177.5	-71.3	172.5	0	0	0	112.3	P22 V25 I34 Q35 S42	P22-L38 HydrophobicContact CG-CB 4.22Å; V25-L38 HydrophobicContact CG2-CD1 3.81Å; I34-L38 HydrophobicContact CG2-CD1 4.15Å; I34-L38 WeakPolarHBondContact O-CG 3.3Å; I34-L38 PolarHBondContact O-N 3.4Å; Q35-L38 PolarHBondContact O-N 3.36Å; L38-S42 WeakPolarHBondContact O-CB 3.32Å; L38-S42 PolarHBondContact O-N 2.97Å; L38-S42 PolarHBondContact O-OG 2.91Å
39	A	96.6	Very high	97.4	Very high	34 Å²	34	78.8 Å²	78.8	28%	0.281	42%	0.419	S	S	.	.	H	α-helix	trans	-62.4	-53	-179.7	0	0	0	0	0	111.3	Q35 L36 M37 S42 V43	Q35-A39 WeakPolarHBondContact O-CB 3.26Å; Q35-A39 PolarHBondContact O-N 3.24Å; L36-A39 PolarHBondContact O-N 2.73Å; M37-A39 PolarHBondContact O-N 2.93Å; A39-S42 PolarHBondContact O-N 3.17Å; A39-S42 PolarHBondContact O-OG 3.12Å; A39-V43 WeakPolarHBondContact O-CG2 3.16Å; A39-V43 PolarHBondContact O-N 2.97Å; A39-V43 VanDerWaalsContact O-N 3.12Å
40	T	97.5	Very high	97.3	Very high	56 Å²	56	74 Å²	74	34%	0.344	39%	0.386	S	S	.	.	H	α-helix	trans	-64.1	-43.9	-178.4	53.2	0	0	0	0	112.4	L36 M37 S42 V43 F44	L36-T40 HydrophobicContact CD1-CG2 3.78Å; L36-T40 HydrophobicContact CG-CG2 4.26Å; L36-T40 WeakPolarHBondContact O-CB 3.26Å; L36-T40 WeakPolarHBondContact O-CG2 3.3Å; L36-T40 PolarHBondContact O-N 3.45Å; L36-T40 PolarHBondContact O-OG1 2.77Å; M37-T40 PolarHBondContact O-OG1 3.49Å; T40-S42 VanDerWaalsContact C-N 3.34Å; T40-S42 PolarHBondContact O-N 3.01Å; T40-V43 PolarHBondContact O-N 3.07Å; T40-F44 WeakPolarHBondContact O-CD2 3.3Å; T40-F44 PolarHBondContact O-N 3.47Å; T40-F44 VanDerWaalsContact O-N 3.07Å
41	S	97.6	Very high	97.4	Very high	65 Å²	65	74.6 Å²	74.6	46%	0.455	39%	0.387	S	S	.	.	H	α-helix	trans	-59.3	-44.9	174.4	-65.6	0	0	0	0	111.6	M37 V43 F44 C45	M37-S41 WeakPolarHBondContact O-CB 3.24Å; M37-S41 PolarHBondContact O-N 3.36Å; M37-S41 PolarHBondContact O-OG 2.64Å; S41-V43 VanDerWaalsContact C-N 3.31Å; S41-V43 PolarHBondContact O-N 2.89Å; S41-F44 PolarHBondContact O-N 3.37Å; S41-C45 VanDerWaalsContact O-CB 3.3Å; S41-C45 WeakPolarHBondContact O-CB 3.27Å; S41-C45 PolarHBondContact O-N 3.3Å; S41-C45 PolarHBondContact O-SG 3.12Å
42	S	98	Very high	97.4	Very high	9 Å²	9	73.1 Å²	73.1	6%	0.063	39%	0.389	C	S	.	.	H	α-helix	trans	-60.1	-41.5	179.7	77.5	0	0	0	0	112.5	G18 L38 A39 T40 Y46	G18-S42 WeakPolarHBondContact CA-OG 3.24Å; L38-S42 WeakPolarHBondContact O-CB 3.32Å; L38-S42 PolarHBondContact O-N 2.97Å; L38-S42 PolarHBondContact O-OG 2.91Å; A39-S42 PolarHBondContact O-N 3.17Å; A39-S42 PolarHBondContact O-OG 3.12Å; T40-S42 VanDerWaalsContact C-N 3.34Å; T40-S42 PolarHBondContact O-N 3.01Å; S42-Y46 VanDerWaalsContact O-CB 3.24Å; S42-Y46 WeakPolarHBondContact O-CB 3.41Å; S42-Y46 PolarHBondContact O-N 3.32Å
43	V	97.8	Very high	97.3	Very high	76 Å²	76	70.7 Å²	70.7	46%	0.461	37%	0.374	S	S	.	.	H	α-helix	trans	-66.1	-50.6	-179.7	171.1	0	0	0	0	110.5	A39 T40 S41 Y46 L47	A39-V43 WeakPolarHBondContact O-CG2 3.16Å; A39-V43 PolarHBondContact O-N 2.97Å; A39-V43 VanDerWaalsContact O-N 3.12Å; T40-V43 PolarHBondContact O-N 3.07Å; S41-V43 VanDerWaalsContact C-N 3.31Å; S41-V43 PolarHBondContact O-N 2.89Å; V43-Y46 PolarHBondContact O-N 3.41Å; V43-L47 HydrophobicContact CG1-CD1 3.86Å; V43-L47 HydrophobicContact CG1-CG 4.42Å; V43-L47 WeakPolarHBondContact O-CB 3.28Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.41Å; V43-L47 PolarHBondContact O-N 3.05Å
44	F	98.2	Very high	97.1	Very high	141 Å²	141	71.5 Å²	71.5	62%	0.618	38%	0.376	S	S	*	.	H	α-helix	trans	-68.3	-38.7	-177.6	-70.4	-57.6	0	0	0	112.7	T40 S41 L47 F48	T40-F44 WeakPolarHBondContact O-CD2 3.3Å; T40-F44 PolarHBondContact O-N 3.47Å; T40-F44 VanDerWaalsContact O-N 3.07Å; S41-F44 PolarHBondContact O-N 3.37Å; F44-L47 PolarHBondContact O-N 3.47Å; F44-F48 VanDerWaalsContact O-CB 3.3Å; F44-F48 WeakPolarHBondContact O-CB 3.4Å; F44-F48 PolarHBondContact O-N 3.34Å
45	C	98	Very high	96.9	Very high	55 Å²	55	71.7 Å²	71.7	37%	0.372	39%	0.389	S	S	.	.	H	α-helix	trans	-65.6	-42.6	175.5	-68.6	0	0	0	0	111.8	W14 S41 W49	W14-C45 HydrophobicContact CD2-CB 4.28Å; W14-C45 HydrophobicContact CE3-CB 4.3Å; W14-C45 HydrophobicContact CH2-CB 3.37Å; W14-C45 HydrophobicContact CZ2-CB 3.35Å; W14-C45 HydrophobicContact CZ3-CB 3.87Å; S41-C45 VanDerWaalsContact O-CB 3.3Å; S41-C45 WeakPolarHBondContact O-CB 3.27Å; S41-C45 PolarHBondContact O-N 3.3Å; S41-C45 PolarHBondContact O-SG 3.12Å; C45-W49 WeakPolarHBondContact O-CB 3.3Å; C45-W49 PolarHBondContact O-N 2.77Å
46	Y	98.2	Very high	96.7	Very high	54 Å²	54	76.6 Å²	76.6	21%	0.212	41%	0.412	C	S	.	.	H	α-helix	trans	-63.4	-45.9	175.6	178.5	-107.4	0	0	0	111.7	T11 W14 S42 V43 W49 L50	T11-Y46 PolarHBondContact OG1-OH 3.04Å; W14-Y46 HydrophobicContact CB-CD2 4.1Å; W14-Y46 HydrophobicContact CB-CG 4.3Å; W14-Y46 AromaticContact CD1-CD2 3.86Å; W14-Y46 HydrophobicContact CG-CD2 4.26Å; S42-Y46 VanDerWaalsContact O-CB 3.24Å; S42-Y46 WeakPolarHBondContact O-CB 3.41Å; S42-Y46 PolarHBondContact O-N 3.32Å; V43-Y46 PolarHBondContact O-N 3.41Å; Y46-W49 HydrophobicContact CD2-CE3 4.14Å; Y46-W49 AromaticContact CE2-CE3 3.99Å; Y46-W49 HydrophobicContact CE2-CE3 3.99Å; Y46-W49 AromaticContact CE2-CZ3 3.95Å; Y46-W49 HydrophobicContact CE2-CZ3 3.95Å; Y46-W49 PolarHBondContact O-N 2.97Å; Y46-L50 HydrophobicContact CE1-CD2 3.91Å; Y46-L50 VanDerWaalsContact O-CB 3.26Å; Y46-L50 WeakPolarHBondContact O-CB 3.3Å; Y46-L50 PolarHBondContact O-N 3.47Å
47	L	97.6	Very high	96.5	Very high	72 Å²	72	75.1 Å²	75.1	38%	0.377	41%	0.408	S	S	.	.	H	α-helix	trans	-62.9	-44	178.6	-74.4	175.3	0	0	0	112.2	V43 F44 W49 L50 M51	V43-L47 HydrophobicContact CG1-CD1 3.86Å; V43-L47 HydrophobicContact CG1-CG 4.42Å; V43-L47 WeakPolarHBondContact O-CB 3.28Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.41Å; V43-L47 PolarHBondContact O-N 3.05Å; F44-L47 PolarHBondContact O-N 3.47Å; L47-W49 VanDerWaalsContact C-N 3.34Å; L47-W49 PolarHBondContact O-N 2.8Å; L47-L50 PolarHBondContact O-N 2.9Å; L47-M51 HydrophobicContact CB-CE 4.38Å; L47-M51 WeakPolarHBondContact O-CB 3.4Å; L47-M51 WeakPolarHBondContact O-CE 3.26Å; L47-M51 VanDerWaalsContact O-CG 3.3Å; L47-M51 WeakPolarHBondContact O-CG 3.42Å; L47-M51 PolarHBondContact O-N 3.4Å
48	F	98	Very high	96.3	Very high	152 Å²	152	76.5 Å²	76.5	67%	0.667	42%	0.417	S	S	*	.	H	α-helix	trans	-58.7	-47.1	176.5	179	-93.1	0	0	0	111.4	F44 S52	F44-F48 VanDerWaalsContact O-CB 3.3Å; F44-F48 WeakPolarHBondContact O-CB 3.4Å; F44-F48 PolarHBondContact O-N 3.34Å; F48-S52 WeakPolarHBondContact O-CB 3.45Å; F48-S52 PolarHBondContact O-N 2.82Å; F48-S52 VanDerWaalsContact O-N 3.17Å; F48-S52 PolarHBondContact O-OG 2.97Å
49	W	97.3	Very high	96.1	Very high	52 Å²	52	78.4 Å²	78.4	20%	0.197	43%	0.433	C	S	.	.	H	α-helix	trans	-63.4	-45.1	176.3	172.6	81.3	0	0	0	112.1	P6 L7 M10 C45 Y46 L47 S52 S53	P6-W49 HydrophobicContact CB-CZ2 4.47Å; L7-W49 HydrophobicContact CD1-CH2 3.95Å; L7-W49 HydrophobicContact CD1-CZ3 4.04Å; M10-W49 HydrophobicContact CB-CD2 4Å; M10-W49 HydrophobicContact CB-CE3 3.9Å; M10-W49 HydrophobicContact CB-CH2 3.79Å; M10-W49 HydrophobicContact CB-CZ2 3.82Å; M10-W49 HydrophobicContact CB-CZ3 3.79Å; M10-W49 HydrophobicContact CG-CD2 4.08Å; M10-W49 HydrophobicContact CG-CE3 4.47Å; M10-W49 HydrophobicContact CG-CH2 4.11Å; M10-W49 HydrophobicContact CG-CZ2 3.62Å; M10-W49 HydrophobicContact CG-CZ3 4.49Å; C45-W49 WeakPolarHBondContact O-CB 3.3Å; C45-W49 PolarHBondContact O-N 2.77Å; Y46-W49 HydrophobicContact CD2-CE3 4.14Å; Y46-W49 AromaticContact CE2-CE3 3.99Å; Y46-W49 HydrophobicContact CE2-CE3 3.99Å; Y46-W49 AromaticContact CE2-CZ3 3.95Å; Y46-W49 HydrophobicContact CE2-CZ3 3.95Å; Y46-W49 PolarHBondContact O-N 2.97Å; L47-W49 VanDerWaalsContact C-N 3.34Å; L47-W49 PolarHBondContact O-N 2.8Å; W49-S52 PolarHBondContact O-OG 2.83Å; W49-S53 PolarHBondContact NE1-OG 2.92Å; W49-S53 VanDerWaalsContact O-CB 3.28Å; W49-S53 WeakPolarHBondContact O-CB 3.45Å; W49-S53 PolarHBondContact O-N 3.31Å; W49-S53 PolarHBondContact O-OG 3.42Å
50	L	96.9	Very high	95.9	Very high	32 Å²	32	84.8 Å²	84.8	17%	0.168	46%	0.461	C	S	.	.	H	α-helix	trans	-64.1	-47.7	-177.4	-179.9	64.2	0	0	0	110.9	L7 Y46 L47 S53 M54	L7-L50 HydrophobicContact CD1-CD1 3.85Å; Y46-L50 HydrophobicContact CE1-CD2 3.91Å; Y46-L50 VanDerWaalsContact O-CB 3.26Å; Y46-L50 WeakPolarHBondContact O-CB 3.3Å; Y46-L50 PolarHBondContact O-N 3.47Å; L47-L50 PolarHBondContact O-N 2.9Å; L50-S53 PolarHBondContact O-N 3.06Å; L50-M54 HydrophobicContact CD1-CG 4.02Å; L50-M54 HydrophobicContact CD1-SD 4.12Å; L50-M54 HydrophobicContact CG-CE 4.48Å; L50-M54 HydrophobicContact CG-CG 4.32Å; L50-M54 HydrophobicContact CG-SD 4.13Å; L50-M54 WeakPolarHBondContact O-CB 3.48Å; L50-M54 VanDerWaalsContact O-CG 3.26Å; L50-M54 WeakPolarHBondContact O-CG 3.26Å; L50-M54 PolarHBondContact O-N 3.32Å
51	M	97.2	Very high	95.8	Very high	116 Å²	116	90.5 Å²	90.5	57%	0.571	48%	0.482	S	S	*	.	H	α-helix	trans	-62.8	-46	-179.8	-70	-173.7	-67.3	0	0	112	L47 S53 M54 A55	L47-M51 HydrophobicContact CB-CE 4.38Å; L47-M51 WeakPolarHBondContact O-CB 3.4Å; L47-M51 WeakPolarHBondContact O-CE 3.26Å; L47-M51 VanDerWaalsContact O-CG 3.3Å; L47-M51 WeakPolarHBondContact O-CG 3.42Å; L47-M51 PolarHBondContact O-N 3.4Å; M51-S53 VanDerWaalsContact C-N 3.3Å; M51-S53 PolarHBondContact O-N 3.33Å; M51-M54 PolarHBondContact O-N 3.17Å; M51-A55 WeakPolarHBondContact O-CB 3.3Å; M51-A55 PolarHBondContact O-N 2.88Å
52	S	95.4	Very high	95.5	Very high	49 Å²	49	90 Å²	90	34%	0.343	49%	0.486	S	S	.	.	H	α-helix	trans	-65.2	-33.7	178.3	55.4	0	0	0	0	112.9	F48 W49 Q56	F48-S52 WeakPolarHBondContact O-CB 3.45Å; F48-S52 PolarHBondContact O-N 2.82Å; F48-S52 VanDerWaalsContact O-N 3.17Å; F48-S52 PolarHBondContact O-OG 2.97Å; W49-S52 PolarHBondContact O-OG 2.83Å; S52-Q56 PolarHBondContact O-NE2 3.49Å
53	S	94.4	Very high	95.3	Very high	36 Å²	36	95 Å²	95	25%	0.252	52%	0.518	S	S	.	.	H	α-helix	trans	-72.7	-46.2	175.7	-58.7	0	0	0	0	111.6	W49 L50 M51 A55 Q56	W49-S53 PolarHBondContact NE1-OG 2.92Å; W49-S53 VanDerWaalsContact O-CB 3.28Å; W49-S53 WeakPolarHBondContact O-CB 3.45Å; W49-S53 PolarHBondContact O-N 3.31Å; W49-S53 PolarHBondContact O-OG 3.42Å; L50-S53 PolarHBondContact O-N 3.06Å; M51-S53 VanDerWaalsContact C-N 3.3Å; M51-S53 PolarHBondContact O-N 3.33Å; S53-A55 VanDerWaalsContact C-N 3.27Å; S53-A55 PolarHBondContact O-N 3.42Å; S53-Q56 PolarHBondContact O-N 2.84Å
54	M	92.9	Very high	95	Very high	115 Å²	115	99.6 Å²	99.6	57%	0.567	54%	0.539	S	S	*	.	H	α-helix	trans	-62.1	-34.8	179.3	-73.6	-167.3	-36.3	0	0	112.5	L50 M51 Q56 V57	L50-M54 HydrophobicContact CD1-CG 4.02Å; L50-M54 HydrophobicContact CD1-SD 4.12Å; L50-M54 HydrophobicContact CG-CE 4.48Å; L50-M54 HydrophobicContact CG-CG 4.32Å; L50-M54 HydrophobicContact CG-SD 4.13Å; L50-M54 WeakPolarHBondContact O-CB 3.48Å; L50-M54 VanDerWaalsContact O-CG 3.26Å; L50-M54 WeakPolarHBondContact O-CG 3.26Å; L50-M54 PolarHBondContact O-N 3.32Å; M51-M54 PolarHBondContact O-N 3.17Å; M54-Q56 PolarHBondContact O-N 3.06Å; M54-Q56 VanDerWaalsContact O-N 3.11Å; M54-V57 PolarHBondContact O-N 2.94Å
55	A	94.1	Very high	94.8	Very high	79 Å²	79	96.6 Å²	96.6	65%	0.653	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-22.5	176	0	0	0	0	0	113.3	M51 S53	M51-A55 WeakPolarHBondContact O-CB 3.3Å; M51-A55 PolarHBondContact O-N 2.88Å; S53-A55 VanDerWaalsContact C-N 3.27Å; S53-A55 PolarHBondContact O-N 3.42Å
56	Q	93.4	Very high	94.6	Very high	146 Å²	146	100.1 Å²	100.1	68%	0.682	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.1	-3	-176.1	-66.4	174	72.2	0	0	113.8	S52 S53 M54 N58 P59	S52-Q56 PolarHBondContact O-NE2 3.49Å; S53-Q56 PolarHBondContact O-N 2.84Å; M54-Q56 PolarHBondContact O-N 3.06Å; M54-Q56 VanDerWaalsContact O-N 3.11Å; Q56-N58 VanDerWaalsContact C-N 3.35Å; Q56-N58 PolarHBondContact O-N 2.91Å; Q56-P59 WeakPolarHBondContact O-CD 3.46Å
57	V	91.9	Very high	94.3	Very high	73 Å²	73	107.4 Å²	107.4	44%	0.442	57%	0.566	S	S	.	*	S	Bend	trans	-68.2	-34.9	-175.5	178	0	0	0	0	112	M54	M54-V57 PolarHBondContact O-N 2.94Å
58	N	93.1	Very high	94.2	Very high	139 Å²	139	109 Å²	109	74%	0.743	58%	0.576	S	S	*	*	S	Bend	trans	-132.1	76.2	177	-64.4	-73.6	0	0	0	109.9	Q56	Q56-N58 VanDerWaalsContact C-N 3.35Å; Q56-N58 PolarHBondContact O-N 2.91Å
59	P	93.3	Very high	94	Very high	95 Å²	95	104.9 Å²	104.9	62%	0.617	56%	0.563	S	S	*	*			trans	-71.2	136	-175.9	29.8	-32.4	0	0	0	110.5	Q56	Q56-P59 WeakPolarHBondContact O-CD 3.46Å
60	L	94.1	Very high	93.7	Very high	169 Å²	169	105.9 Å²	105.9	89%	0.885	57%	0.571	S	S	*	*	S	Bend	trans	-82.1	-24.7	177.3	-65	174.3	0	0	0	112.8
61	F	93.5	Very high	93.4	Very high	176 Å²	176	113.6 Å²	113.6	77%	0.772	60%	0.598	S	S	*	*			trans	-141.3	148	-177	49.4	-95.7	0	0	0	110.6
62	G	92	Very high	93.1	Very high	53 Å²	53	113.1 Å²	113.1	55%	0.546	60%	0.597	S	S	.	*			trans	-97.6	170.5	173.8	0	0	0	0	0	112.6
63	P	93.2	Very high	92.9	Very high	114 Å²	114	113.2 Å²	113.2	74%	0.74	59%	0.593	S	S	*	*			trans	-68.4	138.7	175.4	28.7	-34	0	0	0	111.7	L65	P63-L65 HydrophobicContact CB-CD1 3.96Å; P63-L65 HydrophobicContact CG-CD1 3.92Å
64	I	92.7	Very high	92.6	Very high	174 Å²	174	118 Å²	118	89%	0.892	61%	0.612	S	S	*	*			trans	-98.5	109.5	176.1	-56.1	172.9	0	0	0	108.2
65	L	93.1	Very high	92.4	Very high	78 Å²	78	122.5 Å²	122.5	41%	0.408	62%	0.622	S	S	.	*			trans	-113	148.6	-174	-67.2	124.2	0	0	0	112.1	P63 T69 I70	P63-L65 HydrophobicContact CB-CD1 3.96Å; P63-L65 HydrophobicContact CG-CD1 3.92Å; L65-T69 HydrophobicContact CD2-CG2 3.6Å; L65-I70 HydrophobicContact CB-CD1 4.23Å; L65-I70 HydrophobicContact CB-CG1 3.79Å
66	H	94.1	Very high	92.3	Very high	128 Å²	128	124.6 Å²	124.6	59%	0.593	62%	0.619	S	S	*	*			trans	-71.4	152.8	172.8	-162.3	73.4	0	0	0	111.1	D68 T69 I70	H66-D68 VanDerWaalsContact C-N 3.27Å; H66-D68 IonicContact CD2-OD2 3.62Å; H66-D68 IonicContact NE2-OD2 3.8Å; H66-D68 PolarHBondContact O-N 3.33Å; H66-T69 WeakPolarHBondContact O-CB 3.44Å; H66-T69 PolarHBondContact O-N 2.96Å; H66-I70 WeakPolarHBondContact O-CG1 3.46Å; H66-I70 PolarHBondContact O-N 2.79Å
67	R	92	Very high	92.1	Very high	207 Å²	207	125.8 Å²	125.8	78%	0.781	62%	0.617	S	S	*	*	H	α-helix	trans	-56.8	-40.6	-176.1	-66.8	-179.6	-177.5	-102.1	0.9	112.5	I70 R71	R67-I70 PolarHBondContact O-N 3.31Å; R67-R71 PolarHBondContact O-N 2.98Å
68	D	95.1	Very high	91.3	Very high	106 Å²	106	130.9 Å²	130.9	57%	0.567	64%	0.636	S	S	*	*	H	α-helix	trans	-65.1	-41	178.1	-60.4	-28.4	0	0	0	111.9	H66 I70 R71 I72	H66-D68 VanDerWaalsContact C-N 3.27Å; H66-D68 IonicContact CD2-OD2 3.62Å; H66-D68 IonicContact NE2-OD2 3.8Å; H66-D68 PolarHBondContact O-N 3.33Å; D68-I70 VanDerWaalsContact C-N 3.35Å; D68-I70 PolarHBondContact O-N 3Å; D68-R71 PolarHBondContact O-N 3.24Å; D68-I72 WeakPolarHBondContact O-CG1 3.39Å; D68-I72 PolarHBondContact O-N 3.45Å
69	T	93.8	Very high	89.8	Confident	66 Å²	66	129.2 Å²	129.2	41%	0.405	63%	0.633	S	S	.	*	H	α-helix	trans	-63.5	-41.8	175.5	-46.5	0	0	0	0	111.3	L65 H66 R71 I72 L73	L65-T69 HydrophobicContact CD2-CG2 3.6Å; H66-T69 WeakPolarHBondContact O-CB 3.44Å; H66-T69 PolarHBondContact O-N 2.96Å; T69-R71 VanDerWaalsContact C-N 3.32Å; T69-R71 PolarHBondContact O-N 3.33Å; T69-I72 PolarHBondContact O-N 3.11Å; T69-L73 WeakPolarHBondContact O-CB 3.4Å; T69-L73 PolarHBondContact O-N 3.34Å
70	I	91.3	Very high	88.3	Confident	72 Å²	72	129.7 Å²	129.7	37%	0.369	63%	0.629	S	S	.	*	H	α-helix	trans	-60.8	-43.3	175.6	-65.4	168.6	0	0	0	110.3	L65 H66 R67 D68 I72 L73 Q74	L65-I70 HydrophobicContact CB-CD1 4.23Å; L65-I70 HydrophobicContact CB-CG1 3.79Å; H66-I70 WeakPolarHBondContact O-CG1 3.46Å; H66-I70 PolarHBondContact O-N 2.79Å; R67-I70 PolarHBondContact O-N 3.31Å; D68-I70 VanDerWaalsContact C-N 3.35Å; D68-I70 PolarHBondContact O-N 3Å; I70-I72 PolarHBondContact O-N 2.9Å; I70-L73 PolarHBondContact O-N 3.01Å; I70-Q74 HydrophobicContact CG2-CG 4.44Å; I70-Q74 WeakPolarHBondContact O-CG 3.42Å; I70-Q74 PolarHBondContact O-N 3.47Å
71	R	90	Very high	86.4	Confident	194 Å²	194	132.9 Å²	132.9	73%	0.732	63%	0.629	S	S	*	*	H	α-helix	trans	-64	-39.7	179.4	-169.5	177.1	-177.8	112.4	0	112.4	R67 D68 T69 R75	R67-R71 PolarHBondContact O-N 2.98Å; D68-R71 PolarHBondContact O-N 3.24Å; T69-R71 VanDerWaalsContact C-N 3.32Å; T69-R71 PolarHBondContact O-N 3.33Å; R71-R75 PolarHBondContact O-N 3.46Å
72	I	92	Very high	84.7	Confident	106 Å²	106	130.1 Å²	130.1	54%	0.544	63%	0.627	S	S	.	*	H	α-helix	trans	-66.1	-46.2	174.3	-66.1	166.3	0	0	0	109.9	D68 T69 I70 Q74 R75 E76	D68-I72 WeakPolarHBondContact O-CG1 3.39Å; D68-I72 PolarHBondContact O-N 3.45Å; T69-I72 PolarHBondContact O-N 3.11Å; I70-I72 PolarHBondContact O-N 2.9Å; I72-Q74 VanDerWaalsContact C-N 3.3Å; I72-Q74 PolarHBondContact O-N 3.25Å; I72-R75 WeakPolarHBondContact O-CB 3.35Å; I72-R75 PolarHBondContact O-N 2.95Å; I72-E76 HydrophobicContact CG2-CG 3.96Å; I72-E76 WeakPolarHBondContact O-CG 3.43Å; I72-E76 PolarHBondContact O-N 2.98Å
73	L	91.4	Very high	82.4	Confident	52 Å²	52	139 Å²	139	27%	0.272	66%	0.66	S	S	.	*	H	α-helix	trans	-58.4	-43.2	-179.8	-158	85	0	0	0	111.7	T69 I70 R75 E76 W77 I80	T69-L73 WeakPolarHBondContact O-CB 3.4Å; T69-L73 PolarHBondContact O-N 3.34Å; I70-L73 PolarHBondContact O-N 3.01Å; L73-R75 PolarHBondContact O-N 3.24Å; L73-E76 PolarHBondContact O-N 3.06Å; L73-W77 HydrophobicContact CD1-CD2 3.99Å; L73-W77 HydrophobicContact CD1-CE3 4.14Å; L73-W77 HydrophobicContact CD1-CG 4.45Å; L73-W77 HydrophobicContact CD1-CZ2 4.5Å; L73-W77 HydrophobicContact CD1-CZ3 4.45Å; L73-W77 HydrophobicContact CG-CD2 4.38Å; L73-W77 HydrophobicContact CG-CE3 4.41Å; L73-W77 WeakPolarHBondContact O-CB 3.46Å; L73-W77 PolarHBondContact O-N 3.49Å; L73-I80 HydrophobicContact CD2-CD1 3.91Å
74	Q	86.9	Confident	81.8	Confident	135 Å²	135	140.2 Å²	140.2	63%	0.631	66%	0.656	S	S	*	*	H	α-helix	trans	-65.1	-25.1	176.6	-73.9	178.5	-34.1	0	0	113.9	I70 I72	I70-Q74 HydrophobicContact CG2-CG 4.44Å; I70-Q74 WeakPolarHBondContact O-CG 3.42Å; I70-Q74 PolarHBondContact O-N 3.47Å; I72-Q74 VanDerWaalsContact C-N 3.3Å; I72-Q74 PolarHBondContact O-N 3.25Å
75	R	88.7	Confident	81.2	Confident	210 Å²	210	138.4 Å²	138.4	79%	0.792	64%	0.644	S	S	*	*	H	α-helix	trans	-83.8	-44.3	178.2	-179.3	-175.5	178.6	-177	-1.4	111.6	R71 I72 L73	R71-R75 PolarHBondContact O-N 3.46Å; I72-R75 WeakPolarHBondContact O-CB 3.35Å; I72-R75 PolarHBondContact O-N 2.95Å; L73-R75 PolarHBondContact O-N 3.24Å
76	E	92.1	Very high	80.6	Confident	124 Å²	124	141.8 Å²	141.8	58%	0.579	66%	0.657	S	S	*	*	H	α-helix	trans	-87.6	-31	-170.3	-61.1	-55.8	148.8	0	0	112.8	I72 L73	I72-E76 HydrophobicContact CG2-CG 3.96Å; I72-E76 WeakPolarHBondContact O-CG 3.43Å; I72-E76 PolarHBondContact O-N 2.98Å; L73-E76 PolarHBondContact O-N 3.06Å
77	W	90.2	Very high	79.8	Confident	171 Å²	171	142.6 Å²	142.6	65%	0.648	66%	0.66	S	S	*	*	S	Bend	trans	-103.9	141.3	179.4	-66.1	14.9	0	0	0	108.9	L73	L73-W77 HydrophobicContact CD1-CD2 3.99Å; L73-W77 HydrophobicContact CD1-CE3 4.14Å; L73-W77 HydrophobicContact CD1-CG 4.45Å; L73-W77 HydrophobicContact CD1-CZ2 4.5Å; L73-W77 HydrophobicContact CD1-CZ3 4.45Å; L73-W77 HydrophobicContact CG-CD2 4.38Å; L73-W77 HydrophobicContact CG-CE3 4.41Å; L73-W77 WeakPolarHBondContact O-CB 3.46Å; L73-W77 PolarHBondContact O-N 3.49Å
78	E	75.2	Confident	79	Confident	180 Å²	180	138.6 Å²	138.6	84%	0.841	65%	0.653	S	S	*	*			trans	-50.6	144.8	176.3	-83.2	-160.9	165.2	0	0	110.7	I80	E78-I80 PolarHBondContact O-N 3.25Å
79	P	61.8	Low	78	Confident	103 Å²	103	140.7 Å²	140.7	67%	0.669	66%	0.659	S	S	*	*			trans	-54.8	112.1	-171.7	19.7	-30.9	0	0	0	109.8	R81	P79-R81 VanDerWaalsContact C-N 3.29Å; P79-R81 PolarHBondContact O-N 3.32Å
80	I	61.1	Low	76.8	Confident	106 Å²	106	146.1 Å²	146.1	54%	0.544	68%	0.677	S	S	.	*			trans	-61.9	94.3	173.5	-61.5	167.6	0	0	0	105.8	L73 E78 V82	L73-I80 HydrophobicContact CD2-CD1 3.91Å; E78-I80 PolarHBondContact O-N 3.25Å; I80-V82 HydrophobicContact CB-CG2 4.47Å; I80-V82 HydrophobicContact CG2-CG2 3.25Å; I80-V82 PolarHBondContact O-N 2.99Å
81	R	55.3	Low	75.7	Confident	236 Å²	236	151.8 Å²	151.8	89%	0.891	70%	0.7	S	S	*	*			trans	-71.1	61.4	-177.2	-63.9	-164	-151	-156.5	6.4	112.2	P79	P79-R81 VanDerWaalsContact C-N 3.29Å; P79-R81 PolarHBondContact O-N 3.32Å
82	V	56.6	Low	74.5	Confident	118 Å²	118	148.3 Å²	148.3	72%	0.715	70%	0.698	S	S	*	*			trans	-126.5	30.5	172.5	-79.9	0	0	0	0	112	I80	I80-V82 HydrophobicContact CB-CG2 4.47Å; I80-V82 HydrophobicContact CG2-CG2 3.25Å; I80-V82 PolarHBondContact O-N 2.99Å
83	L	43.1	Very low	72.9	Confident	238 Å²	238	152.1 Å²	152.1	100%	1.246	71%	0.712	S	S	*	*			trans	-121.7	0	152.1	-69.6	173.2	0	0	0	108.7

Retrieved 83 of 83 residues in 222.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).