A0A1S3SLV3_SALSA Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A1S3SLV3, Species SALSA (Salmo salar, Atlantic salmon), Gene timm10, Length 87 aa.

						>A0A1S3SLV3_SALSA|A0A1S3SLV3|timm10
MDPEKAQQLAAELEVEMMADMYNRMTNACHRKCVPPHYKEAELSKGEAVCLDRCVAKYLDLHERLGRKLTELSVQDEEMMRKNAIGQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.4	Low	87.7	Confident	225 Å²	225	103.7 Å²	103.7	100%	1.108	56%	0.56	S	S	*	*				0	139.3	0	-75.7	175.1	170.1	0	0	107.3
2	D	85.9	Confident	88.2	Confident	78 Å²	78	105.8 Å²	105.8	42%	0.417	56%	0.563	S	S	.	*			trans	-64.9	125.4	173.5	-175.1	-13.8	0	0	0	108.8	E4 K5 A6	D2-E4 PolarHBondContact O-N 3.25Å; D2-E4 PolarHBondContact OD1-N 3.28Å; D2-K5 HydrophobicContact CB-CB 4.35Å; D2-K5 HydrophobicContact CB-CD 4.18Å; D2-K5 HydrophobicContact CB-CG 4.15Å; D2-K5 PolarHBondContact O-N 2.91Å; D2-K5 VanDerWaalsContact O-N 3.09Å; D2-A6 PolarHBondContact O-N 3.44Å
3	P	84.8	Confident	88.7	Confident	98 Å²	98	104.1 Å²	104.1	64%	0.636	55%	0.553	S	S	*	*	H	α-helix	trans	-55.6	-30.6	-178.4	19.5	-32.1	0	0	0	113.6	A6 Q7	P3-A6 PolarHBondContact O-N 2.95Å; P3-Q7 PolarHBondContact O-N 3.31Å; P3-Q7 VanDerWaalsContact O-N 3.15Å
4	E	88.6	Confident	89.1	Confident	119 Å²	119	105.4 Å²	105.4	56%	0.556	56%	0.555	S	S	*	*	H	α-helix	trans	-66.8	-41.1	177.5	-167.5	-179.6	155.3	0	0	111.7	D2 A6 Q7 Q8	D2-E4 PolarHBondContact O-N 3.25Å; D2-E4 PolarHBondContact OD1-N 3.28Å; E4-A6 VanDerWaalsContact C-N 3.32Å; E4-A6 PolarHBondContact O-N 2.93Å; E4-Q7 PolarHBondContact O-N 3.46Å; E4-Q8 WeakPolarHBondContact O-CG 3.27Å; E4-Q8 PolarHBondContact O-N 3.23Å
5	K	90.1	Very high	89.5	Confident	138 Å²	138	105.2 Å²	105.2	60%	0.6	56%	0.559	S	S	*	*	H	α-helix	trans	-68	-32.9	176.4	-67.6	-177.4	-179.1	178.8	0	112.4	D2 L9	D2-K5 HydrophobicContact CB-CB 4.35Å; D2-K5 HydrophobicContact CB-CD 4.18Å; D2-K5 HydrophobicContact CB-CG 4.15Å; D2-K5 PolarHBondContact O-N 2.91Å; D2-K5 VanDerWaalsContact O-N 3.09Å; K5-L9 WeakPolarHBondContact O-CB 3.27Å; K5-L9 PolarHBondContact O-N 3.45Å
6	A	90.1	Very high	89.9	Confident	49 Å²	49	107.1 Å²	107.1	41%	0.405	56%	0.564	S	S	.	*	H	α-helix	trans	-67.3	-39.6	176.2	0	0	0	0	0	111.6	D2 P3 E4 A10	D2-A6 PolarHBondContact O-N 3.44Å; P3-A6 PolarHBondContact O-N 2.95Å; E4-A6 VanDerWaalsContact C-N 3.32Å; E4-A6 PolarHBondContact O-N 2.93Å; A6-A10 PolarHBondContact O-N 3.44Å
7	Q	90.6	Very high	90.2	Very high	146 Å²	146	108.1 Å²	108.1	68%	0.682	57%	0.567	S	S	*	*	H	α-helix	trans	-67.5	-42.5	175	-72.1	177.8	-19.5	0	0	112.2	P3 E4 L9 A10 A11	P3-Q7 PolarHBondContact O-N 3.31Å; P3-Q7 VanDerWaalsContact O-N 3.15Å; E4-Q7 PolarHBondContact O-N 3.46Å; Q7-L9 PolarHBondContact O-N 3.32Å; Q7-A10 PolarHBondContact O-N 3.45Å; Q7-A11 PolarHBondContact O-N 3.32Å
8	Q	92.3	Very high	90.5	Very high	98 Å²	98	109.4 Å²	109.4	46%	0.458	57%	0.571	S	S	.	*	H	α-helix	trans	-59.2	-47.2	175.2	-73.7	170.8	2.4	0	0	111.3	E4 A10 A11 E12	E4-Q8 WeakPolarHBondContact O-CG 3.27Å; E4-Q8 PolarHBondContact O-N 3.23Å; Q8-A10 VanDerWaalsContact C-N 3.34Å; Q8-A10 PolarHBondContact O-N 3.45Å; Q8-A11 PolarHBondContact O-N 3.19Å; Q8-E12 WeakPolarHBondContact O-CG 3.41Å; Q8-E12 PolarHBondContact O-N 3.49Å
9	L	92.8	Very high	90.8	Very high	92 Å²	92	106.2 Å²	106.2	48%	0.482	56%	0.562	S	S	.	*	H	α-helix	trans	-61.5	-41	177.4	-179.5	62.3	0	0	0	112.2	K5 Q7 A11 E12 L13	K5-L9 WeakPolarHBondContact O-CB 3.27Å; K5-L9 PolarHBondContact O-N 3.45Å; Q7-L9 PolarHBondContact O-N 3.32Å; L9-A11 VanDerWaalsContact C-N 3.35Å; L9-A11 PolarHBondContact O-N 3.11Å; L9-E12 PolarHBondContact O-N 3.41Å; L9-L13 HydrophobicContact CD1-CD1 4.38Å; L9-L13 HydrophobicContact CD1-CG 4.39Å; L9-L13 HydrophobicContact CG-CD1 4.14Å; L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 VanDerWaalsContact O-CG 3.28Å; L9-L13 WeakPolarHBondContact O-CG 3.43Å; L9-L13 PolarHBondContact O-N 2.99Å
10	A	92.7	Very high	91.1	Very high	48 Å²	48	104.6 Å²	104.6	40%	0.397	55%	0.553	S	S	.	*	H	α-helix	trans	-61.1	-43.8	176.5	0	0	0	0	0	111.8	A6 Q7 Q8 L13 E14	A6-A10 PolarHBondContact O-N 3.44Å; Q7-A10 PolarHBondContact O-N 3.45Å; Q8-A10 VanDerWaalsContact C-N 3.34Å; Q8-A10 PolarHBondContact O-N 3.45Å; A10-L13 PolarHBondContact O-N 3.2Å; A10-E14 WeakPolarHBondContact O-CG 3.34Å; A10-E14 PolarHBondContact O-N 3.48Å
11	A	93.3	Very high	91.4	Very high	50 Å²	50	101.4 Å²	101.4	41%	0.413	54%	0.536	S	S	.	.	H	α-helix	trans	-65.2	-40.3	177.4	0	0	0	0	0	112.6	Q7 Q8 L9 L13 E14 V15	Q7-A11 PolarHBondContact O-N 3.32Å; Q8-A11 PolarHBondContact O-N 3.19Å; L9-A11 VanDerWaalsContact C-N 3.35Å; L9-A11 PolarHBondContact O-N 3.11Å; A11-L13 VanDerWaalsContact C-N 3.34Å; A11-E14 PolarHBondContact O-N 3.44Å; A11-V15 WeakPolarHBondContact O-CG2 3.3Å; A11-V15 PolarHBondContact O-N 2.91Å; A11-V15 VanDerWaalsContact O-N 3.14Å
12	E	94	Very high	93.1	Very high	128 Å²	128	97.4 Å²	97.4	60%	0.598	51%	0.51	S	S	*	.	H	α-helix	trans	-61.4	-44	175.3	-73.9	174.6	-177	0	0	111.6	Q8 L9 V15 E16	Q8-E12 WeakPolarHBondContact O-CG 3.41Å; Q8-E12 PolarHBondContact O-N 3.49Å; L9-E12 PolarHBondContact O-N 3.41Å; E12-V15 PolarHBondContact O-N 3.35Å; E12-E16 PolarHBondContact O-N 3.04Å
13	L	95.2	Very high	93.6	Very high	84 Å²	84	97.8 Å²	97.8	44%	0.44	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-41.3	176.7	-72	170	0	0	0	111.9	L9 A10 A11 V15 E16 M17	L9-L13 HydrophobicContact CD1-CD1 4.38Å; L9-L13 HydrophobicContact CD1-CG 4.39Å; L9-L13 HydrophobicContact CG-CD1 4.14Å; L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 VanDerWaalsContact O-CG 3.28Å; L9-L13 WeakPolarHBondContact O-CG 3.43Å; L9-L13 PolarHBondContact O-N 2.99Å; A10-L13 PolarHBondContact O-N 3.2Å; A11-L13 VanDerWaalsContact C-N 3.34Å; L13-V15 VanDerWaalsContact C-N 3.32Å; L13-V15 PolarHBondContact O-N 2.95Å; L13-E16 PolarHBondContact O-N 3.5Å; L13-M17 WeakPolarHBondContact O-CB 3.38Å; L13-M17 VanDerWaalsContact O-CG 3.26Å; L13-M17 WeakPolarHBondContact O-CG 3.35Å; L13-M17 PolarHBondContact O-N 3.15Å
14	E	93.8	Very high	94.3	Very high	123 Å²	123	100.2 Å²	100.2	58%	0.575	51%	0.508	S	S	*	.	H	α-helix	trans	-57.5	-45.2	175	-76.4	178.3	-178.2	0	0	111.8	A10 A11 M17 M18	A10-E14 WeakPolarHBondContact O-CG 3.34Å; A10-E14 PolarHBondContact O-N 3.48Å; A11-E14 PolarHBondContact O-N 3.44Å; E14-M17 PolarHBondContact O-N 3.34Å; E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.5Å; E14-M18 PolarHBondContact O-N 3.09Å
15	V	95.4	Very high	94.8	Very high	102 Å²	102	95.4 Å²	95.4	62%	0.618	49%	0.486	S	S	*	.	H	α-helix	trans	-63.9	-45	177.8	173.5	0	0	0	0	111.4	A11 E12 L13 M17 M18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.3Å; A11-V15 PolarHBondContact O-N 2.91Å; A11-V15 VanDerWaalsContact O-N 3.14Å; E12-V15 PolarHBondContact O-N 3.35Å; L13-V15 VanDerWaalsContact C-N 3.32Å; L13-V15 PolarHBondContact O-N 2.95Å; V15-M17 PolarHBondContact O-N 3.36Å; V15-M18 PolarHBondContact O-N 3.18Å; V15-A19 WeakPolarHBondContact O-CB 3.45Å; V15-A19 PolarHBondContact O-N 3.02Å
16	E	95.8	Very high	95.1	Very high	135 Å²	135	91.8 Å²	91.8	63%	0.631	48%	0.475	S	S	*	.	H	α-helix	trans	-61.6	-44.7	179.3	-173.3	178.6	-179	0	0	111.7	E12 L13 M18 A19 D20	E12-E16 PolarHBondContact O-N 3.04Å; L13-E16 PolarHBondContact O-N 3.5Å; E16-M18 PolarHBondContact O-N 2.84Å; E16-A19 WeakPolarHBondContact O-CB 3.37Å; E16-A19 PolarHBondContact O-N 3.43Å; E16-D20 PolarHBondContact O-N 2.86Å
17	M	94.5	Very high	95.5	Very high	125 Å²	125	94.3 Å²	94.3	62%	0.616	48%	0.482	S	S	*	.	H	α-helix	trans	-62.9	-42.9	177	-69.5	-169.8	-45.3	0	0	112	L13 E14 V15 A19 D20 M21	L13-M17 WeakPolarHBondContact O-CB 3.38Å; L13-M17 VanDerWaalsContact O-CG 3.26Å; L13-M17 WeakPolarHBondContact O-CG 3.35Å; L13-M17 PolarHBondContact O-N 3.15Å; E14-M17 PolarHBondContact O-N 3.34Å; V15-M17 PolarHBondContact O-N 3.36Å; M17-A19 VanDerWaalsContact C-N 3.29Å; M17-A19 PolarHBondContact O-N 3.46Å; M17-D20 PolarHBondContact O-N 3.19Å; M17-M21 PolarHBondContact O-N 3.21Å
18	M	95.3	Very high	95.9	Very high	132 Å²	132	88.6 Å²	88.6	65%	0.65	46%	0.46	S	S	*	.	H	α-helix	trans	-63.4	-36.6	176.7	-73.3	-173.1	74.4	0	0	111.8	E14 V15 E16 M21 Y22	E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.5Å; E14-M18 PolarHBondContact O-N 3.09Å; V15-M18 PolarHBondContact O-N 3.18Å; E16-M18 PolarHBondContact O-N 2.84Å; M18-M21 PolarHBondContact O-N 3.34Å; M18-Y22 WeakPolarHBondContact O-CB 3.25Å; M18-Y22 PolarHBondContact O-N 3.45Å
19	A	96.9	Very high	96.2	Very high	48 Å²	48	84.1 Å²	84.1	40%	0.397	44%	0.439	S	S	.	.	H	α-helix	trans	-66	-44.2	175.9	0	0	0	0	0	112.1	V15 E16 M17 Y22 N23	V15-A19 WeakPolarHBondContact O-CB 3.45Å; V15-A19 PolarHBondContact O-N 3.02Å; E16-A19 WeakPolarHBondContact O-CB 3.37Å; E16-A19 PolarHBondContact O-N 3.43Å; M17-A19 VanDerWaalsContact C-N 3.29Å; M17-A19 PolarHBondContact O-N 3.46Å; A19-Y22 PolarHBondContact O-N 3.39Å; A19-N23 PolarHBondContact O-N 3.2Å; A19-N23 PolarHBondContact O-ND2 2.9Å; A19-N23 VanDerWaalsContact O-ND2 3.13Å
20	D	97.3	Very high	96.5	Very high	73 Å²	73	83.8 Å²	83.8	39%	0.39	44%	0.435	S	S	.	.	H	α-helix	trans	-61.6	-44.8	174.8	-176.6	47.5	0	0	0	111.3	E16 M17 Y22 N23 R24	E16-D20 PolarHBondContact O-N 2.86Å; M17-D20 PolarHBondContact O-N 3.19Å; D20-Y22 VanDerWaalsContact C-N 3.34Å; D20-Y22 PolarHBondContact O-N 3.1Å; D20-N23 PolarHBondContact O-N 2.81Å; D20-R24 VanDerWaalsContact CG-NE 3.27Å; D20-R24 WeakPolarHBondContact O-CG 3.3Å; D20-R24 PolarHBondContact O-N 3.03Å; D20-R24 IonicContact OD1-CZ 3.74Å; D20-R24 IonicContact OD1-NE 3.3Å; D20-R24 PolarHBondContact OD1-NE 3.46Å; D20-R24 IonicContact OD1-NH2 2.64Å; D20-R24 IonicContact OD2-CZ 3.89Å; D20-R24 VanDerWaalsContact OD2-CZ 3.26Å; D20-R24 IonicContact OD2-NE 3.83Å; D20-R24 PolarHBondContact OD2-NE 3.08Å; D20-R24 IonicContact OD2-NH2 3.21Å; D20-R24 PolarHBondContact OD2-NH2 3.3Å
21	M	97.1	Very high	96.8	Very high	38 Å²	38	91.7 Å²	91.7	19%	0.187	46%	0.455	C	S	.	.	H	α-helix	trans	-57.5	-46.8	175.6	-172	-143.9	74	0	0	111.4	M17 M18 N23 R24 M25 Y58 L59	M17-M21 PolarHBondContact O-N 3.21Å; M18-M21 PolarHBondContact O-N 3.34Å; M21-N23 PolarHBondContact O-N 3.31Å; M21-R24 PolarHBondContact O-N 3Å; M21-M25 VanDerWaalsContact O-CB 3.28Å; M21-M25 WeakPolarHBondContact O-CB 3.38Å; M21-M25 PolarHBondContact O-N 2.9Å; M21-Y58 HydrophobicContact CG-CE1 4.18Å; M21-L59 HydrophobicContact CE-CD2 3.94Å; M21-L59 HydrophobicContact SD-CD2 4.07Å
22	Y	98	Very high	97	Very high	142 Å²	142	97 Å²	97	56%	0.557	47%	0.469	S	S	*	.	H	α-helix	trans	-59.9	-44.7	178.5	178.6	-95.5	0	0	0	112.1	M18 A19 D20 M25 T26	M18-Y22 WeakPolarHBondContact O-CB 3.25Å; M18-Y22 PolarHBondContact O-N 3.45Å; A19-Y22 PolarHBondContact O-N 3.39Å; D20-Y22 VanDerWaalsContact C-N 3.34Å; D20-Y22 PolarHBondContact O-N 3.1Å; Y22-M25 HydrophobicContact CD2-CE 4.16Å; Y22-M25 PolarHBondContact O-N 3.23Å; Y22-T26 VanDerWaalsContact O-CB 3.3Å; Y22-T26 WeakPolarHBondContact O-CB 3.16Å; Y22-T26 PolarHBondContact O-N 2.87Å; Y22-T26 PolarHBondContact O-OG1 3.41Å
23	N	98.2	Very high	97.2	Very high	86 Å²	86	91.5 Å²	91.5	46%	0.46	44%	0.444	S	S	.	.	H	α-helix	trans	-64	-43.8	178.5	-72.6	-34.9	0	0	0	111.9	A19 D20 M21 N27	A19-N23 PolarHBondContact O-N 3.2Å; A19-N23 PolarHBondContact O-ND2 2.9Å; A19-N23 VanDerWaalsContact O-ND2 3.13Å; D20-N23 PolarHBondContact O-N 2.81Å; M21-N23 PolarHBondContact O-N 3.31Å; N23-N27 WeakPolarHBondContact O-CB 3.44Å; N23-N27 PolarHBondContact O-N 3.02Å; N23-N27 PolarHBondContact O-ND2 3.42Å
24	R	98.2	Very high	97.3	Very high	149 Å²	149	88.2 Å²	88.2	56%	0.562	43%	0.427	S	S	*	.	H	α-helix	trans	-65.7	-43.4	177.2	-69.9	176.2	-172.4	-125.6	9.1	112.1	D20 M21 A28 Y58	D20-R24 VanDerWaalsContact CG-NE 3.27Å; D20-R24 WeakPolarHBondContact O-CG 3.3Å; D20-R24 PolarHBondContact O-N 3.03Å; D20-R24 IonicContact OD1-CZ 3.74Å; D20-R24 IonicContact OD1-NE 3.3Å; D20-R24 PolarHBondContact OD1-NE 3.46Å; D20-R24 IonicContact OD1-NH2 2.64Å; D20-R24 IonicContact OD2-CZ 3.89Å; D20-R24 VanDerWaalsContact OD2-CZ 3.26Å; D20-R24 IonicContact OD2-NE 3.83Å; D20-R24 PolarHBondContact OD2-NE 3.08Å; D20-R24 IonicContact OD2-NH2 3.21Å; D20-R24 PolarHBondContact OD2-NH2 3.3Å; M21-R24 PolarHBondContact O-N 3Å; R24-A28 VanDerWaalsContact O-CB 3.27Å; R24-A28 WeakPolarHBondContact O-CB 3.45Å; R24-A28 PolarHBondContact O-N 2.92Å; R24-Y58 WeakPolarHBondContact CB-OH 3.1Å
25	M	98.6	Very high	97.4	Very high	18 Å²	18	85.5 Å²	85.5	9%	0.089	42%	0.42	C	S	.	.	H	α-helix	trans	-61.1	-49.3	177	-178.9	178.2	67.3	0	0	111	M21 Y22 N27 A28 C29 V55 Y58 L59	M21-M25 VanDerWaalsContact O-CB 3.28Å; M21-M25 WeakPolarHBondContact O-CB 3.38Å; M21-M25 PolarHBondContact O-N 2.9Å; Y22-M25 HydrophobicContact CD2-CE 4.16Å; Y22-M25 PolarHBondContact O-N 3.23Å; M25-N27 PolarHBondContact O-N 3.39Å; M25-A28 PolarHBondContact O-N 2.86Å; M25-C29 WeakPolarHBondContact O-CB 3.42Å; M25-C29 PolarHBondContact O-N 3.33Å; M25-V55 HydrophobicContact CE-CG1 4.17Å; M25-V55 HydrophobicContact SD-CB 4.31Å; M25-V55 HydrophobicContact SD-CG1 3.73Å; M25-V55 HydrophobicContact SD-CG2 4.28Å; M25-Y58 HydrophobicContact CB-CD1 3.72Å; M25-Y58 HydrophobicContact CB-CD2 4.31Å; M25-Y58 HydrophobicContact CB-CE1 3.63Å; M25-Y58 HydrophobicContact CB-CE2 4.23Å; M25-Y58 HydrophobicContact CB-CG 4.08Å; M25-Y58 HydrophobicContact CG-CD1 3.61Å; M25-Y58 HydrophobicContact CG-CD2 4.18Å; M25-Y58 HydrophobicContact CG-CE1 4.08Å; M25-Y58 HydrophobicContact CG-CG 3.67Å; M25-Y58 HydrophobicContact SD-CD1 3.91Å; M25-Y58 HydrophobicContact SD-CG 4.31Å; M25-L59 HydrophobicContact SD-CD2 4.2Å; M25-L59 HydrophobicContact SD-CG 4.26Å
26	T	98.4	Very high	97.3	Very high	61 Å²	61	86.6 Å²	86.6	37%	0.374	43%	0.43	S	S	.	.	H	α-helix	trans	-58.3	-49.1	179.9	-61.2	0	0	0	0	110.7	Y22 A28 C29 H30	Y22-T26 VanDerWaalsContact O-CB 3.3Å; Y22-T26 WeakPolarHBondContact O-CB 3.16Å; Y22-T26 PolarHBondContact O-N 2.87Å; Y22-T26 PolarHBondContact O-OG1 3.41Å; T26-A28 PolarHBondContact O-N 2.64Å; T26-C29 PolarHBondContact O-N 3.13Å; T26-H30 VanDerWaalsContact O-CB 3.24Å; T26-H30 WeakPolarHBondContact O-CB 3.38Å; T26-H30 PolarHBondContact O-N 3.3Å
27	N	98.4	Very high	97.3	Very high	102 Å²	102	86.9 Å²	86.9	55%	0.545	43%	0.431	S	S	.	.	H	α-helix	trans	-62.1	-41	177.4	-76.9	-42.2	0	0	0	112.7	N23 M25 R31	N23-N27 WeakPolarHBondContact O-CB 3.44Å; N23-N27 PolarHBondContact O-N 3.02Å; N23-N27 PolarHBondContact O-ND2 3.42Å; M25-N27 PolarHBondContact O-N 3.39Å; N27-R31 WeakPolarHBondContact O-CB 3.45Å; N27-R31 WeakPolarHBondContact O-CG 3.44Å; N27-R31 PolarHBondContact O-N 3.18Å; N27-R31 VanDerWaalsContact O-N 3.1Å
28	A	98.6	Very high	97.3	Very high	27 Å²	27	87.3 Å²	87.3	22%	0.223	43%	0.426	C	S	.	.	H	α-helix	trans	-66.1	-45.8	178.6	0	0	0	0	0	111.8	R24 M25 T26 R31 K32 Y58	R24-A28 VanDerWaalsContact O-CB 3.27Å; R24-A28 WeakPolarHBondContact O-CB 3.45Å; R24-A28 PolarHBondContact O-N 2.92Å; M25-A28 PolarHBondContact O-N 2.86Å; T26-A28 PolarHBondContact O-N 2.64Å; A28-R31 PolarHBondContact O-N 3.04Å; A28-K32 WeakPolarHBondContact O-CB 3.39Å; A28-K32 VanDerWaalsContact O-CG 3.23Å; A28-K32 WeakPolarHBondContact O-CG 3.49Å; A28-K32 PolarHBondContact O-N 3.11Å; A28-Y58 HydrophobicContact CB-CD2 4.36Å; A28-Y58 HydrophobicContact CB-CE2 4.16Å
29	C	98.7	Very high	97.2	Very high	3 Å²	3	90.2 Å²	90.2	2%	0.02	44%	0.435	C	S	.	.	H	α-helix	trans	-72	-38	-179.1	-70.3	0	0	0	0	112.6	M25 T26 R31 K32 C33 L51 C54	M25-C29 WeakPolarHBondContact O-CB 3.42Å; M25-C29 PolarHBondContact O-N 3.33Å; T26-C29 PolarHBondContact O-N 3.13Å; C29-R31 PolarHBondContact O-N 3.46Å; C29-K32 PolarHBondContact O-N 3.35Å; C29-C33 VanDerWaalsContact O-CB 3.3Å; C29-C33 WeakPolarHBondContact O-CB 3.43Å; C29-C33 PolarHBondContact O-N 3.36Å; C29-L51 HydrophobicContact CB-CD2 4.09Å; C29-C54 WeakPolarHBondContact CA-SG 3.4Å; C29-C54 HydrophobicContact CB-CB 3.81Å; C29-C54 WeakPolarHBondContact CB-SG 3.49Å; C29-C54 WeakPolarHBondContact SG-CB 3.43Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 3.42Å
30	H	98.1	Very high	97	Very high	86 Å²	86	94 Å²	94	40%	0.398	45%	0.445	S	S	.	.	H	α-helix	trans	-56.4	-52.2	170.8	-176.4	-83.7	0	0	0	111	T26 K32 C33 V34 Y38	T26-H30 VanDerWaalsContact O-CB 3.24Å; T26-H30 WeakPolarHBondContact O-CB 3.38Å; T26-H30 PolarHBondContact O-N 3.3Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 2.99Å; H30-C33 PolarHBondContact O-N 3.41Å; H30-V34 WeakPolarHBondContact O-CB 3.23Å; H30-V34 PolarHBondContact O-N 3.29Å; H30-Y38 PolarHBondContact CE1-OH 2.97Å; H30-Y38 PolarHBondContact NE2-OH 2.97Å
31	R	98.2	Very high	96.9	Very high	213 Å²	213	95.8 Å²	95.8	80%	0.804	47%	0.47	S	S	*	.	H	α-helix	trans	-61.6	-31.3	178.7	-74.4	-178.8	-178.7	-157.9	1.6	114.1	N27 A28 C29	N27-R31 WeakPolarHBondContact O-CB 3.45Å; N27-R31 WeakPolarHBondContact O-CG 3.44Å; N27-R31 PolarHBondContact O-N 3.18Å; N27-R31 VanDerWaalsContact O-N 3.1Å; A28-R31 PolarHBondContact O-N 3.04Å; C29-R31 PolarHBondContact O-N 3.46Å
32	K	98.3	Very high	96.9	Very high	162 Å²	162	101.6 Å²	101.6	70%	0.704	50%	0.497	S	S	*	.	H	α-helix	trans	-83	-33.5	-178.1	-75.7	173.5	-175	-68	0	113.1	A28 C29 H30	A28-K32 WeakPolarHBondContact O-CB 3.39Å; A28-K32 VanDerWaalsContact O-CG 3.23Å; A28-K32 WeakPolarHBondContact O-CG 3.49Å; A28-K32 PolarHBondContact O-N 3.11Å; C29-K32 PolarHBondContact O-N 3.35Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 2.99Å
33	C	98.4	Very high	96.9	Very high	12 Å²	12	99.6 Å²	99.6	8%	0.081	50%	0.495	C	S	.	.	H	α-helix	trans	-112.8	-24.2	-167.2	-68.7	0	0	0	0	114.2	C29 H30 E47 C50 L51	C29-C33 VanDerWaalsContact O-CB 3.3Å; C29-C33 WeakPolarHBondContact O-CB 3.43Å; C29-C33 PolarHBondContact O-N 3.36Å; H30-C33 PolarHBondContact O-N 3.41Å; C33-E47 WeakPolarHBondContact O-CG 3.46Å; C33-C50 WeakPolarHBondContact CA-SG 3.26Å; C33-C50 HydrophobicContact CB-CB 3.6Å; C33-C50 WeakPolarHBondContact CB-SG 3.23Å; C33-C50 WeakPolarHBondContact SG-CB 3.28Å; C33-C50 PolarHBondContact SG-O 3.38Å; C33-C50 CovalentContact SG-SG 2.05Å; C33-C50 PolarHBondContact SG-SG 2.89Å; C33-L51 HydrophobicContact CB-CD2 3.88Å; C33-L51 HydrophobicContact CB-CG 4.01Å
34	V	97.4	Very high	96.8	Very high	15 Å²	15	97.4 Å²	97.4	9%	0.091	49%	0.487	C	S	.	.	S	Bend	trans	-109.4	109.8	-177.5	-174.5	0	0	0	0	109	H30 Y38 L43	H30-V34 WeakPolarHBondContact O-CB 3.23Å; H30-V34 PolarHBondContact O-N 3.29Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.43Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.43Å; V34-L43 HydrophobicContact CG2-CD2 4.38Å
35	P	95.4	Very high	96.8	Very high	66 Å²	66	99 Å²	99	43%	0.429	50%	0.498	S	S	.	.			trans	-62.6	150.8	179	-20.4	33.1	0	0	0	111.7	H37 E47	P35-H37 PolarHBondContact O-N 3.04Å; P35-E47 VanDerWaalsContact CD-OE1 3.24Å; P35-E47 WeakPolarHBondContact CD-OE1 3.31Å
36	P	94.6	Very high	96.7	Very high	125 Å²	125	100.6 Å²	100.6	81%	0.812	52%	0.518	S	S	*	.	S	Bend	trans	-66.4	-19.2	178	27.8	-35.1	0	0	0	113.1
37	H	95	Very high	96.7	Very high	141 Å²	141	99.1 Å²	99.1	65%	0.653	51%	0.508	S	S	*	.	S	Bend	trans	-96.7	101.2	174.6	-175.9	-59.1	0	0	0	110.3	P35 K39	P35-H37 PolarHBondContact O-N 3.04Å; H37-K39 PolarHBondContact O-N 3.38Å
38	Y	94.2	Very high	96.7	Very high	135 Å²	135	96 Å²	96	53%	0.529	50%	0.496	S	S	.	.			trans	-76.8	114.6	175	-56.8	-83.9	0	0	0	110.3	H30 V34	H30-Y38 PolarHBondContact CE1-OH 2.97Å; H30-Y38 PolarHBondContact NE2-OH 2.97Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.43Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.43Å
39	K	92.5	Very high	96.7	Very high	193 Å²	193	97.4 Å²	97.4	84%	0.839	50%	0.501	S	S	*	.	S	Bend	trans	-80.8	-31.9	173.9	-67.6	-175.8	179.6	179.4	0	111.9	H37	H37-K39 PolarHBondContact O-N 3.38Å
40	E	94.4	Very high	96.7	Very high	126 Å²	126	99.4 Å²	99.4	59%	0.589	52%	0.515	S	S	*	.	S	Bend	trans	-148.3	166.1	179.3	62.2	-161	163.3	0	0	109.4
41	A	94.5	Very high	96.7	Very high	112 Å²	112	97.2 Å²	97.2	93%	0.926	51%	0.506	S	S	*	.	S	Bend	trans	-82.6	-21.4	-176.6	0	0	0	0	0	113.2
42	E	96.9	Very high	96.7	Very high	160 Å²	160	92.7 Å²	92.7	75%	0.748	50%	0.498	S	S	*	.	S	Bend	trans	-87.4	150.5	179.3	-65.7	-178.1	-173.6	0	0	110.7	S44	E42-S44 PolarHBondContact O-N 3.49Å
43	L	97	Very high	96.8	Very high	99 Å²	99	92.8 Å²	92.8	52%	0.518	49%	0.494	S	S	.	.	P	Polyproline II helix	trans	-68.4	123.1	171.4	-65.9	174.3	0	0	0	109.1	V34 E47 L51	V34-L43 HydrophobicContact CG2-CD2 4.38Å; L43-E47 HydrophobicContact CB-CB 4.39Å; L43-E47 HydrophobicContact CD2-CB 4.04Å; L43-L51 HydrophobicContact CD1-CD1 3.75Å; L43-L51 HydrophobicContact CD2-CD1 4.17Å
44	S	96.9	Very high	96.8	Very high	41 Å²	41	93 Å²	93	29%	0.287	50%	0.495	S	S	.	.	P	Polyproline II helix	trans	-60.8	156	166.7	68.4	0	0	0	0	110.1	E42 G46 E47 A48	E42-S44 PolarHBondContact O-N 3.49Å; S44-G46 PolarHBondContact O-N 3.23Å; S44-G46 VanDerWaalsContact O-N 3.07Å; S44-E47 VanDerWaalsContact CB-OE2 3.28Å; S44-E47 WeakPolarHBondContact CB-OE2 3.26Å; S44-E47 PolarHBondContact N-OE2 3.42Å; S44-E47 PolarHBondContact O-N 3.3Å; S44-E47 VanDerWaalsContact OG-CD 3.3Å; S44-E47 VanDerWaalsContact OG-CG 3.3Å; S44-E47 WeakPolarHBondContact OG-CG 3.33Å; S44-E47 PolarHBondContact OG-N 3.13Å; S44-E47 PolarHBondContact OG-OE2 3.41Å; S44-A48 PolarHBondContact O-N 2.96Å
45	K	97.3	Very high	96.8	Very high	182 Å²	182	94.8 Å²	94.8	79%	0.791	51%	0.506	S	S	*	.	H	α-helix	trans	-52.7	-33.7	174	-174.4	178.8	-179	179.5	0	112.4	V49	K45-V49 WeakPolarHBondContact O-CB 3.49Å; K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.48Å; K45-V49 PolarHBondContact O-N 2.93Å; K45-V49 VanDerWaalsContact O-N 3.15Å
46	G	97.2	Very high	97	Very high	51 Å²	51	94.5 Å²	94.5	53%	0.526	51%	0.509	S	S	.	.	H	α-helix	trans	-68.2	-44.5	177.4	0	0	0	0	0	112.7	S44 C50	S44-G46 PolarHBondContact O-N 3.23Å; S44-G46 VanDerWaalsContact O-N 3.07Å; G46-C50 VanDerWaalsContact O-CB 3.28Å; G46-C50 WeakPolarHBondContact O-CB 3.46Å; G46-C50 PolarHBondContact O-N 3Å
47	E	98.3	Very high	97.2	Very high	31 Å²	31	95.6 Å²	95.6	15%	0.145	50%	0.501	C	S	.	.	H	α-helix	trans	-65.3	-45.3	177.7	-70.3	161.1	138.8	0	0	111.1	C33 P35 L43 S44 C50 L51	C33-E47 WeakPolarHBondContact O-CG 3.46Å; P35-E47 VanDerWaalsContact CD-OE1 3.24Å; P35-E47 WeakPolarHBondContact CD-OE1 3.31Å; L43-E47 HydrophobicContact CB-CB 4.39Å; L43-E47 HydrophobicContact CD2-CB 4.04Å; S44-E47 VanDerWaalsContact CB-OE2 3.28Å; S44-E47 WeakPolarHBondContact CB-OE2 3.26Å; S44-E47 PolarHBondContact N-OE2 3.42Å; S44-E47 PolarHBondContact O-N 3.3Å; S44-E47 VanDerWaalsContact OG-CD 3.3Å; S44-E47 VanDerWaalsContact OG-CG 3.3Å; S44-E47 WeakPolarHBondContact OG-CG 3.33Å; S44-E47 PolarHBondContact OG-N 3.13Å; S44-E47 PolarHBondContact OG-OE2 3.41Å; E47-C50 WeakPolarHBondContact O-CB 3.5Å; E47-C50 PolarHBondContact O-N 3.24Å; E47-L51 VanDerWaalsContact O-CG 3.31Å; E47-L51 WeakPolarHBondContact O-CG 3.4Å; E47-L51 PolarHBondContact O-N 3.44Å
48	A	98.1	Very high	97.4	Very high	36 Å²	36	91.6 Å²	91.6	30%	0.298	48%	0.481	S	S	.	.	H	α-helix	trans	-57.5	-52.1	176.9	0	0	0	0	0	112	S44 C50 L51 D52	S44-A48 PolarHBondContact O-N 2.96Å; A48-C50 VanDerWaalsContact C-N 3.28Å; A48-C50 PolarHBondContact O-N 2.83Å; A48-L51 PolarHBondContact O-N 2.89Å; A48-D52 PolarHBondContact O-N 3.01Å; A48-D52 VanDerWaalsContact O-N 3.09Å
49	V	98.7	Very high	97.6	Very high	56 Å²	56	88.8 Å²	88.8	34%	0.339	47%	0.474	S	S	.	.	H	α-helix	trans	-63.8	-34.1	177.6	171.4	0	0	0	0	112	K45 R53	K45-V49 WeakPolarHBondContact O-CB 3.49Å; K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.48Å; K45-V49 PolarHBondContact O-N 2.93Å; K45-V49 VanDerWaalsContact O-N 3.15Å; V49-R53 WeakPolarHBondContact O-CD 3.3Å; V49-R53 VanDerWaalsContact O-CG 3.26Å; V49-R53 WeakPolarHBondContact O-CG 3.35Å; V49-R53 PolarHBondContact O-N 3.32Å
50	C	98.7	Very high	97.8	Very high	45 Å²	45	82.6 Å²	82.6	30%	0.304	45%	0.451	S	S	.	.	H	α-helix	trans	-65.3	-45.8	174.6	-176.1	0	0	0	0	111.3	C33 G46 E47 A48 R53 C54	C33-C50 WeakPolarHBondContact CA-SG 3.26Å; C33-C50 HydrophobicContact CB-CB 3.6Å; C33-C50 WeakPolarHBondContact CB-SG 3.23Å; C33-C50 WeakPolarHBondContact SG-CB 3.28Å; C33-C50 PolarHBondContact SG-O 3.38Å; C33-C50 CovalentContact SG-SG 2.05Å; C33-C50 PolarHBondContact SG-SG 2.89Å; G46-C50 VanDerWaalsContact O-CB 3.28Å; G46-C50 WeakPolarHBondContact O-CB 3.46Å; G46-C50 PolarHBondContact O-N 3Å; E47-C50 WeakPolarHBondContact O-CB 3.5Å; E47-C50 PolarHBondContact O-N 3.24Å; A48-C50 VanDerWaalsContact C-N 3.28Å; A48-C50 PolarHBondContact O-N 2.83Å; C50-R53 PolarHBondContact O-N 3.02Å; C50-C54 VanDerWaalsContact O-CB 3.29Å; C50-C54 WeakPolarHBondContact O-CB 3.47Å; C50-C54 PolarHBondContact O-N 3.47Å
51	L	98.8	Very high	98	Very high	40 Å²	40	82 Å²	82	21%	0.209	45%	0.451	C	S	.	.	H	α-helix	trans	-59.6	-47.4	179.7	-73.2	168	0	0	0	111.1	C29 C33 L43 E47 A48 R53 C54 V55	C29-L51 HydrophobicContact CB-CD2 4.09Å; C33-L51 HydrophobicContact CB-CD2 3.88Å; C33-L51 HydrophobicContact CB-CG 4.01Å; L43-L51 HydrophobicContact CD1-CD1 3.75Å; L43-L51 HydrophobicContact CD2-CD1 4.17Å; E47-L51 VanDerWaalsContact O-CG 3.31Å; E47-L51 WeakPolarHBondContact O-CG 3.4Å; E47-L51 PolarHBondContact O-N 3.44Å; A48-L51 PolarHBondContact O-N 2.89Å; L51-R53 VanDerWaalsContact C-N 3.33Å; L51-R53 PolarHBondContact O-N 3.49Å; L51-C54 WeakPolarHBondContact O-CB 3.28Å; L51-C54 PolarHBondContact O-N 2.95Å; L51-C54 VanDerWaalsContact O-N 3.08Å; L51-V55 WeakPolarHBondContact O-CG2 3.47Å; L51-V55 PolarHBondContact O-N 3.28Å
52	D	98.7	Very high	98.1	Very high	118 Å²	118	81.1 Å²	81.1	63%	0.631	43%	0.427	S	S	*	.	H	α-helix	trans	-55.6	-48.7	176.2	-66.9	-26.2	0	0	0	111.6	A48 C54 A56	A48-D52 PolarHBondContact O-N 3.01Å; A48-D52 VanDerWaalsContact O-N 3.09Å; D52-C54 VanDerWaalsContact C-N 3.32Å; D52-C54 PolarHBondContact O-N 3.31Å; D52-A56 WeakPolarHBondContact O-CB 3.28Å; D52-A56 PolarHBondContact O-N 3.48Å; D52-A56 VanDerWaalsContact O-N 3.12Å
53	R	98.8	Very high	98.1	Very high	165 Å²	165	78.6 Å²	78.6	62%	0.623	42%	0.415	S	S	*	.	H	α-helix	trans	-65.2	-36	177.6	-71.3	171.6	177	178.8	0.5	112.2	V49 C50 L51 K57	V49-R53 WeakPolarHBondContact O-CD 3.3Å; V49-R53 VanDerWaalsContact O-CG 3.26Å; V49-R53 WeakPolarHBondContact O-CG 3.35Å; V49-R53 PolarHBondContact O-N 3.32Å; C50-R53 PolarHBondContact O-N 3.02Å; L51-R53 VanDerWaalsContact C-N 3.33Å; L51-R53 PolarHBondContact O-N 3.49Å; R53-K57 WeakPolarHBondContact O-CB 3.45Å; R53-K57 VanDerWaalsContact O-CG 3.23Å; R53-K57 WeakPolarHBondContact O-CG 3.29Å; R53-K57 PolarHBondContact O-N 3.02Å
54	C	98.8	Very high	98.2	Very high	15 Å²	15	80.4 Å²	80.4	10%	0.101	42%	0.415	C	S	.	.	H	α-helix	trans	-67.6	-49.2	-179	179.8	0	0	0	0	110.9	C29 C50 L51 D52 A56 K57 Y58	C29-C54 WeakPolarHBondContact CA-SG 3.4Å; C29-C54 HydrophobicContact CB-CB 3.81Å; C29-C54 WeakPolarHBondContact CB-SG 3.49Å; C29-C54 WeakPolarHBondContact SG-CB 3.43Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 3.42Å; C50-C54 VanDerWaalsContact O-CB 3.29Å; C50-C54 WeakPolarHBondContact O-CB 3.47Å; C50-C54 PolarHBondContact O-N 3.47Å; L51-C54 WeakPolarHBondContact O-CB 3.28Å; L51-C54 PolarHBondContact O-N 2.95Å; L51-C54 VanDerWaalsContact O-N 3.08Å; D52-C54 VanDerWaalsContact C-N 3.32Å; D52-C54 PolarHBondContact O-N 3.31Å; C54-A56 PolarHBondContact O-N 3Å; C54-K57 PolarHBondContact O-N 3.23Å; C54-Y58 WeakPolarHBondContact O-CB 3.43Å; C54-Y58 PolarHBondContact O-N 2.96Å
55	V	98.7	Very high	98.2	Very high	53 Å²	53	84.1 Å²	84.1	32%	0.321	43%	0.431	S	S	.	.	H	α-helix	trans	-60.4	-47.4	178.2	173.2	0	0	0	0	110	M25 L51 K57 Y58 L59	M25-V55 HydrophobicContact CE-CG1 4.17Å; M25-V55 HydrophobicContact SD-CB 4.31Å; M25-V55 HydrophobicContact SD-CG1 3.73Å; M25-V55 HydrophobicContact SD-CG2 4.28Å; L51-V55 WeakPolarHBondContact O-CG2 3.47Å; L51-V55 PolarHBondContact O-N 3.28Å; V55-K57 VanDerWaalsContact C-N 3.33Å; V55-K57 PolarHBondContact O-N 3.28Å; V55-Y58 PolarHBondContact O-N 3.37Å; V55-Y58 VanDerWaalsContact O-N 3.15Å; V55-L59 HydrophobicContact CG1-CD1 4.07Å; V55-L59 WeakPolarHBondContact O-CG 3.02Å; V55-L59 PolarHBondContact O-N 3.07Å
56	A	98.7	Very high	98.1	Very high	61 Å²	61	77 Å²	77	50%	0.504	41%	0.41	S	S	.	.	H	α-helix	trans	-56.6	-45.6	177.4	0	0	0	0	0	112.4	D52 C54 D60	D52-A56 WeakPolarHBondContact O-CB 3.28Å; D52-A56 PolarHBondContact O-N 3.48Å; D52-A56 VanDerWaalsContact O-N 3.12Å; C54-A56 PolarHBondContact O-N 3Å; A56-D60 WeakPolarHBondContact O-CB 3.02Å; A56-D60 PolarHBondContact O-N 3.14Å; A56-D60 VanDerWaalsContact O-N 3.13Å
57	K	98.8	Very high	98.1	Very high	148 Å²	148	80.2 Å²	80.2	64%	0.643	41%	0.406	S	S	*	.	H	α-helix	trans	-68.7	-36.5	177.2	-73.2	176.2	-177.6	-174.8	0	113	R53 C54 V55 L61	R53-K57 WeakPolarHBondContact O-CB 3.45Å; R53-K57 VanDerWaalsContact O-CG 3.23Å; R53-K57 WeakPolarHBondContact O-CG 3.29Å; R53-K57 PolarHBondContact O-N 3.02Å; C54-K57 PolarHBondContact O-N 3.23Å; V55-K57 VanDerWaalsContact C-N 3.33Å; V55-K57 PolarHBondContact O-N 3.28Å; K57-L61 VanDerWaalsContact O-CB 3.3Å; K57-L61 WeakPolarHBondContact O-CB 3.26Å; K57-L61 PolarHBondContact O-N 3.08Å
58	Y	98.8	Very high	98	Very high	57 Å²	57	83.3 Å²	83.3	22%	0.224	42%	0.419	C	S	.	.	H	α-helix	trans	-63.2	-46.4	179.3	-171.6	-81	0	0	0	110.3	M21 R24 M25 A28 C54 V55 L61 H62	M21-Y58 HydrophobicContact CG-CE1 4.18Å; R24-Y58 WeakPolarHBondContact CB-OH 3.1Å; M25-Y58 HydrophobicContact CB-CD1 3.72Å; M25-Y58 HydrophobicContact CB-CD2 4.31Å; M25-Y58 HydrophobicContact CB-CE1 3.63Å; M25-Y58 HydrophobicContact CB-CE2 4.23Å; M25-Y58 HydrophobicContact CB-CG 4.08Å; M25-Y58 HydrophobicContact CG-CD1 3.61Å; M25-Y58 HydrophobicContact CG-CD2 4.18Å; M25-Y58 HydrophobicContact CG-CE1 4.08Å; M25-Y58 HydrophobicContact CG-CG 3.67Å; M25-Y58 HydrophobicContact SD-CD1 3.91Å; M25-Y58 HydrophobicContact SD-CG 4.31Å; A28-Y58 HydrophobicContact CB-CD2 4.36Å; A28-Y58 HydrophobicContact CB-CE2 4.16Å; C54-Y58 WeakPolarHBondContact O-CB 3.43Å; C54-Y58 PolarHBondContact O-N 2.96Å; V55-Y58 PolarHBondContact O-N 3.37Å; V55-Y58 VanDerWaalsContact O-N 3.15Å; Y58-L61 PolarHBondContact O-N 2.78Å; Y58-H62 VanDerWaalsContact O-CB 3.23Å; Y58-H62 WeakPolarHBondContact O-CB 3.46Å; Y58-H62 PolarHBondContact O-N 3.27Å
59	L	98.3	Very high	97.9	Very high	76 Å²	76	87 Å²	87	40%	0.398	43%	0.433	S	S	.	.	H	α-helix	trans	-66.2	-44.8	179	-66.2	174.1	0	0	0	112.1	M21 M25 V55 L61 H62 E63	M21-L59 HydrophobicContact CE-CD2 3.94Å; M21-L59 HydrophobicContact SD-CD2 4.07Å; M25-L59 HydrophobicContact SD-CD2 4.2Å; M25-L59 HydrophobicContact SD-CG 4.26Å; V55-L59 HydrophobicContact CG1-CD1 4.07Å; V55-L59 WeakPolarHBondContact O-CG 3.02Å; V55-L59 PolarHBondContact O-N 3.07Å; L59-L61 VanDerWaalsContact C-N 3.33Å; L59-L61 PolarHBondContact O-N 3.45Å; L59-H62 PolarHBondContact O-N 3.34Å; L59-E63 WeakPolarHBondContact O-CB 3.47Å; L59-E63 PolarHBondContact O-N 3.49Å
60	D	98.3	Very high	97.8	Very high	63 Å²	63	88.7 Å²	88.7	34%	0.337	44%	0.444	S	S	.	.	H	α-helix	trans	-59.3	-43	175	174.1	49.9	0	0	0	111.7	A56 R64	A56-D60 WeakPolarHBondContact O-CB 3.02Å; A56-D60 PolarHBondContact O-N 3.14Å; A56-D60 VanDerWaalsContact O-N 3.13Å; D60-R64 VanDerWaalsContact CG-NE 3.34Å; D60-R64 VanDerWaalsContact CG-NH2 3.29Å; D60-R64 VanDerWaalsContact O-CG 3.25Å; D60-R64 WeakPolarHBondContact O-CG 3.28Å; D60-R64 PolarHBondContact O-N 3.32Å; D60-R64 VanDerWaalsContact O-N 3.13Å; D60-R64 IonicContact OD1-CZ 3.63Å; D60-R64 VanDerWaalsContact OD1-CZ 3.26Å; D60-R64 IonicContact OD1-NE 3.02Å; D60-R64 PolarHBondContact OD1-NE 2.81Å; D60-R64 IonicContact OD1-NH2 2.84Å; D60-R64 PolarHBondContact OD1-NH2 3.47Å; D60-R64 IonicContact OD2-CZ 3.26Å; D60-R64 IonicContact OD2-NE 2.81Å; D60-R64 PolarHBondContact OD2-NE 3.45Å; D60-R64 IonicContact OD2-NH2 2.9Å; D60-R64 PolarHBondContact OD2-NH2 2.97Å
61	L	97.9	Very high	97.7	Very high	113 Å²	113	91 Å²	91	59%	0.592	45%	0.45	S	S	*	.	H	α-helix	trans	-66.4	-44.1	175.6	-178.6	64	0	0	0	112	K57 Y58 L59 E63 R64 L65	K57-L61 VanDerWaalsContact O-CB 3.3Å; K57-L61 WeakPolarHBondContact O-CB 3.26Å; K57-L61 PolarHBondContact O-N 3.08Å; Y58-L61 PolarHBondContact O-N 2.78Å; L59-L61 VanDerWaalsContact C-N 3.33Å; L59-L61 PolarHBondContact O-N 3.45Å; L61-E63 VanDerWaalsContact C-N 3.32Å; L61-E63 PolarHBondContact O-N 3.12Å; L61-R64 PolarHBondContact O-N 3.35Å; L61-L65 WeakPolarHBondContact O-CB 3.06Å; L61-L65 PolarHBondContact O-N 2.96Å
62	H	97	Very high	97.5	Very high	94 Å²	94	92.5 Å²	92.5	44%	0.435	46%	0.458	S	S	.	.	H	α-helix	trans	-58.7	-44.4	179	179.7	-87.2	0	0	0	111.1	Y58 L59 L65 G66	Y58-H62 VanDerWaalsContact O-CB 3.23Å; Y58-H62 WeakPolarHBondContact O-CB 3.46Å; Y58-H62 PolarHBondContact O-N 3.27Å; L59-H62 PolarHBondContact O-N 3.34Å; H62-L65 PolarHBondContact O-N 3.26Å; H62-G66 PolarHBondContact O-N 3.15Å
63	E	97.4	Very high	97.3	Very high	106 Å²	106	89.4 Å²	89.4	50%	0.495	45%	0.446	S	S	.	.	H	α-helix	trans	-63.8	-45.7	177.5	-165.1	-163.7	166.5	0	0	112.2	L59 L61 L65 G66 R67	L59-E63 WeakPolarHBondContact O-CB 3.47Å; L59-E63 PolarHBondContact O-N 3.49Å; L61-E63 VanDerWaalsContact C-N 3.32Å; L61-E63 PolarHBondContact O-N 3.12Å; E63-L65 VanDerWaalsContact C-N 3.32Å; E63-L65 PolarHBondContact O-N 3.09Å; E63-G66 PolarHBondContact O-N 2.94Å; E63-R67 PolarHBondContact O-N 3.41Å; E63-R67 IonicContact OE1-CZ 2.86Å; E63-R67 IonicContact OE1-NH1 2.76Å; E63-R67 PolarHBondContact OE1-NH1 2.93Å; E63-R67 IonicContact OE2-NH1 3.07Å
64	R	97.9	Very high	97.1	Very high	138 Å²	138	84.9 Å²	84.9	52%	0.521	44%	0.436	S	S	.	.	H	α-helix	trans	-62	-41.5	176.6	-70.3	170.6	-167	-151	6.3	111.8	D60 L61 K68	D60-R64 VanDerWaalsContact CG-NE 3.34Å; D60-R64 VanDerWaalsContact CG-NH2 3.29Å; D60-R64 VanDerWaalsContact O-CG 3.25Å; D60-R64 WeakPolarHBondContact O-CG 3.28Å; D60-R64 PolarHBondContact O-N 3.32Å; D60-R64 VanDerWaalsContact O-N 3.13Å; D60-R64 IonicContact OD1-CZ 3.63Å; D60-R64 VanDerWaalsContact OD1-CZ 3.26Å; D60-R64 IonicContact OD1-NE 3.02Å; D60-R64 PolarHBondContact OD1-NE 2.81Å; D60-R64 IonicContact OD1-NH2 2.84Å; D60-R64 PolarHBondContact OD1-NH2 3.47Å; D60-R64 IonicContact OD2-CZ 3.26Å; D60-R64 IonicContact OD2-NE 2.81Å; D60-R64 PolarHBondContact OD2-NE 3.45Å; D60-R64 IonicContact OD2-NH2 2.9Å; D60-R64 PolarHBondContact OD2-NH2 2.97Å; L61-R64 PolarHBondContact O-N 3.35Å; R64-K68 PolarHBondContact O-N 2.93Å
65	L	96.6	Very high	96.8	Very high	118 Å²	118	89 Å²	89	62%	0.618	45%	0.454	S	S	*	.	H	α-helix	trans	-65.2	-43.3	177.6	-173.3	62.2	0	0	0	110.9	L61 H62 E63 K68 L69	L61-L65 WeakPolarHBondContact O-CB 3.06Å; L61-L65 PolarHBondContact O-N 2.96Å; H62-L65 PolarHBondContact O-N 3.26Å; E63-L65 VanDerWaalsContact C-N 3.32Å; E63-L65 PolarHBondContact O-N 3.09Å; L65-K68 PolarHBondContact O-N 2.05Å; L65-L69 WeakPolarHBondContact O-CB 3.31Å; L65-L69 PolarHBondContact O-N 3.33Å
66	G	95.9	Very high	96.5	Very high	33 Å²	33	91 Å²	91	34%	0.34	46%	0.462	S	S	.	.	H	α-helix	trans	-57	-51	175.1	0	0	0	0	0	112.1	H62 E63 K68 L69 T70	H62-G66 PolarHBondContact O-N 3.15Å; E63-G66 PolarHBondContact O-N 2.94Å; G66-K68 VanDerWaalsContact C-N 3.3Å; G66-K68 PolarHBondContact O-N 3.26Å; G66-L69 PolarHBondContact O-N 3.19Å; G66-T70 PolarHBondContact O-N 3.35Å; G66-T70 PolarHBondContact O-OG1 3.43Å
67	R	96.6	Very high	96.2	Very high	119 Å²	119	94.5 Å²	94.5	45%	0.449	47%	0.468	S	S	.	.	H	α-helix	trans	-54.7	-46.6	174.4	-78.2	-168.4	-72.6	-90	-1.3	112.1	E63 L69 T70 E71	E63-R67 PolarHBondContact O-N 3.41Å; E63-R67 IonicContact OE1-CZ 2.86Å; E63-R67 IonicContact OE1-NH1 2.76Å; E63-R67 PolarHBondContact OE1-NH1 2.93Å; E63-R67 IonicContact OE2-NH1 3.07Å; R67-L69 VanDerWaalsContact C-N 3.32Å; R67-L69 PolarHBondContact O-N 3.13Å; R67-T70 PolarHBondContact O-N 3.23Å; R67-E71 WeakPolarHBondContact O-CG 3.35Å; R67-E71 PolarHBondContact O-N 3.01Å
68	K	96.9	Very high	95.8	Very high	96 Å²	96	92.3 Å²	92.3	42%	0.417	46%	0.46	S	S	.	.	H	α-helix	trans	-66.1	-37.9	-177.1	-170.9	61.9	-170.4	167.1	0	112.2	R64 L65 G66 E71 L72	R64-K68 PolarHBondContact O-N 2.93Å; L65-K68 PolarHBondContact O-N 2.05Å; G66-K68 VanDerWaalsContact C-N 3.3Å; G66-K68 PolarHBondContact O-N 3.26Å; K68-E71 WeakPolarHBondContact CD-OE2 3.24Å; K68-E71 IonicContact NZ-OE2 3.26Å; K68-E71 PolarHBondContact NZ-OE2 2.85Å; K68-E71 PolarHBondContact O-N 3.18Å; K68-L72 HydrophobicContact CG-CD1 4.38Å; K68-L72 VanDerWaalsContact O-CG 3.3Å; K68-L72 WeakPolarHBondContact O-CG 3.47Å; K68-L72 PolarHBondContact O-N 3.4Å; K68-L72 VanDerWaalsContact O-N 3.1Å
69	L	96.5	Very high	95.4	Very high	113 Å²	113	94.8 Å²	94.8	59%	0.592	48%	0.475	S	S	*	.	H	α-helix	trans	-63.3	-45.5	176.2	-174.8	61.5	0	0	0	110.9	L65 G66 R67 E71 L72 S73	L65-L69 WeakPolarHBondContact O-CB 3.31Å; L65-L69 PolarHBondContact O-N 3.33Å; G66-L69 PolarHBondContact O-N 3.19Å; R67-L69 VanDerWaalsContact C-N 3.32Å; R67-L69 PolarHBondContact O-N 3.13Å; L69-E71 PolarHBondContact O-N 2.86Å; L69-L72 PolarHBondContact O-N 3.2Å; L69-S73 PolarHBondContact O-N 2.93Å; L69-S73 PolarHBondContact O-OG 2.05Å; L69-S73 VanDerWaalsContact O-OG 3.11Å
70	T	95.6	Very high	95	Very high	92 Å²	92	97.6 Å²	97.6	56%	0.564	49%	0.488	S	S	*	.	H	α-helix	trans	-60.2	-43.8	175.9	-55	0	0	0	0	112.3	G66 R67 L72 S73 V74	G66-T70 PolarHBondContact O-N 3.35Å; G66-T70 PolarHBondContact O-OG1 3.43Å; R67-T70 PolarHBondContact O-N 3.23Å; T70-L72 VanDerWaalsContact C-N 3.3Å; T70-L72 PolarHBondContact O-N 3.43Å; T70-S73 PolarHBondContact O-N 3.15Å; T70-V74 WeakPolarHBondContact O-CG2 3.27Å; T70-V74 PolarHBondContact O-N 2.99Å; T70-V74 VanDerWaalsContact O-N 3.08Å
71	E	96.1	Very high	94.7	Very high	92 Å²	92	103.3 Å²	103.3	43%	0.43	51%	0.505	S	S	.	.	H	α-helix	trans	-56.5	-44.8	175.1	-74	171.9	-164.1	0	0	111.9	R67 K68 L69 Q75	R67-E71 WeakPolarHBondContact O-CG 3.35Å; R67-E71 PolarHBondContact O-N 3.01Å; K68-E71 WeakPolarHBondContact CD-OE2 3.24Å; K68-E71 IonicContact NZ-OE2 3.26Å; K68-E71 PolarHBondContact NZ-OE2 2.85Å; K68-E71 PolarHBondContact O-N 3.18Å; L69-E71 PolarHBondContact O-N 2.86Å; E71-Q75 VanDerWaalsContact O-CG 3.27Å; E71-Q75 WeakPolarHBondContact O-CG 3.23Å; E71-Q75 PolarHBondContact O-N 2.76Å; E71-Q75 VanDerWaalsContact O-N 3.11Å
72	L	95.6	Very high	94.2	Very high	73 Å²	73	104.7 Å²	104.7	38%	0.382	51%	0.506	S	S	.	.	H	α-helix	trans	-67.4	-41.9	179.6	-68.5	170.9	0	0	0	111.5	K68 L69 T70 V74 Q75 D76	K68-L72 HydrophobicContact CG-CD1 4.38Å; K68-L72 VanDerWaalsContact O-CG 3.3Å; K68-L72 WeakPolarHBondContact O-CG 3.47Å; K68-L72 PolarHBondContact O-N 3.4Å; K68-L72 VanDerWaalsContact O-N 3.1Å; L69-L72 PolarHBondContact O-N 3.2Å; T70-L72 VanDerWaalsContact C-N 3.3Å; T70-L72 PolarHBondContact O-N 3.43Å; L72-V74 VanDerWaalsContact C-N 3.34Å; L72-V74 PolarHBondContact O-N 2.87Å; L72-Q75 WeakPolarHBondContact O-CB 3.41Å; L72-Q75 PolarHBondContact O-N 3.06Å; L72-D76 PolarHBondContact O-N 2.9Å
73	S	94.8	Very high	93.7	Very high	53 Å²	53	105 Å²	105	37%	0.371	51%	0.511	S	S	.	.	H	α-helix	trans	-59.2	-43.5	176.8	-61.9	0	0	0	0	112.5	L69 T70 D76 E77	L69-S73 PolarHBondContact O-N 2.93Å; L69-S73 PolarHBondContact O-OG 2.05Å; L69-S73 VanDerWaalsContact O-OG 3.11Å; T70-S73 PolarHBondContact O-N 3.15Å; S73-D76 PolarHBondContact O-N 2.98Å; S73-E77 WeakPolarHBondContact O-CG 3.3Å; S73-E77 PolarHBondContact O-N 3.44Å
74	V	94	Very high	93	Very high	70 Å²	70	104 Å²	104	42%	0.424	52%	0.521	S	S	.	.	H	α-helix	trans	-64.9	-41.9	176.4	174	0	0	0	0	111.1	T70 L72 D76 E77 E78	T70-V74 WeakPolarHBondContact O-CG2 3.27Å; T70-V74 PolarHBondContact O-N 2.99Å; T70-V74 VanDerWaalsContact O-N 3.08Å; L72-V74 VanDerWaalsContact C-N 3.34Å; L72-V74 PolarHBondContact O-N 2.87Å; V74-D76 PolarHBondContact O-N 3.44Å; V74-E77 PolarHBondContact O-N 3.02Å; V74-E78 WeakPolarHBondContact O-CG 3.39Å; V74-E78 PolarHBondContact O-N 3.07Å
75	Q	92.5	Very high	92.2	Very high	102 Å²	102	103.3 Å²	103.3	48%	0.477	53%	0.526	S	S	.	.	H	α-helix	trans	-62.4	-41.7	177	-74.1	175	-1.9	0	0	112.2	E71 L72 E78 M79	E71-Q75 VanDerWaalsContact O-CG 3.27Å; E71-Q75 WeakPolarHBondContact O-CG 3.23Å; E71-Q75 PolarHBondContact O-N 2.76Å; E71-Q75 VanDerWaalsContact O-N 3.11Å; L72-Q75 WeakPolarHBondContact O-CB 3.41Å; L72-Q75 PolarHBondContact O-N 3.06Å; Q75-E78 PolarHBondContact O-N 2.8Å; Q75-M79 WeakPolarHBondContact O-CB 3.41Å; Q75-M79 PolarHBondContact O-N 2.71Å
76	D	92.3	Very high	90.6	Very high	93 Å²	93	100.6 Å²	100.6	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-65.3	-44	177.8	-73.3	-15.6	0	0	0	111.1	L72 S73 V74 E78 M79 M80	L72-D76 PolarHBondContact O-N 2.9Å; S73-D76 PolarHBondContact O-N 2.98Å; V74-D76 PolarHBondContact O-N 3.44Å; D76-E78 PolarHBondContact O-N 3.26Å; D76-M79 PolarHBondContact O-N 2.76Å; D76-M80 WeakPolarHBondContact O-CB 3.28Å; D76-M80 WeakPolarHBondContact O-CG 3.3Å; D76-M80 PolarHBondContact O-N 3.01Å
77	E	91.9	Very high	88.5	Confident	135 Å²	135	111.1 Å²	111.1	63%	0.631	57%	0.567	S	S	*	*	H	α-helix	trans	-60.8	-43.8	175	-74.6	177.9	-176.5	0	0	112.2	S73 V74 M80 R81	S73-E77 WeakPolarHBondContact O-CG 3.3Å; S73-E77 PolarHBondContact O-N 3.44Å; V74-E77 PolarHBondContact O-N 3.02Å; E77-M80 PolarHBondContact O-N 3.39Å; E77-R81 WeakPolarHBondContact O-CB 3.44Å; E77-R81 PolarHBondContact O-N 2.89Å
78	E	91.3	Very high	88.1	Confident	102 Å²	102	110.7 Å²	110.7	48%	0.477	57%	0.573	S	S	.	*	H	α-helix	trans	-63.8	-41.8	175.6	-76.7	-172.7	-179.3	0	0	112.3	V74 Q75 D76 R81 K82	V74-E78 WeakPolarHBondContact O-CG 3.39Å; V74-E78 PolarHBondContact O-N 3.07Å; Q75-E78 PolarHBondContact O-N 2.8Å; D76-E78 PolarHBondContact O-N 3.26Å; E78-R81 PolarHBondContact O-N 3.24Å; E78-K82 VanDerWaalsContact O-CG 3.3Å; E78-K82 WeakPolarHBondContact O-CG 3.3Å; E78-K82 PolarHBondContact O-N 3.05Å
79	M	90.9	Very high	87.6	Confident	109 Å²	109	111.5 Å²	111.5	54%	0.537	58%	0.581	S	S	.	*	H	α-helix	trans	-63.8	-46	177.4	-172.3	-176.1	-59.4	0	0	110.7	Q75 D76 R81 K82 N83	Q75-M79 WeakPolarHBondContact O-CB 3.41Å; Q75-M79 PolarHBondContact O-N 2.71Å; D76-M79 PolarHBondContact O-N 2.76Å; M79-R81 VanDerWaalsContact C-N 3.34Å; M79-R81 PolarHBondContact O-N 3.25Å; M79-K82 PolarHBondContact O-N 3.49Å; M79-N83 PolarHBondContact O-N 3.4Å; M79-N83 PolarHBondContact O-ND2 3.03Å; M79-N83 PolarHBondContact O-OD1 3.07Å
80	M	89.6	Confident	87.1	Confident	135 Å²	135	111.4 Å²	111.4	67%	0.665	58%	0.581	S	S	*	*	H	α-helix	trans	-61.8	-42.1	177.3	-70.8	-69.6	-81.9	0	0	111.5	D76 E77 N83 A84	D76-M80 WeakPolarHBondContact O-CB 3.28Å; D76-M80 WeakPolarHBondContact O-CG 3.3Å; D76-M80 PolarHBondContact O-N 3.01Å; E77-M80 PolarHBondContact O-N 3.39Å; M80-N83 PolarHBondContact O-N 3.17Å; M80-A84 WeakPolarHBondContact O-CB 3.32Å; M80-A84 PolarHBondContact O-N 2.9Å
81	R	91.2	Very high	86.6	Confident	184 Å²	184	112.5 Å²	112.5	69%	0.694	58%	0.582	S	S	*	*	H	α-helix	trans	-63.2	-42	175.1	179.5	178.7	154.4	-176.3	-6	112.1	E77 E78 M79 N83 A84 I85	E77-R81 WeakPolarHBondContact O-CB 3.44Å; E77-R81 PolarHBondContact O-N 2.89Å; E78-R81 PolarHBondContact O-N 3.24Å; M79-R81 VanDerWaalsContact C-N 3.34Å; M79-R81 PolarHBondContact O-N 3.25Å; R81-N83 VanDerWaalsContact C-N 3.35Å; R81-A84 PolarHBondContact O-N 2.87Å; R81-I85 HydrophobicContact CG-CD1 3.85Å; R81-I85 WeakPolarHBondContact O-CD1 3.24Å; R81-I85 VanDerWaalsContact O-CG1 3.27Å; R81-I85 WeakPolarHBondContact O-CG1 3.45Å; R81-I85 PolarHBondContact O-N 3.36Å
82	K	87.8	Confident	86	Confident	141 Å²	141	113.8 Å²	113.8	61%	0.613	59%	0.591	S	S	*	*	H	α-helix	trans	-62.9	-42	175.5	-73.9	170.2	-172.9	168.1	0	111.4	E78 M79 A84 I85 G86	E78-K82 VanDerWaalsContact O-CG 3.3Å; E78-K82 WeakPolarHBondContact O-CG 3.3Å; E78-K82 PolarHBondContact O-N 3.05Å; M79-K82 PolarHBondContact O-N 3.49Å; K82-A84 VanDerWaalsContact C-N 3.32Å; K82-A84 PolarHBondContact O-N 3.47Å; K82-I85 PolarHBondContact O-N 3.1Å; K82-G86 PolarHBondContact O-N 3.29Å
83	N	86.5	Confident	85.4	Confident	101 Å²	101	116.5 Å²	116.5	54%	0.54	61%	0.605	S	S	.	*	H	α-helix	trans	-65.3	-35.1	177.4	-66.9	-13.5	0	0	0	112.3	M79 M80 R81 G86	M79-N83 PolarHBondContact O-N 3.4Å; M79-N83 PolarHBondContact O-ND2 3.03Å; M79-N83 PolarHBondContact O-OD1 3.07Å; M80-N83 PolarHBondContact O-N 3.17Å; R81-N83 VanDerWaalsContact C-N 3.35Å; N83-G86 PolarHBondContact O-N 3.39Å
84	A	83.1	Confident	84.7	Confident	84 Å²	84	121.1 Å²	121.1	69%	0.694	62%	0.622	S	S	*	*	H	α-helix	trans	-73.3	-24.3	177.8	0	0	0	0	0	113.9	M80 R81 K82	M80-A84 WeakPolarHBondContact O-CB 3.32Å; M80-A84 PolarHBondContact O-N 2.9Å; R81-A84 PolarHBondContact O-N 2.87Å; K82-A84 VanDerWaalsContact C-N 3.32Å; K82-A84 PolarHBondContact O-N 3.47Å
85	I	79.8	Confident	84	Confident	124 Å²	124	125 Å²	125	64%	0.636	64%	0.637	S	S	*	*	H	α-helix	trans	-87.8	-12.2	177.8	-62.7	164.7	0	0	0	111.2	R81 K82	R81-I85 HydrophobicContact CG-CD1 3.85Å; R81-I85 WeakPolarHBondContact O-CD1 3.24Å; R81-I85 VanDerWaalsContact O-CG1 3.27Å; R81-I85 WeakPolarHBondContact O-CG1 3.45Å; R81-I85 PolarHBondContact O-N 3.36Å; K82-I85 PolarHBondContact O-N 3.1Å
86	G	64.6	Low	83.3	Confident	62 Å²	62	126.9 Å²	126.9	64%	0.639	65%	0.65	S	S	*	*			trans	-92.8	23.9	-173.5	0	0	0	0	0	117.3	K82 N83	K82-G86 PolarHBondContact O-N 3.29Å; N83-G86 PolarHBondContact O-N 3.39Å
87	Q	50.9	Low	82.5	Confident	253 Å²	253	130 Å²	130	100%	1.182	66%	0.664	S	S	*	*			trans	-125.3	0	169.8	-71.6	-174.2	18.9	0	0	111.6

Retrieved 87 of 87 residues in 62.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).