A0A1C9A1H6_SCHMA Loading...

MEG-14 isoform 3

AlphaFold DB , UniProt , Accession A0A1C9A1H6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 141 aa.

						>A0A1C9A1H6_SCHMA|A0A1C9A1H6
MNRFFWTVTQCTILLVIICNLNTMKATSANSRTHGATSTSTHGATSTAKPAASTPPKAAATSTIKPTVTTPKAAATSTIKPTVTTSKPSPAKPAASNTAKPAASTPKKPHDERAVLAAAAVPIVLGVIGEVIGFILQYIAS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.8	Low	72	Confident	196 Å²	196	113.8 Å²	113.8	97%	0.966	54%	0.542	S	S	*	.				0	3.7	0	-129.4	80.6	139.2	0	0	113.8	F5	M1-F5 WeakPolarHBondContact O-CD2 3.36Å
2	N	66	Low	72.7	Confident	88 Å²	88	110.8 Å²	110.8	47%	0.471	54%	0.537	S	S	.	.	H	α-helix	trans	-87.6	-22.2	-163.4	-56.7	36.9	0	0	0	114.5	F4 W6 Q137	N2-F4 VanDerWaalsContact C-N 3.31Å; N2-F4 PolarHBondContact O-N 3.38Å; N2-W6 PolarHBondContact O-N 3.28Å; N2-W6 VanDerWaalsContact O-N 3.1Å; N2-Q137 WeakPolarHBondContact ND2-CG 3.39Å
3	R	74.5	Confident	73.3	Confident	211 Å²	211	107.5 Å²	107.5	80%	0.796	52%	0.522	S	S	*	.	H	α-helix	trans	-64.1	-36	-179.5	-68.3	-79.2	-171.4	-137.3	-1.8	112.3	T7	R3-T7 WeakPolarHBondContact O-CB 3.37Å; R3-T7 PolarHBondContact O-N 3.11Å; R3-T7 PolarHBondContact O-OG1 2.95Å
4	F	72.8	Confident	73.9	Confident	146 Å²	146	106.6 Å²	106.6	64%	0.64	52%	0.52	S	S	*	.	H	α-helix	trans	-66.3	-50.9	179.8	-176.7	-99.6	0	0	0	111.1	N2 W6 T7 V8	N2-F4 VanDerWaalsContact C-N 3.31Å; N2-F4 PolarHBondContact O-N 3.38Å; F4-W6 VanDerWaalsContact C-N 3.32Å; F4-W6 PolarHBondContact O-N 3.17Å; F4-T7 WeakPolarHBondContact O-CB 3.4Å; F4-T7 PolarHBondContact O-N 3.06Å; F4-T7 VanDerWaalsContact O-N 3.1Å; F4-V8 HydrophobicContact CD1-CG2 4.08Å; F4-V8 HydrophobicContact CE1-CG2 3.72Å; F4-V8 HydrophobicContact CE2-CG2 4.31Å; F4-V8 HydrophobicContact CZ-CG2 3.84Å; F4-V8 WeakPolarHBondContact O-CG2 3.39Å; F4-V8 PolarHBondContact O-N 3.04Å
5	F	70	Confident	74.3	Confident	123 Å²	123	107.5 Å²	107.5	54%	0.539	53%	0.527	S	S	.	.	H	α-helix	trans	-58.7	-43.7	176.4	-70.4	-71.6	0	0	0	112.1	M1 T7 V8 T9	M1-F5 WeakPolarHBondContact O-CD2 3.36Å; F5-T7 VanDerWaalsContact C-N 3.31Å; F5-T7 PolarHBondContact O-N 3.3Å; F5-V8 PolarHBondContact O-N 3.02Å; F5-T9 WeakPolarHBondContact O-CB 3.43Å; F5-T9 PolarHBondContact O-N 2.77Å; F5-T9 PolarHBondContact O-OG1 3.44Å
6	W	69.8	Low	74.5	Confident	160 Å²	160	104.4 Å²	104.4	61%	0.606	52%	0.517	S	S	*	.	H	α-helix	trans	-59.1	-42.5	175.4	-172	79.2	0	0	0	112.3	N2 F4 T9 Q10	N2-W6 PolarHBondContact O-N 3.28Å; N2-W6 VanDerWaalsContact O-N 3.1Å; F4-W6 VanDerWaalsContact C-N 3.32Å; F4-W6 PolarHBondContact O-N 3.17Å; W6-T9 PolarHBondContact O-N 3.38Å; W6-Q10 HydrophobicContact CD2-CG 4.15Å; W6-Q10 HydrophobicContact CE3-CG 4.29Å; W6-Q10 HydrophobicContact CH2-CG 4.28Å; W6-Q10 HydrophobicContact CZ2-CG 4.13Å; W6-Q10 HydrophobicContact CZ3-CG 4.35Å; W6-Q10 WeakPolarHBondContact O-CB 3.43Å; W6-Q10 VanDerWaalsContact O-CG 3.23Å; W6-Q10 WeakPolarHBondContact O-CG 3.35Å; W6-Q10 PolarHBondContact O-N 3.05Å
7	T	75.3	Confident	74.8	Confident	70 Å²	70	103.6 Å²	103.6	43%	0.429	51%	0.514	S	S	.	.	H	α-helix	trans	-66.5	-42.3	177.9	-53.2	0	0	0	0	111.7	R3 F4 F5 Q10 C11	R3-T7 WeakPolarHBondContact O-CB 3.37Å; R3-T7 PolarHBondContact O-N 3.11Å; R3-T7 PolarHBondContact O-OG1 2.95Å; F4-T7 WeakPolarHBondContact O-CB 3.4Å; F4-T7 PolarHBondContact O-N 3.06Å; F4-T7 VanDerWaalsContact O-N 3.1Å; F5-T7 VanDerWaalsContact C-N 3.31Å; F5-T7 PolarHBondContact O-N 3.3Å; T7-Q10 PolarHBondContact O-N 3.22Å; T7-C11 WeakPolarHBondContact O-CB 3.46Å; T7-C11 PolarHBondContact O-N 3.1Å; T7-C11 PolarHBondContact O-SG 2.87Å; T7-C11 VanDerWaalsContact O-SG 3.32Å
8	V	75.2	Confident	75.1	Confident	62 Å²	62	102.3 Å²	102.3	38%	0.376	51%	0.508	S	S	.	.	H	α-helix	trans	-64.3	-41.6	177.4	173	0	0	0	0	111.3	F4 F5 C11 T12	F4-V8 HydrophobicContact CD1-CG2 4.08Å; F4-V8 HydrophobicContact CE1-CG2 3.72Å; F4-V8 HydrophobicContact CE2-CG2 4.31Å; F4-V8 HydrophobicContact CZ-CG2 3.84Å; F4-V8 WeakPolarHBondContact O-CG2 3.39Å; F4-V8 PolarHBondContact O-N 3.04Å; F5-V8 PolarHBondContact O-N 3.02Å; V8-C11 PolarHBondContact O-N 3.17Å; V8-T12 WeakPolarHBondContact O-CB 3.45Å; V8-T12 PolarHBondContact O-N 3.09Å; V8-T12 PolarHBondContact O-OG1 2.94Å
9	T	74.2	Confident	75.2	Confident	53 Å²	53	101.1 Å²	101.1	33%	0.325	51%	0.509	S	S	.	.	H	α-helix	trans	-62.1	-47.1	174.6	-58.6	0	0	0	0	111.1	F5 W6 C11 T12 I13	F5-T9 WeakPolarHBondContact O-CB 3.43Å; F5-T9 PolarHBondContact O-N 2.77Å; F5-T9 PolarHBondContact O-OG1 3.44Å; W6-T9 PolarHBondContact O-N 3.38Å; T9-C11 PolarHBondContact O-N 3.02Å; T9-T12 PolarHBondContact O-N 3.36Å; T9-I13 HydrophobicContact CG2-CD1 3.83Å; T9-I13 VanDerWaalsContact O-CG1 3.29Å; T9-I13 WeakPolarHBondContact O-CG1 3.44Å; T9-I13 PolarHBondContact O-N 3.45Å
10	Q	75.2	Confident	75.1	Confident	74 Å²	74	99.4 Å²	99.4	35%	0.346	50%	0.501	S	S	.	.	H	α-helix	trans	-59.3	-44.7	175.8	-72.9	-66.4	-28	0	0	112.1	W6 T7 T12 I13 L14	W6-Q10 HydrophobicContact CD2-CG 4.15Å; W6-Q10 HydrophobicContact CE3-CG 4.29Å; W6-Q10 HydrophobicContact CH2-CG 4.28Å; W6-Q10 HydrophobicContact CZ2-CG 4.13Å; W6-Q10 HydrophobicContact CZ3-CG 4.35Å; W6-Q10 WeakPolarHBondContact O-CB 3.43Å; W6-Q10 VanDerWaalsContact O-CG 3.23Å; W6-Q10 WeakPolarHBondContact O-CG 3.35Å; W6-Q10 PolarHBondContact O-N 3.05Å; T7-Q10 PolarHBondContact O-N 3.22Å; Q10-T12 VanDerWaalsContact C-N 3.33Å; Q10-T12 PolarHBondContact O-N 3.44Å; Q10-I13 PolarHBondContact O-N 3.33Å; Q10-L14 WeakPolarHBondContact O-CB 3.31Å; Q10-L14 WeakPolarHBondContact O-CD1 3.25Å; Q10-L14 PolarHBondContact O-N 3.02Å
11	C	78.5	Confident	75	Confident	69 Å²	69	99.5 Å²	99.5	47%	0.466	50%	0.503	S	S	.	.	H	α-helix	trans	-60.5	-42.6	175.6	-76.2	0	0	0	0	112.1	T7 V8 T9 L14 L15	T7-C11 WeakPolarHBondContact O-CB 3.46Å; T7-C11 PolarHBondContact O-N 3.1Å; T7-C11 PolarHBondContact O-SG 2.87Å; T7-C11 VanDerWaalsContact O-SG 3.32Å; V8-C11 PolarHBondContact O-N 3.17Å; T9-C11 PolarHBondContact O-N 3.02Å; C11-L14 PolarHBondContact O-N 3.46Å; C11-L15 WeakPolarHBondContact O-CG 3.49Å; C11-L15 PolarHBondContact O-N 2.93Å
12	T	80.8	Confident	75.6	Confident	78 Å²	78	94.9 Å²	94.9	48%	0.479	48%	0.482	S	S	.	.	H	α-helix	trans	-64	-46.1	179.5	-55.7	0	0	0	0	110.9	V8 T9 Q10 L14 L15 V16	V8-T12 WeakPolarHBondContact O-CB 3.45Å; V8-T12 PolarHBondContact O-N 3.09Å; V8-T12 PolarHBondContact O-OG1 2.94Å; T9-T12 PolarHBondContact O-N 3.36Å; Q10-T12 VanDerWaalsContact C-N 3.33Å; Q10-T12 PolarHBondContact O-N 3.44Å; T12-L14 PolarHBondContact O-N 3.35Å; T12-L15 PolarHBondContact O-N 3.4Å; T12-V16 WeakPolarHBondContact O-CG2 3.4Å; T12-V16 PolarHBondContact O-N 2.93Å
13	I	79.4	Confident	75.6	Confident	68 Å²	68	94.6 Å²	94.6	35%	0.349	48%	0.484	S	S	.	.	H	α-helix	trans	-60.2	-46.5	176.3	-66.4	163.7	0	0	0	110.3	T9 Q10 L15 V16 I17	T9-I13 HydrophobicContact CG2-CD1 3.83Å; T9-I13 VanDerWaalsContact O-CG1 3.29Å; T9-I13 WeakPolarHBondContact O-CG1 3.44Å; T9-I13 PolarHBondContact O-N 3.45Å; Q10-I13 PolarHBondContact O-N 3.33Å; I13-L15 PolarHBondContact O-N 3.39Å; I13-V16 PolarHBondContact O-N 2.93Å; I13-I17 HydrophobicContact CG2-CD1 3.77Å; I13-I17 HydrophobicContact CG2-CG1 4.5Å; I13-I17 VanDerWaalsContact O-CG1 3.3Å; I13-I17 WeakPolarHBondContact O-CG1 3.48Å; I13-I17 PolarHBondContact O-N 3.42Å
14	L	81.6	Confident	74.8	Confident	95 Å²	95	90.2 Å²	90.2	50%	0.497	47%	0.474	S	S	.	.	H	α-helix	trans	-58.8	-45.5	177.1	-108.9	90.4	0	0	0	112.3	Q10 C11 T12 V16 I17 I18	Q10-L14 WeakPolarHBondContact O-CB 3.31Å; Q10-L14 WeakPolarHBondContact O-CD1 3.25Å; Q10-L14 PolarHBondContact O-N 3.02Å; C11-L14 PolarHBondContact O-N 3.46Å; T12-L14 PolarHBondContact O-N 3.35Å; L14-V16 VanDerWaalsContact C-N 3.33Å; L14-V16 PolarHBondContact O-N 2.96Å; L14-I17 PolarHBondContact O-N 3.48Å; L14-I18 WeakPolarHBondContact O-CB 3.46Å; L14-I18 VanDerWaalsContact O-CG1 3.25Å; L14-I18 WeakPolarHBondContact O-CG1 3.48Å; L14-I18 PolarHBondContact O-N 3.46Å
15	L	79.9	Confident	74	Confident	119 Å²	119	90.8 Å²	90.8	62%	0.623	48%	0.476	S	S	*	.	H	α-helix	trans	-63.4	-39.3	179.8	-73.8	176.8	0	0	0	111.9	C11 T12 I13 I18 C19	C11-L15 WeakPolarHBondContact O-CG 3.49Å; C11-L15 PolarHBondContact O-N 2.93Å; T12-L15 PolarHBondContact O-N 3.4Å; I13-L15 PolarHBondContact O-N 3.39Å; L15-I18 PolarHBondContact O-N 2.89Å; L15-C19 WeakPolarHBondContact O-CB 3.49Å; L15-C19 PolarHBondContact O-N 3.47Å
16	V	78.3	Confident	73.2	Confident	59 Å²	59	88 Å²	88	36%	0.358	48%	0.476	S	S	.	.	H	α-helix	trans	-63.2	-45.3	175.2	172.5	0	0	0	0	110.9	T12 I13 L14 C19 N20	T12-V16 WeakPolarHBondContact O-CG2 3.4Å; T12-V16 PolarHBondContact O-N 2.93Å; I13-V16 PolarHBondContact O-N 2.93Å; L14-V16 VanDerWaalsContact C-N 3.33Å; L14-V16 PolarHBondContact O-N 2.96Å; V16-C19 PolarHBondContact O-N 2.91Å; V16-N20 WeakPolarHBondContact O-CB 3.17Å; V16-N20 PolarHBondContact O-N 3.04Å
17	I	78.7	Confident	72.5	Confident	91 Å²	91	84.5 Å²	84.5	47%	0.467	47%	0.472	S	S	.	.	H	α-helix	trans	-61.9	-48.6	177.9	-66	164.5	0	0	0	110.7	I13 L14 C19 N20 L21	I13-I17 HydrophobicContact CG2-CD1 3.77Å; I13-I17 HydrophobicContact CG2-CG1 4.5Å; I13-I17 VanDerWaalsContact O-CG1 3.3Å; I13-I17 WeakPolarHBondContact O-CG1 3.48Å; I13-I17 PolarHBondContact O-N 3.42Å; L14-I17 PolarHBondContact O-N 3.48Å; I17-C19 VanDerWaalsContact C-N 3.33Å; I17-C19 PolarHBondContact O-N 3.03Å; I17-N20 PolarHBondContact O-N 3.11Å; I17-L21 HydrophobicContact CG2-CD1 3.86Å; I17-L21 HydrophobicContact CG2-CG 4.38Å; I17-L21 WeakPolarHBondContact O-CG 3.38Å; I17-L21 PolarHBondContact O-N 3.22Å
18	I	80.9	Confident	71.4	Confident	80 Å²	80	84 Å²	84	41%	0.41	47%	0.471	S	S	.	.	H	α-helix	trans	-61.4	-43.2	179.1	-67.9	164.7	0	0	0	110.7	L14 L15 N20 L21 N22	L14-I18 WeakPolarHBondContact O-CB 3.46Å; L14-I18 VanDerWaalsContact O-CG1 3.25Å; L14-I18 WeakPolarHBondContact O-CG1 3.48Å; L14-I18 PolarHBondContact O-N 3.46Å; L15-I18 PolarHBondContact O-N 2.89Å; I18-N20 VanDerWaalsContact C-N 3.33Å; I18-N20 PolarHBondContact O-N 3.2Å; I18-L21 PolarHBondContact O-N 2.96Å; I18-N22 WeakPolarHBondContact O-CB 3.39Å; I18-N22 PolarHBondContact O-N 3.46Å; I18-N22 PolarHBondContact O-ND2 3.28Å
19	C	76.5	Confident	70.1	Confident	78 Å²	78	84 Å²	84	53%	0.527	48%	0.478	S	S	.	.	H	α-helix	trans	-61	-42.5	177	-171.8	0	0	0	0	111.6	L15 V16 I17 N22 T23	L15-C19 WeakPolarHBondContact O-CB 3.49Å; L15-C19 PolarHBondContact O-N 3.47Å; V16-C19 PolarHBondContact O-N 2.91Å; I17-C19 VanDerWaalsContact C-N 3.33Å; I17-C19 PolarHBondContact O-N 3.03Å; C19-N22 PolarHBondContact O-N 3.13Å; C19-T23 WeakPolarHBondContact O-CB 3.34Å; C19-T23 PolarHBondContact O-N 3.47Å; C19-T23 PolarHBondContact O-OG1 2.91Å
20	N	74.1	Confident	69	Low	67 Å²	67	87.1 Å²	87.1	36%	0.358	49%	0.493	S	S	.	.	H	α-helix	trans	-67.7	-43.5	178.2	-160.9	-73.8	0	0	0	112.1	V16 I17 I18 N22 T23 M24	V16-N20 WeakPolarHBondContact O-CB 3.17Å; V16-N20 PolarHBondContact O-N 3.04Å; I17-N20 PolarHBondContact O-N 3.11Å; I18-N20 VanDerWaalsContact C-N 3.33Å; I18-N20 PolarHBondContact O-N 3.2Å; N20-N22 PolarHBondContact O-N 3.06Å; N20-T23 WeakPolarHBondContact O-CB 3.3Å; N20-T23 PolarHBondContact O-N 2.91Å; N20-M24 WeakPolarHBondContact O-CG 3.44Å; N20-M24 PolarHBondContact O-N 3.32Å
21	L	73.5	Confident	67.7	Low	102 Å²	102	88 Å²	88	53%	0.534	51%	0.507	S	S	.	.	H	α-helix	trans	-61.3	-42.7	175.6	-72.9	170.2	0	0	0	112	I17 I18 T23 M24 K25	I17-L21 HydrophobicContact CG2-CD1 3.86Å; I17-L21 HydrophobicContact CG2-CG 4.38Å; I17-L21 WeakPolarHBondContact O-CG 3.38Å; I17-L21 PolarHBondContact O-N 3.22Å; I18-L21 PolarHBondContact O-N 2.96Å; L21-T23 VanDerWaalsContact C-N 3.34Å; L21-M24 PolarHBondContact O-N 2.81Å; L21-K25 WeakPolarHBondContact O-CB 3.48Å; L21-K25 PolarHBondContact O-N 2.91Å
22	N	71.6	Confident	66.4	Low	100 Å²	100	95 Å²	95	54%	0.535	52%	0.524	S	S	.	.	H	α-helix	trans	-65.2	-39	175.6	-76.7	-20.4	0	0	0	111.8	I18 C19 N20 K25 A26	I18-N22 WeakPolarHBondContact O-CB 3.39Å; I18-N22 PolarHBondContact O-N 3.46Å; I18-N22 PolarHBondContact O-ND2 3.28Å; C19-N22 PolarHBondContact O-N 3.13Å; N20-N22 PolarHBondContact O-N 3.06Å; N22-K25 PolarHBondContact O-N 2.95Å; N22-A26 WeakPolarHBondContact O-CB 3.26Å; N22-A26 PolarHBondContact O-N 3.45Å
23	T	66.4	Low	64.9	Low	81 Å²	81	96.7 Å²	96.7	50%	0.497	53%	0.534	S	S	.	.	H	α-helix	trans	-62.4	-46.2	175	-58.1	0	0	0	0	111	C19 N20 L21 K25 A26 T27	C19-T23 WeakPolarHBondContact O-CB 3.34Å; C19-T23 PolarHBondContact O-N 3.47Å; C19-T23 PolarHBondContact O-OG1 2.91Å; N20-T23 WeakPolarHBondContact O-CB 3.3Å; N20-T23 PolarHBondContact O-N 2.91Å; L21-T23 VanDerWaalsContact C-N 3.34Å; T23-K25 PolarHBondContact O-N 3.31Å; T23-A26 PolarHBondContact O-N 3.27Å; T23-T27 PolarHBondContact O-N 2.89Å; T23-T27 PolarHBondContact O-OG1 3.45Å
24	M	57.4	Low	63.2	Low	119 Å²	119	101.4 Å²	101.4	59%	0.586	55%	0.554	S	S	*	*	H	α-helix	trans	-65.3	-36.9	177.1	-67.7	-129.3	-71.8	0	0	112.7	N20 L21 T27 S28	N20-M24 WeakPolarHBondContact O-CG 3.44Å; N20-M24 PolarHBondContact O-N 3.32Å; L21-M24 PolarHBondContact O-N 2.81Å; M24-T27 PolarHBondContact O-N 3.39Å; M24-S28 WeakPolarHBondContact O-CB 3.26Å; M24-S28 PolarHBondContact O-N 3.5Å
25	K	57	Low	61	Low	159 Å²	159	100.4 Å²	100.4	69%	0.691	57%	0.567	S	S	*	*	H	α-helix	trans	-67.7	-38.6	176.9	-164.2	171.4	-177.4	176.5	0	111.9	L21 N22 T23 A29	L21-K25 WeakPolarHBondContact O-CB 3.48Å; L21-K25 PolarHBondContact O-N 2.91Å; N22-K25 PolarHBondContact O-N 2.95Å; T23-K25 PolarHBondContact O-N 3.31Å; K25-A29 WeakPolarHBondContact O-CB 3.43Å; K25-A29 PolarHBondContact O-N 3.44Å
26	A	53.5	Low	59.2	Low	65 Å²	65	99.8 Å²	99.8	54%	0.537	58%	0.579	S	S	.	*	H	α-helix	trans	-66.7	-40.4	174.2	0	0	0	0	0	112.2	N22 T23 N30	N22-A26 WeakPolarHBondContact O-CB 3.26Å; N22-A26 PolarHBondContact O-N 3.45Å; T23-A26 PolarHBondContact O-N 3.27Å; A26-N30 PolarHBondContact O-N 2.9Å
27	T	54.5	Low	57.5	Low	85 Å²	85	102.3 Å²	102.3	52%	0.521	60%	0.595	S	S	.	*	H	α-helix	trans	-66.8	-40.3	176.1	-56.7	0	0	0	0	112.1	T23 M24 N30 S31	T23-T27 PolarHBondContact O-N 2.89Å; T23-T27 PolarHBondContact O-OG1 3.45Å; M24-T27 PolarHBondContact O-N 3.39Å; T27-N30 PolarHBondContact O-N 2.78Å; T27-S31 PolarHBondContact O-N 3.23Å
28	S	51.3	Low	55.7	Low	59 Å²	59	104 Å²	104	41%	0.413	62%	0.615	S	S	.	*	H	α-helix	trans	-70	-34.6	177.8	-172.9	0	0	0	0	113.2	M24	M24-S28 WeakPolarHBondContact O-CB 3.26Å; M24-S28 PolarHBondContact O-N 3.5Å
29	A	48.5	Very low	54	Low	63 Å²	63	105.5 Å²	105.5	52%	0.521	63%	0.628	S	S	.	*	H	α-helix	trans	-69.1	-35.6	175.9	0	0	0	0	0	112.3	K25 T33	K25-A29 WeakPolarHBondContact O-CB 3.43Å; K25-A29 PolarHBondContact O-N 3.44Å; A29-T33 PolarHBondContact O-OG1 3.48Å
30	N	50.6	Low	52.3	Low	118 Å²	118	106.5 Å²	106.5	63%	0.631	64%	0.636	S	S	*	*	H	α-helix	trans	-71.7	-35.5	179.8	-164.7	14.3	0	0	0	112.9	A26 T27 R32	A26-N30 PolarHBondContact O-N 2.9Å; T27-N30 PolarHBondContact O-N 2.78Å; N30-R32 PolarHBondContact O-N 2.96Å
31	S	48.5	Very low	50.9	Low	93 Å²	93	109.6 Å²	109.6	65%	0.65	66%	0.657	S	S	*	*	H	α-helix	trans	-78.4	-11.1	-179.4	-67.1	0	0	0	0	115	T27	T27-S31 PolarHBondContact O-N 3.23Å
32	R	51.4	Low	49.2	Very low	217 Å²	217	113.6 Å²	113.6	82%	0.819	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.2	-13.5	178.9	-87.1	-175.2	-172.3	147.4	4.1	114.8	N30	N30-R32 PolarHBondContact O-N 2.96Å
33	T	48.9	Very low	47.6	Very low	113 Å²	113	112.2 Å²	112.2	69%	0.693	68%	0.682	S	S	*	*	S	Bend	trans	-98.1	-0.3	-176.9	17.1	0	0	0	0	114.8	A29	A29-T33 PolarHBondContact O-OG1 3.48Å
34	H	44	Very low	46.3	Very low	166 Å²	166	113.3 Å²	113.3	77%	0.769	70%	0.7	S	S	*	*	S	Bend	trans	-133.4	110.1	174	-87.3	-83	0	0	0	109.9
35	G	35.5	Very low	45.5	Very low	74 Å²	74	114 Å²	114	76%	0.763	71%	0.711	S	S	*	*			trans	143.3	19.8	164.8	0	0	0	0	0	118	T37	G35-T37 PolarHBondContact O-N 2.92Å; G35-T37 VanDerWaalsContact O-N 3.11Å
36	A	42.3	Very low	44.8	Very low	107 Å²	107	111.7 Å²	111.7	88%	0.884	72%	0.715	S	S	*	*			trans	-79.8	69.8	160	0	0	0	0	0	109.8
37	T	41.2	Very low	44.5	Very low	111 Å²	111	115.3 Å²	115.3	68%	0.681	73%	0.73	S	S	*	*			trans	-137.2	88.4	166.5	-51.2	0	0	0	0	109.1	G35 T39	G35-T37 PolarHBondContact O-N 2.92Å; G35-T37 VanDerWaalsContact O-N 3.11Å; T37-T39 PolarHBondContact O-N 3.29Å
38	S	43	Very low	43.6	Very low	128 Å²	128	115.8 Å²	115.8	90%	0.895	74%	0.743	S	S	*	*			trans	-59.6	112.3	163.4	-61.3	0	0	0	0	108.8
39	T	43.9	Very low	43.4	Very low	110 Å²	110	122.6 Å²	122.6	68%	0.675	77%	0.765	S	S	*	*			trans	-109.5	99	167.2	-36.6	0	0	0	0	107.2	T37 T41	T37-T39 PolarHBondContact O-N 3.29Å; T39-T41 PolarHBondContact O-N 3.02Å
40	S	41.7	Very low	43	Very low	100 Å²	100	125.4 Å²	125.4	70%	0.699	78%	0.778	S	S	*	*			trans	-69.8	114.9	166	175.2	0	0	0	0	107.9
41	T	43.2	Very low	42.7	Very low	132 Å²	132	124.5 Å²	124.5	81%	0.81	79%	0.787	S	S	*	*			trans	-102.4	91	169.6	15.3	0	0	0	0	109.2	T39	T39-T41 PolarHBondContact O-N 3.02Å
42	H	39.2	Very low	42.5	Very low	185 Å²	185	124.5 Å²	124.5	86%	0.856	79%	0.792	S	S	*	*			trans	-69.4	125.4	148.9	-90.3	-79.3	0	0	0	108.1
43	G	37	Very low	42.1	Very low	71 Å²	71	119.2 Å²	119.2	73%	0.732	79%	0.789	S	S	*	*			trans	-173	78.2	177.5	0	0	0	0	0	110.8
44	A	40.5	Very low	42	Very low	105 Å²	105	120.6 Å²	120.6	87%	0.868	80%	0.797	S	S	*	*			trans	-69.7	127.2	173.7	0	0	0	0	0	110.4
45	T	40	Very low	41.9	Very low	133 Å²	133	118.3 Å²	118.3	82%	0.816	80%	0.797	S	S	*	*			trans	-123.6	109.1	160.6	-57	0	0	0	0	107.9
46	S	42.2	Very low	42.2	Very low	111 Å²	111	120.7 Å²	120.7	78%	0.776	80%	0.799	S	S	*	*			trans	-83	125.9	175.1	-177.7	0	0	0	0	109.7
47	T	46.2	Very low	42.4	Very low	140 Å²	140	125.3 Å²	125.3	86%	0.859	80%	0.799	S	S	*	*			trans	-136	110.2	159.8	9.9	0	0	0	0	107.4
48	A	36.4	Very low	42.4	Very low	95 Å²	95	124.8 Å²	124.8	79%	0.785	81%	0.806	S	S	*	*			trans	-85.4	146.4	-176.4	0	0	0	0	0	112.3
49	K	47.9	Very low	42.4	Very low	203 Å²	203	123.7 Å²	123.7	88%	0.883	81%	0.805	S	S	*	*				-165.3	139.6	123.1	-162.6	164	-178	-179.1	0	110
50	P	39.9	Very low	42.6	Very low	121 Å²	121	123 Å²	123	79%	0.786	81%	0.81	S	S	*	*			trans	-103.3	157.7	-152.5	37.8	-31.2	0	0	0	114.4
51	A	43.1	Very low	42.5	Very low	100 Å²	100	124.5 Å²	124.5	83%	0.826	82%	0.815	S	S	*	*			trans	-148.4	127.4	158	0	0	0	0	0	111.6
52	A	46	Very low	42.5	Very low	92 Å²	92	123.5 Å²	123.5	76%	0.76	81%	0.813	S	S	*	*			trans	60.6	91.5	153.9	0	0	0	0	0	120.7
53	S	42.6	Very low	42.9	Very low	107 Å²	107	120.6 Å²	120.6	75%	0.748	81%	0.809	S	S	*	*				38.9	108.6	125.1	59	0	0	0	0	120.4
54	T	46.5	Very low	43.4	Very low	141 Å²	141	124.6 Å²	124.6	87%	0.865	81%	0.812	S	S	*	*			trans	-176.2	116.7	131.7	18.7	0	0	0	0	109.6
55	P	41.4	Very low	43.9	Very low	118 Å²	118	127.9 Å²	127.9	77%	0.766	81%	0.807	S	S	*	*			trans	-93.8	149.1	162.9	35.6	-27.2	0	0	0	108.9
56	P	43	Very low	44.8	Very low	124 Å²	124	126.9 Å²	126.9	81%	0.805	80%	0.803	S	S	*	*				-153.8	157.7	92.4	38.7	-19.7	0	0	0	117.2
57	K	44.8	Very low	45.1	Very low	205 Å²	205	127.5 Å²	127.5	89%	0.891	80%	0.802	S	S	*	*			trans	85.5	112.1	141.7	-147.2	164.3	-174.5	175.5	0	119.3
58	A	42.4	Very low	45.5	Very low	99 Å²	99	126.5 Å²	126.5	82%	0.818	80%	0.795	S	S	*	*			trans	-58.7	145	171.8	0	0	0	0	0	113.7
59	A	43.1	Very low	46.3	Very low	106 Å²	106	128.3 Å²	128.3	88%	0.876	80%	0.797	S	S	*	*			trans	-134.7	144.2	155.1	0	0	0	0	0	109
60	A	47.7	Very low	46.5	Very low	94 Å²	94	124.3 Å²	124.3	78%	0.777	79%	0.789	S	S	*	*			trans	-82	157	-152.9	0	0	0	0	0	115.8
61	T	39.6	Very low	46.6	Very low	132 Å²	132	124 Å²	124	81%	0.81	79%	0.788	S	S	*	*			trans	-17	135.6	154.6	13	0	0	0	0	117.7
62	S	44.1	Very low	46.9	Very low	111 Å²	111	129.2 Å²	129.2	78%	0.776	79%	0.791	S	S	*	*			trans	-148.6	117.2	137.1	-162	0	0	0	0	111
63	T	45.9	Very low	46.9	Very low	125 Å²	125	129.4 Å²	129.4	77%	0.767	79%	0.793	S	S	*	*			trans	-86.7	116.8	173.7	-58.9	0	0	0	0	108.1
64	I	49	Very low	46.9	Very low	155 Å²	155	129.1 Å²	129.1	80%	0.795	80%	0.797	S	S	*	*			trans	-99	110.1	169.3	-58.3	-173.1	0	0	0	108.5
65	K	51.2	Low	47	Very low	174 Å²	174	126.3 Å²	126.3	76%	0.757	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-75.7	130.4	169.2	-176.6	-175.5	-178.5	-169.4	0	108.7	T67	K65-T67 PolarHBondContact O-N 3.01Å
66	P	58.7	Low	47.3	Very low	112 Å²	112	127.1 Å²	127.1	73%	0.727	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-74.2	122.1	171.8	27.1	-28.9	0	0	0	109.9
67	T	48.2	Very low	47.4	Very low	124 Å²	124	126.6 Å²	126.6	76%	0.761	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-80	119	168.2	-61.2	0	0	0	0	108.6	K65	K65-T67 PolarHBondContact O-N 3.01Å
68	V	54.9	Low	47.4	Very low	119 Å²	119	122.5 Å²	122.5	72%	0.721	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-90.5	121.8	167.8	175.1	0	0	0	0	107.8
69	T	52.5	Low	47.4	Very low	133 Å²	133	126 Å²	126	82%	0.816	79%	0.786	S	S	*	*			trans	-105.5	110.2	165.3	29.2	0	0	0	0	109.5
70	T	51.5	Low	47.4	Very low	118 Å²	118	130 Å²	130	72%	0.724	78%	0.784	S	S	*	*			trans	-84.6	-178	174	-24.7	0	0	0	0	110.5
71	P	43.6	Very low	47.1	Very low	116 Å²	116	130.4 Å²	130.4	75%	0.753	78%	0.779	S	S	*	*				-120.9	-176.4	-104.1	41.3	-23.5	0	0	0	113.3
72	K	49.2	Very low	47.1	Very low	208 Å²	208	130.8 Å²	130.8	90%	0.904	78%	0.781	S	S	*	*			trans	-129.5	128	161.1	-168.3	169.9	-177.6	176.1	0	111.5
73	A	45.5	Very low	47.1	Very low	96 Å²	96	131.1 Å²	131.1	79%	0.793	78%	0.778	S	S	*	*			trans	-90.7	156.7	-172.8	0	0	0	0	0	114.2
74	A	42.4	Very low	46.9	Very low	102 Å²	102	131.5 Å²	131.5	84%	0.843	78%	0.78	S	S	*	*			trans	-167.3	145.1	149.9	0	0	0	0	0	106.9
75	A	47.8	Very low	46.5	Very low	82 Å²	82	130.1 Å²	130.1	68%	0.678	78%	0.779	S	S	*	*			cis	-173.6	140.4	-9.9	0	0	0	0	0	105.9
76	T	48.3	Very low	46.2	Very low	135 Å²	135	127.7 Å²	127.7	83%	0.828	78%	0.784	S	S	*	*			trans	57	122.6	146.5	-18.1	0	0	0	0	118.5
77	S	44.3	Very low	45.7	Very low	112 Å²	112	132.2 Å²	132.2	78%	0.783	79%	0.792	S	S	*	*				-171.2	148.2	63.5	-170.5	0	0	0	0	112.9
78	T	44.7	Very low	45.2	Very low	119 Å²	119	131.9 Å²	131.9	73%	0.73	79%	0.792	S	S	*	*			trans	-60	136.2	178.7	-47.8	0	0	0	0	115.8
79	I	43.8	Very low	44.5	Very low	173 Å²	173	131.5 Å²	131.5	89%	0.887	80%	0.795	S	S	*	*			trans	-145.6	133.8	133.8	-60.3	-166.9	0	0	0	108.8
80	K	43.1	Very low	44.4	Very low	190 Å²	190	131.2 Å²	131.2	83%	0.826	80%	0.795	S	S	*	*			trans	-69.4	163.9	-173.7	-115.3	-168.4	170.5	-173.7	0	114.3
81	P	41.5	Very low	44.2	Very low	103 Å²	103	130 Å²	130	67%	0.669	80%	0.798	S	S	*	*			trans	-100.3	160.7	-159.4	39.8	-34.7	0	0	0	114.4
82	T	38.3	Very low	44.5	Very low	140 Å²	140	133.6 Å²	133.6	86%	0.859	80%	0.801	S	S	*	*			trans	-132.4	124.6	158.9	-59	0	0	0	0	109.4
83	V	43.9	Very low	44.7	Very low	118 Å²	118	129.5 Å²	129.5	72%	0.715	80%	0.796	S	S	*	*			trans	-92.6	127	176.9	173.7	0	0	0	0	108.5
84	T	43.4	Very low	44.8	Very low	133 Å²	133	129.5 Å²	129.5	82%	0.816	80%	0.796	S	S	*	*			trans	-142.7	110.2	151.8	38.2	0	0	0	0	109.3
85	T	38.9	Very low	45.2	Very low	126 Å²	126	128.8 Å²	128.8	77%	0.773	79%	0.79	S	S	*	*			trans	-61.9	133.6	168.7	42	0	0	0	0	111.3
86	S	46.3	Very low	45.3	Very low	123 Å²	123	129.6 Å²	129.6	86%	0.86	79%	0.791	S	S	*	*			trans	-151.4	130.8	157.7	-68.5	0	0	0	0	109.1
87	K	47.1	Very low	45.4	Very low	206 Å²	206	130.5 Å²	130.5	90%	0.896	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-58.6	162.6	-172.9	-113.4	179.5	167.8	169.3	0	114.1
88	P	38.6	Very low	45.7	Very low	117 Å²	117	131 Å²	131	76%	0.76	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-81.3	140	-160.2	33.5	-33.3	0	0	0	112.8
89	S	40.3	Very low	46	Very low	111 Å²	111	129.5 Å²	129.5	78%	0.776	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-98.1	121.4	163.6	-174.4	0	0	0	0	108.9	A91	S89-A91 PolarHBondContact O-N 3.09Å
90	P	50.8	Low	46.5	Very low	127 Å²	127	130.1 Å²	130.1	83%	0.825	79%	0.785	S	S	*	*			trans	-76	94.1	175.5	29.4	-28.9	0	0	0	108.9	K92	P90-K92 PolarHBondContact O-N 3.33Å
91	A	46.3	Very low	47.1	Very low	94 Å²	94	126.3 Å²	126.3	78%	0.777	78%	0.78	S	S	*	*			trans	-74.3	112.2	168.4	0	0	0	0	0	109.2	S89	S89-A91 PolarHBondContact O-N 3.09Å
92	K	49.2	Very low	47.7	Very low	190 Å²	190	126 Å²	126	83%	0.826	79%	0.785	S	S	*	*			trans	-39.6	134.1	172	-171	176.2	-175.7	179	0	111.8	P90 A94	P90-K92 PolarHBondContact O-N 3.33Å; K92-A94 PolarHBondContact O-N 2.89Å
93	P	54.6	Low	48.2	Very low	122 Å²	122	123.8 Å²	123.8	79%	0.792	78%	0.782	S	S	*	*			trans	-62.3	113.9	175.7	-17	28.9	0	0	0	109.7	A95	P93-A95 PolarHBondContact O-N 3.36Å
94	A	47.6	Very low	48.8	Very low	96 Å²	96	123.4 Å²	123.4	79%	0.793	78%	0.784	S	S	*	*			trans	-68.2	118.7	164.1	0	0	0	0	0	107.2	K92 S96	K92-A94 PolarHBondContact O-N 2.89Å; A94-S96 PolarHBondContact O-N 3.33Å
95	A	51.4	Low	49.5	Very low	87 Å²	87	123 Å²	123	72%	0.719	78%	0.782	S	S	*	*			trans	-55.3	107.4	175.6	0	0	0	0	0	109.2	P93 N97	P93-A95 PolarHBondContact O-N 3.36Å; A95-N97 PolarHBondContact O-N 2.88Å
96	S	48	Very low	49.9	Very low	99 Å²	99	123 Å²	123	69%	0.692	78%	0.784	S	S	*	*			trans	-65.6	102.5	166.7	171.6	0	0	0	0	107.1	A94 T98	A94-S96 PolarHBondContact O-N 3.33Å; S96-T98 PolarHBondContact O-N 3.5Å; S96-T98 PolarHBondContact O-OG1 2.89Å
97	N	51	Low	50.6	Low	155 Å²	155	126.9 Å²	126.9	83%	0.829	79%	0.785	S	S	*	*			trans	-59	90.8	164.3	-75.6	-36.8	0	0	0	107.6	A95 A99	A95-N97 PolarHBondContact O-N 2.88Å; N97-A99 VanDerWaalsContact C-N 3.27Å; N97-A99 PolarHBondContact O-N 3.32Å
98	T	50.9	Low	51.2	Low	122 Å²	122	125.3 Å²	125.3	75%	0.748	78%	0.778	S	S	*	*			trans	-71.5	93.7	170.6	-53.3	0	0	0	0	105.4	S96 K100	S96-T98 PolarHBondContact O-N 3.5Å; S96-T98 PolarHBondContact O-OG1 2.89Å; T98-K100 PolarHBondContact O-N 3.5Å
99	A	51.3	Low	51.8	Low	87 Å²	87	124.5 Å²	124.5	72%	0.719	77%	0.773	S	S	*	*			trans	-56.4	114.1	171.4	0	0	0	0	0	107.8	N97 P101	N97-A99 VanDerWaalsContact C-N 3.27Å; N97-A99 PolarHBondContact O-N 3.32Å; A99-P101 WeakPolarHBondContact O-CD 3.34Å
100	K	53.5	Low	52.9	Low	187 Å²	187	125.5 Å²	125.5	81%	0.813	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-52.3	122.4	171.6	-179.4	177.4	-179.2	-179.2	0	107.9	T98 A102	T98-K100 PolarHBondContact O-N 3.5Å; K100-A102 PolarHBondContact O-N 3.36Å; K100-A102 VanDerWaalsContact O-N 3.1Å
101	P	55.8	Low	53.6	Low	110 Å²	110	123.8 Å²	123.8	71%	0.714	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-56	122.5	170.2	-20.6	31.2	0	0	0	107.7	A99 A103	A99-P101 WeakPolarHBondContact O-CD 3.34Å; P101-A103 PolarHBondContact O-N 2.87Å; P101-A103 VanDerWaalsContact O-N 3.09Å
102	A	53.7	Low	54.4	Low	95 Å²	95	126.6 Å²	126.6	79%	0.785	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-53.3	121.6	169.8	0	0	0	0	0	107	K100 S104	K100-A102 PolarHBondContact O-N 3.36Å; K100-A102 VanDerWaalsContact O-N 3.1Å; A102-S104 PolarHBondContact O-N 3.38Å
103	A	50.4	Low	55	Low	95 Å²	95	128.1 Å²	128.1	79%	0.785	75%	0.747	S	S	*	*			trans	-58.3	106.3	177.6	0	0	0	0	0	107.5	P101 T105	P101-A103 PolarHBondContact O-N 2.87Å; P101-A103 VanDerWaalsContact O-N 3.09Å; A103-T105 PolarHBondContact O-N 3.44Å; A103-T105 VanDerWaalsContact O-N 3.11Å
104	S	56.2	Low	55.4	Low	109 Å²	109	125 Å²	125	76%	0.762	73%	0.731	S	S	*	*			trans	-59	115.8	170.2	47.5	0	0	0	0	107	A102	A102-S104 PolarHBondContact O-N 3.38Å
105	T	57.3	Low	56.4	Low	125 Å²	125	124.1 Å²	124.1	77%	0.767	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-49.5	132.8	172.7	32.4	0	0	0	0	109.3	A103 K107	A103-T105 PolarHBondContact O-N 3.44Å; A103-T105 VanDerWaalsContact O-N 3.11Å; T105-K107 PolarHBondContact O-N 3.39Å
106	P	48.5	Very low	57	Low	126 Å²	126	126.3 Å²	126.3	82%	0.818	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-58.3	117.2	177.9	-18.5	29.3	0	0	0	108.4	K108	P106-K108 PolarHBondContact O-N 3.44Å; P106-K108 VanDerWaalsContact O-N 3.13Å
107	K	59.8	Low	57.7	Low	204 Å²	204	124.3 Å²	124.3	89%	0.887	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-58.2	121.5	164.8	-81.9	-178.7	178.5	171.7	0	106.4	T105	T105-K107 PolarHBondContact O-N 3.39Å
108	K	59.6	Low	58.5	Low	173 Å²	173	120.1 Å²	120.1	75%	0.752	69%	0.691	S	S	*	*			trans	-43.7	135.8	174.1	-170.1	176.4	-179.2	-178.6	0	108.9	P106 H110	P106-K108 PolarHBondContact O-N 3.44Å; P106-K108 VanDerWaalsContact O-N 3.13Å; K108-H110 PolarHBondContact O-N 3.35Å
109	P	52.9	Low	59.3	Low	101 Å²	101	115.7 Å²	115.7	66%	0.656	67%	0.667	S	S	*	*			trans	-52	130.8	178.6	19.1	-30.1	0	0	0	109.1	D111	P109-D111 VanDerWaalsContact C-N 3.33Å; P109-D111 PolarHBondContact O-N 2.96Å
110	H	62.9	Low	60.2	Low	132 Å²	132	113.6 Å²	113.6	61%	0.611	65%	0.65	S	S	*	*			trans	-61.6	97.6	171.6	173.2	-74.3	0	0	0	107.2	K108 E112 V115	K108-H110 PolarHBondContact O-N 3.35Å; H110-E112 PolarHBondContact O-N 3.19Å; H110-V115 VanDerWaalsContact CE1-CG2 3.4Å; H110-V115 WeakPolarHBondContact CE1-CG2 3.29Å; H110-V115 WeakPolarHBondContact NE2-CG2 3.43Å
111	D	64	Low	61.1	Low	90 Å²	90	108.6 Å²	108.6	48%	0.481	64%	0.635	S	S	.	*			trans	-66	96.8	175.7	-77.4	-44.1	0	0	0	108	P109 R113 A114 V115	P109-D111 VanDerWaalsContact C-N 3.33Å; P109-D111 PolarHBondContact O-N 2.96Å; D111-R113 PolarHBondContact O-N 3.13Å; D111-A114 HydrophobicContact CB-CB 3.94Å; D111-A114 WeakPolarHBondContact O-CA 3.23Å; D111-A114 VanDerWaalsContact O-CB 3.31Å; D111-A114 WeakPolarHBondContact O-CB 3.46Å; D111-A114 PolarHBondContact O-N 2.96Å; D111-V115 PolarHBondContact O-N 3.05Å
112	E	65.1	Low	62.1	Low	153 Å²	153	106.1 Å²	106.1	72%	0.715	62%	0.618	S	S	*	*	H	α-helix	trans	-53.4	-30.1	176.8	-63	-174.7	155.9	0	0	111.6	H110 A114 V115 L116	H110-E112 PolarHBondContact O-N 3.19Å; E112-A114 VanDerWaalsContact C-N 3.34Å; E112-A114 PolarHBondContact O-N 2.93Å; E112-V115 PolarHBondContact O-N 2.92Å; E112-L116 WeakPolarHBondContact O-CB 3.27Å; E112-L116 PolarHBondContact O-N 3.34Å
113	R	59.8	Low	63.1	Low	222 Å²	222	106.7 Å²	106.7	84%	0.838	61%	0.607	S	S	*	*	H	α-helix	trans	-62.4	-36.6	172.5	-68.3	-176.1	175.6	-119.4	-0.3	113.2	D111 L116 A117	D111-R113 PolarHBondContact O-N 3.13Å; R113-L116 PolarHBondContact O-N 2.93Å; R113-A117 VanDerWaalsContact O-CB 3.26Å; R113-A117 WeakPolarHBondContact O-CB 3.42Å; R113-A117 PolarHBondContact O-N 3.29Å
114	A	64.3	Low	64.4	Low	57 Å²	57	106 Å²	106	47%	0.471	59%	0.593	S	S	.	*	H	α-helix	trans	-69.9	-37.2	176.8	0	0	0	0	0	111.1	D111 E112 A117 A118	D111-A114 HydrophobicContact CB-CB 3.94Å; D111-A114 WeakPolarHBondContact O-CA 3.23Å; D111-A114 VanDerWaalsContact O-CB 3.31Å; D111-A114 WeakPolarHBondContact O-CB 3.46Å; D111-A114 PolarHBondContact O-N 2.96Å; E112-A114 VanDerWaalsContact C-N 3.34Å; E112-A114 PolarHBondContact O-N 2.93Å; A114-A117 PolarHBondContact O-N 3.18Å; A114-A118 VanDerWaalsContact O-CB 3.26Å; A114-A118 WeakPolarHBondContact O-CB 3.33Å; A114-A118 PolarHBondContact O-N 3Å
115	V	67.7	Low	65.5	Low	77 Å²	77	106.4 Å²	106.4	47%	0.467	59%	0.586	S	S	.	*	H	α-helix	trans	-67.7	-42.4	174.5	179.8	0	0	0	0	111.2	H110 D111 E112 A118 A119	H110-V115 VanDerWaalsContact CE1-CG2 3.4Å; H110-V115 WeakPolarHBondContact CE1-CG2 3.29Å; H110-V115 WeakPolarHBondContact NE2-CG2 3.43Å; D111-V115 PolarHBondContact O-N 3.05Å; E112-V115 PolarHBondContact O-N 2.92Å; V115-A118 PolarHBondContact O-N 2.97Å; V115-A119 WeakPolarHBondContact O-CB 3.38Å; V115-A119 PolarHBondContact O-N 2.74Å
116	L	63.7	Low	66.5	Low	134 Å²	134	102.5 Å²	102.5	70%	0.702	57%	0.57	S	S	*	*	H	α-helix	trans	-64.4	-42	176.3	-142.9	77.4	0	0	0	111.6	E112 R113 A119 A120	E112-L116 WeakPolarHBondContact O-CB 3.27Å; E112-L116 PolarHBondContact O-N 3.34Å; R113-L116 PolarHBondContact O-N 2.93Å; L116-A119 PolarHBondContact O-N 3.1Å; L116-A120 WeakPolarHBondContact O-CB 3.42Å; L116-A120 PolarHBondContact O-N 3.37Å
117	A	64.1	Low	68	Low	57 Å²	57	100.3 Å²	100.3	47%	0.471	55%	0.554	S	S	.	*	H	α-helix	trans	-62.3	-47.6	174.6	0	0	0	0	0	111.1	R113 A114 A119 A120 V121	R113-A117 VanDerWaalsContact O-CB 3.26Å; R113-A117 WeakPolarHBondContact O-CB 3.42Å; R113-A117 PolarHBondContact O-N 3.29Å; A114-A117 PolarHBondContact O-N 3.18Å; A117-A119 VanDerWaalsContact C-N 3.26Å; A117-A119 PolarHBondContact O-N 3.01Å; A117-A120 PolarHBondContact O-N 3.38Å; A117-A120 VanDerWaalsContact O-N 3.09Å; A117-V121 WeakPolarHBondContact O-CG2 3.48Å; A117-V121 PolarHBondContact O-N 2.89Å
118	A	67.3	Low	69.1	Low	66 Å²	66	94.7 Å²	94.7	55%	0.545	53%	0.533	S	S	.	.	H	α-helix	trans	-61.3	-34.4	177.1	0	0	0	0	0	112.6	A114 V115 P122	A114-A118 VanDerWaalsContact O-CB 3.26Å; A114-A118 WeakPolarHBondContact O-CB 3.33Å; A114-A118 PolarHBondContact O-N 3Å; V115-A118 PolarHBondContact O-N 2.97Å; A118-P122 VanDerWaalsContact O-CD 3.27Å; A118-P122 WeakPolarHBondContact O-CD 3.48Å
119	A	67.1	Low	70.2	Confident	30 Å²	30	88.5 Å²	88.5	25%	0.248	52%	0.519	C	S	.	.	H	α-helix	trans	-72.9	-28.7	175.1	0	0	0	0	0	113.3	V115 L116 A117 P122	V115-A119 WeakPolarHBondContact O-CB 3.38Å; V115-A119 PolarHBondContact O-N 2.74Å; L116-A119 PolarHBondContact O-N 3.1Å; A117-A119 VanDerWaalsContact C-N 3.26Å; A117-A119 PolarHBondContact O-N 3.01Å; A119-P122 WeakPolarHBondContact O-CD 3.49Å; A119-P122 WeakPolarHBondContact O-CG 3.36Å
120	A	70.6	Confident	71.4	Confident	43 Å²	43	89.1 Å²	89.1	36%	0.355	51%	0.513	S	S	.	.	H	α-helix	trans	-78.6	-29.6	179.3	0	0	0	0	0	113.3	L116 A117 I123 V124	L116-A120 WeakPolarHBondContact O-CB 3.42Å; L116-A120 PolarHBondContact O-N 3.37Å; A117-A120 PolarHBondContact O-N 3.38Å; A117-A120 VanDerWaalsContact O-N 3.09Å; A120-I123 WeakPolarHBondContact O-CB 3.34Å; A120-I123 PolarHBondContact O-N 2.79Å; A120-I123 VanDerWaalsContact O-N 3.13Å; A120-V124 WeakPolarHBondContact O-CG2 3.46Å; A120-V124 PolarHBondContact O-N 3.1Å
121	V	73.2	Confident	72.2	Confident	82 Å²	82	86.5 Å²	86.5	50%	0.497	51%	0.506	S	S	.	.	H	α-helix	trans	-50.5	-52.9	178.9	175.8	0	0	0	0	113.4	A117 I123 V124 L125	A117-V121 WeakPolarHBondContact O-CG2 3.48Å; A117-V121 PolarHBondContact O-N 2.89Å; V121-I123 VanDerWaalsContact C-N 3.27Å; V121-I123 PolarHBondContact O-N 3.26Å; V121-V124 PolarHBondContact O-N 3.42Å; V121-L125 HydrophobicContact CG1-CD1 4.37Å; V121-L125 PolarHBondContact O-N 3.46Å
122	P	76.4	Confident	73.2	Confident	57 Å²	57	86.4 Å²	86.4	37%	0.37	50%	0.504	S	S	.	.	H	α-helix	trans	-65.7	-30	-179	24	-34.1	0	0	0	113.1	A118 A119 G126	A118-P122 VanDerWaalsContact O-CD 3.27Å; A118-P122 WeakPolarHBondContact O-CD 3.48Å; A119-P122 WeakPolarHBondContact O-CD 3.49Å; A119-P122 WeakPolarHBondContact O-CG 3.36Å; P122-G126 PolarHBondContact O-N 2.91Å
123	I	75.1	Confident	74	Confident	107 Å²	107	80.9 Å²	80.9	55%	0.549	49%	0.488	S	S	.	.	H	α-helix	trans	-66.4	-49.4	176.1	-56.8	173.3	0	0	0	109.3	A120 V121 L125 G126 V127	A120-I123 WeakPolarHBondContact O-CB 3.34Å; A120-I123 PolarHBondContact O-N 2.79Å; A120-I123 VanDerWaalsContact O-N 3.13Å; V121-I123 VanDerWaalsContact C-N 3.27Å; V121-I123 PolarHBondContact O-N 3.26Å; I123-L125 PolarHBondContact O-N 2.92Å; I123-G126 PolarHBondContact O-N 3.43Å; I123-V127 WeakPolarHBondContact O-CG2 3.42Å; I123-V127 PolarHBondContact O-N 3Å
124	V	77.8	Confident	75	Confident	81 Å²	81	77.6 Å²	77.6	49%	0.491	48%	0.48	S	S	.	.	H	α-helix	trans	-62.2	-45	179.1	175.5	0	0	0	0	110.8	A120 V121 G126 V127 I128	A120-V124 WeakPolarHBondContact O-CG2 3.46Å; A120-V124 PolarHBondContact O-N 3.1Å; V121-V124 PolarHBondContact O-N 3.42Å; V124-G126 VanDerWaalsContact C-N 3.32Å; V124-G126 PolarHBondContact O-N 3.21Å; V124-V127 PolarHBondContact O-N 3Å; V124-I128 HydrophobicContact CG1-CD1 3.73Å; V124-I128 HydrophobicContact CG1-CG1 4.48Å; V124-I128 WeakPolarHBondContact O-CD1 3.22Å; V124-I128 VanDerWaalsContact O-CG1 3.22Å; V124-I128 WeakPolarHBondContact O-CG1 3.43Å; V124-I128 PolarHBondContact O-N 3.3Å
125	L	78.6	Confident	76	Confident	118 Å²	118	78.9 Å²	78.9	62%	0.618	48%	0.479	S	S	*	.	H	α-helix	trans	-60.7	-40.7	175.2	-114	76.2	0	0	0	112.3	V121 I123 I128 G129	V121-L125 HydrophobicContact CG1-CD1 4.37Å; V121-L125 PolarHBondContact O-N 3.46Å; I123-L125 PolarHBondContact O-N 2.92Å; L125-I128 PolarHBondContact O-N 3.26Å; L125-G129 PolarHBondContact O-N 3.49Å
126	G	78.6	Confident	76.7	Confident	42 Å²	42	80.5 Å²	80.5	43%	0.433	48%	0.484	S	S	.	.	H	α-helix	trans	-62.1	-47.4	177.5	0	0	0	0	0	112.4	P122 I123 V124 I128 G129 E130	P122-G126 PolarHBondContact O-N 2.91Å; I123-G126 PolarHBondContact O-N 3.43Å; V124-G126 VanDerWaalsContact C-N 3.32Å; V124-G126 PolarHBondContact O-N 3.21Å; G126-I128 PolarHBondContact O-N 2.9Å; G126-G129 PolarHBondContact O-N 3.44Å; G126-E130 PolarHBondContact O-N 3.49Å
127	V	80.6	Confident	77.3	Confident	80 Å²	80	76.8 Å²	76.8	49%	0.485	46%	0.463	S	S	.	.	H	α-helix	trans	-62.5	-43.2	177	174.5	0	0	0	0	111.2	I123 V124 G129 E130 V131	I123-V127 WeakPolarHBondContact O-CG2 3.42Å; I123-V127 PolarHBondContact O-N 3Å; V124-V127 PolarHBondContact O-N 3Å; V127-G129 VanDerWaalsContact C-N 3.34Å; V127-G129 PolarHBondContact O-N 3.35Å; V127-E130 PolarHBondContact O-N 3.48Å; V127-V131 WeakPolarHBondContact O-CG2 3.45Å; V127-V131 PolarHBondContact O-N 3.39Å
128	I	82.8	Confident	78.2	Confident	87 Å²	87	82.6 Å²	82.6	45%	0.446	47%	0.474	S	S	.	.	H	α-helix	trans	-61.7	-44.7	176.3	-67.9	165.1	0	0	0	110.5	V124 L125 G126 E130 V131 I132	V124-I128 HydrophobicContact CG1-CD1 3.73Å; V124-I128 HydrophobicContact CG1-CG1 4.48Å; V124-I128 WeakPolarHBondContact O-CD1 3.22Å; V124-I128 VanDerWaalsContact O-CG1 3.22Å; V124-I128 WeakPolarHBondContact O-CG1 3.43Å; V124-I128 PolarHBondContact O-N 3.3Å; L125-I128 PolarHBondContact O-N 3.26Å; G126-I128 PolarHBondContact O-N 2.9Å; I128-E130 VanDerWaalsContact C-N 3.33Å; I128-E130 PolarHBondContact O-N 2.99Å; I128-V131 PolarHBondContact O-N 2.89Å; I128-I132 HydrophobicContact CG2-CD1 3.62Å; I128-I132 HydrophobicContact CG2-CG1 4.37Å; I128-I132 VanDerWaalsContact O-CG1 3.25Å; I128-I132 WeakPolarHBondContact O-CG1 3.5Å; I128-I132 PolarHBondContact O-N 3.27Å
129	G	82.2	Confident	78.9	Confident	43 Å²	43	85.3 Å²	85.3	44%	0.443	48%	0.478	S	S	.	.	H	α-helix	trans	-61	-39.7	176.7	0	0	0	0	0	113	L125 G126 V127 G133	L125-G129 PolarHBondContact O-N 3.49Å; G126-G129 PolarHBondContact O-N 3.44Å; V127-G129 VanDerWaalsContact C-N 3.34Å; V127-G129 PolarHBondContact O-N 3.35Å; G129-G133 PolarHBondContact O-N 3.45Å
130	E	77	Confident	79.2	Confident	113 Å²	113	87.8 Å²	87.8	53%	0.528	50%	0.499	S	S	.	.	H	α-helix	trans	-64.5	-46.4	175.7	-173.3	176.5	176.4	0	0	112	G126 V127 I128 G133 F134	G126-E130 PolarHBondContact O-N 3.49Å; V127-E130 PolarHBondContact O-N 3.48Å; I128-E130 VanDerWaalsContact C-N 3.33Å; I128-E130 PolarHBondContact O-N 2.99Å; E130-G133 PolarHBondContact O-N 3.4Å; E130-F134 WeakPolarHBondContact O-CB 3.44Å; E130-F134 PolarHBondContact O-N 3.32Å
131	V	80	Confident	78.9	Confident	78 Å²	78	92.2 Å²	92.2	47%	0.473	53%	0.527	S	S	.	.	H	α-helix	trans	-62	-45.6	177.7	173.1	0	0	0	0	110.9	V127 I128 G133 F134 I135	V127-V131 WeakPolarHBondContact O-CG2 3.45Å; V127-V131 PolarHBondContact O-N 3.39Å; I128-V131 PolarHBondContact O-N 2.89Å; V131-G133 PolarHBondContact O-N 2.89Å; V131-F134 PolarHBondContact O-N 2.87Å; V131-I135 HydrophobicContact CG1-CD1 3.8Å; V131-I135 WeakPolarHBondContact O-CD1 3.35Å; V131-I135 VanDerWaalsContact O-CG1 3.23Å; V131-I135 WeakPolarHBondContact O-CG1 3.26Å; V131-I135 PolarHBondContact O-N 2.9Å
132	I	84.4	Confident	79.2	Confident	87 Å²	87	92.7 Å²	92.7	45%	0.446	53%	0.529	S	S	.	.	H	α-helix	trans	-62.9	-43.9	176.9	-65.8	166.2	0	0	0	110.6	I128 F134 I135 L136	I128-I132 HydrophobicContact CG2-CD1 3.62Å; I128-I132 HydrophobicContact CG2-CG1 4.37Å; I128-I132 VanDerWaalsContact O-CG1 3.25Å; I128-I132 WeakPolarHBondContact O-CG1 3.5Å; I128-I132 PolarHBondContact O-N 3.27Å; I132-F134 VanDerWaalsContact C-N 3.33Å; I132-F134 PolarHBondContact O-N 2.94Å; I132-I135 PolarHBondContact O-N 2.97Å; I132-L136 HydrophobicContact CG2-CD1 3.87Å; I132-L136 HydrophobicContact CG2-CG 4.3Å; I132-L136 WeakPolarHBondContact O-CB 3.44Å; I132-L136 WeakPolarHBondContact O-CG 3.38Å; I132-L136 PolarHBondContact O-N 3Å
133	G	82.7	Confident	79.4	Confident	37 Å²	37	94.6 Å²	94.6	38%	0.381	54%	0.537	S	S	.	.	H	α-helix	trans	-60.7	-41	177	0	0	0	0	0	112.6	G129 E130 V131 Q137	G129-G133 PolarHBondContact O-N 3.45Å; E130-G133 PolarHBondContact O-N 3.4Å; V131-G133 PolarHBondContact O-N 2.89Å; G133-Q137 VanDerWaalsContact O-CB 3.26Å; G133-Q137 WeakPolarHBondContact O-CB 3.47Å; G133-Q137 PolarHBondContact O-N 3.44Å
134	F	81.2	Confident	79.6	Confident	153 Å²	153	93.9 Å²	93.9	67%	0.671	54%	0.536	S	S	*	.	H	α-helix	trans	-63.5	-44.4	175.1	-174.5	-96.6	0	0	0	112	E130 V131 I132 Q137 Y138	E130-F134 WeakPolarHBondContact O-CB 3.44Å; E130-F134 PolarHBondContact O-N 3.32Å; V131-F134 PolarHBondContact O-N 2.87Å; I132-F134 VanDerWaalsContact C-N 3.33Å; I132-F134 PolarHBondContact O-N 2.94Å; F134-Q137 PolarHBondContact O-N 3.5Å; F134-Y138 WeakPolarHBondContact O-CB 3.23Å; F134-Y138 PolarHBondContact O-N 3.28Å
135	I	84.3	Confident	79.7	Confident	85 Å²	85	94.6 Å²	94.6	44%	0.436	54%	0.539	S	S	.	.	H	α-helix	trans	-63.9	-47	177.9	-66.1	162.3	0	0	0	110.9	V131 I132 Q137 Y138 I139	V131-I135 HydrophobicContact CG1-CD1 3.8Å; V131-I135 WeakPolarHBondContact O-CD1 3.35Å; V131-I135 VanDerWaalsContact O-CG1 3.23Å; V131-I135 WeakPolarHBondContact O-CG1 3.26Å; V131-I135 PolarHBondContact O-N 2.9Å; I132-I135 PolarHBondContact O-N 2.97Å; I135-Q137 VanDerWaalsContact C-N 3.33Å; I135-Q137 PolarHBondContact O-N 3.22Å; I135-Y138 WeakPolarHBondContact O-CB 3.25Å; I135-Y138 PolarHBondContact O-N 3Å; I135-I139 HydrophobicContact CG2-CD1 3.83Å; I135-I139 WeakPolarHBondContact O-CG1 3.27Å; I135-I139 PolarHBondContact O-N 3.19Å
136	L	83.2	Confident	79.8	Confident	111 Å²	111	93.2 Å²	93.2	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-63.2	-39.8	178.1	-71.3	173.3	0	0	0	111.8	I132 I139 A140	I132-L136 HydrophobicContact CG2-CD1 3.87Å; I132-L136 HydrophobicContact CG2-CG 4.3Å; I132-L136 WeakPolarHBondContact O-CB 3.44Å; I132-L136 WeakPolarHBondContact O-CG 3.38Å; I132-L136 PolarHBondContact O-N 3Å; L136-I139 PolarHBondContact O-N 2.69Å; L136-A140 VanDerWaalsContact O-CB 3.27Å; L136-A140 WeakPolarHBondContact O-CB 3.32Å; L136-A140 PolarHBondContact O-N 3.19Å
137	Q	76.4	Confident	79.9	Confident	56 Å²	56	96.6 Å²	96.6	26%	0.262	54%	0.541	S	S	.	.	H	α-helix	trans	-65.9	-37.7	175.2	-178.1	62.9	74.7	0	0	112	N2 G133 F134 I135 A140 S141	N2-Q137 WeakPolarHBondContact ND2-CG 3.39Å; G133-Q137 VanDerWaalsContact O-CB 3.26Å; G133-Q137 WeakPolarHBondContact O-CB 3.47Å; G133-Q137 PolarHBondContact O-N 3.44Å; F134-Q137 PolarHBondContact O-N 3.5Å; I135-Q137 VanDerWaalsContact C-N 3.33Å; I135-Q137 PolarHBondContact O-N 3.22Å; Q137-A140 PolarHBondContact O-N 3.4Å; Q137-S141 PolarHBondContact NE2-OG 3.45Å; Q137-S141 PolarHBondContact O-N 3.41Å; Q137-S141 PolarHBondContact O-OG 2.99Å
138	Y	82.4	Confident	79.8	Confident	178 Å²	178	97.8 Å²	97.8	70%	0.698	55%	0.545	S	S	*	.	H	α-helix	trans	-65	-40.1	176	179	-97.6	0	0	0	112	F134 I135	F134-Y138 WeakPolarHBondContact O-CB 3.23Å; F134-Y138 PolarHBondContact O-N 3.28Å; I135-Y138 WeakPolarHBondContact O-CB 3.25Å; I135-Y138 PolarHBondContact O-N 3Å
139	I	81.6	Confident	79.6	Confident	123 Å²	123	98.6 Å²	98.6	63%	0.631	55%	0.552	S	S	*	*	H	α-helix	trans	-72.2	-31.4	176.9	-63	163.6	0	0	0	111.7	I135 L136	I135-I139 HydrophobicContact CG2-CD1 3.83Å; I135-I139 WeakPolarHBondContact O-CG1 3.27Å; I135-I139 PolarHBondContact O-N 3.19Å; L136-I139 PolarHBondContact O-N 2.69Å
140	A	74.3	Confident	79.3	Confident	83 Å²	83	103.3 Å²	103.3	69%	0.686	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	-3.2	-179.6	0	0	0	0	0	114.6	L136 Q137	L136-A140 VanDerWaalsContact O-CB 3.27Å; L136-A140 WeakPolarHBondContact O-CB 3.32Å; L136-A140 PolarHBondContact O-N 3.19Å; Q137-A140 PolarHBondContact O-N 3.4Å
141	S	64.7	Low	79.6	Confident	135 Å²	135	102.4 Å²	102.4	94%	0.944	56%	0.564	S	S	*	*			trans	-102.7	0	177.7	-52.7	0	0	0	0	110.7	Q137	Q137-S141 PolarHBondContact NE2-OG 3.45Å; Q137-S141 PolarHBondContact O-N 3.41Å; Q137-S141 PolarHBondContact O-OG 2.99Å

Retrieved 141 of 141 residues in 206.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).