A0A2K5KKD1_CERAT Loading...

Coiled-coil domain containing 182

AlphaFold DB , UniProt , Accession A0A2K5KKD1, Species CERAT (Cercocebus atys, Sooty mangabey), Gene CCDC182, Length 153 aa.

						>A0A2K5KKD1_CERAT|A0A2K5KKD1|CCDC182
MESLYQAGSILMTVNTLQGKKMVESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQRELEDFKKETLKSIHYLEDSFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRATKKSQAD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.6	Very low	42.8	Very low	245 Å²	245	153.4 Å²	153.4	100%	1.207	84%	0.843	S	S	*	*				0	91.4	0	-79.7	-81.8	-125	0	0	106.7
2	E	36.1	Very low	42.4	Very low	189 Å²	189	154.5 Å²	154.5	88%	0.883	84%	0.841	S	S	*	*			trans	-79.3	133.5	171.5	-73.9	168.2	145.5	0	0	108.6
3	S	45.3	Very low	42.7	Very low	99 Å²	99	152.1 Å²	152.1	69%	0.692	83%	0.834	S	S	*	*			trans	-127.1	95.8	164.4	56.2	0	0	0	0	108.4	Y5	S3-Y5 PolarHBondContact O-N 3.26Å
4	L	45.2	Very low	43.2	Very low	165 Å²	165	150 Å²	150	86%	0.864	83%	0.828	S	S	*	*			trans	-68	103.7	170.4	-74.3	154.6	0	0	0	109	Q6	L4-Q6 PolarHBondContact O-N 2.94Å
5	Y	42.1	Very low	43.2	Very low	217 Å²	217	150.3 Å²	150.3	85%	0.851	83%	0.828	S	S	*	*			trans	-89.9	98	161.2	-87.6	-87	0	0	0	108.5	S3 A7	S3-Y5 PolarHBondContact O-N 3.26Å; Y5-A7 PolarHBondContact O-N 3.39Å
6	Q	39.7	Very low	43.8	Very low	190 Å²	190	149 Å²	149	89%	0.888	83%	0.826	S	S	*	*			trans	-77.1	95	173.3	-173.8	168.3	1.2	0	0	108.8	L4 G8	L4-Q6 PolarHBondContact O-N 2.94Å; Q6-G8 PolarHBondContact O-N 2.87Å
7	A	45.8	Very low	44.1	Very low	96 Å²	96	149.6 Å²	149.6	79%	0.793	83%	0.826	S	S	*	*			trans	-72.4	108.8	168.9	0	0	0	0	0	108.8	Y5 S9	Y5-A7 PolarHBondContact O-N 3.39Å; A7-S9 PolarHBondContact O-N 3.35Å; A7-S9 VanDerWaalsContact O-N 3.16Å
8	G	45.9	Very low	44.3	Very low	71 Å²	71	152.6 Å²	152.6	73%	0.732	83%	0.833	S	S	*	*			trans	-61.6	112.9	171.9	0	0	0	0	0	110.2	Q6 I10	Q6-G8 PolarHBondContact O-N 2.87Å; G8-I10 PolarHBondContact O-N 3.27Å
9	S	42.8	Very low	44.1	Very low	115 Å²	115	148.5 Å²	148.5	80%	0.804	83%	0.83	S	S	*	*			trans	-69.3	114.5	174.7	175.6	0	0	0	0	109.7	A7 L11	A7-S9 PolarHBondContact O-N 3.35Å; A7-S9 VanDerWaalsContact O-N 3.16Å; S9-L11 PolarHBondContact O-N 3.06Å
10	I	46.9	Very low	44.9	Very low	152 Å²	152	151.7 Å²	151.7	78%	0.779	84%	0.835	S	S	*	*			trans	-76.9	107.8	165.5	-62.1	174.3	0	0	0	106.8	G8 M12	G8-I10 PolarHBondContact O-N 3.27Å; I10-M12 PolarHBondContact O-N 3.43Å
11	L	40.3	Very low	45.2	Very low	148 Å²	148	153.9 Å²	153.9	78%	0.775	84%	0.836	S	S	*	*			trans	-64.4	102	175.1	-174.3	75.2	0	0	0	109.5	S9	S9-L11 PolarHBondContact O-N 3.06Å
12	M	37.9	Very low	45.2	Very low	167 Å²	167	149.4 Å²	149.4	82%	0.823	81%	0.814	S	S	*	*			trans	-84.8	110.4	166.4	-70.9	-140.3	98.2	0	0	109.6	I10 V14	I10-M12 PolarHBondContact O-N 3.43Å; M12-V14 PolarHBondContact O-N 3.3Å
13	T	46.3	Very low	45.9	Very low	123 Å²	123	147.1 Å²	147.1	76%	0.755	81%	0.813	S	S	*	*			trans	-74.5	106.2	169.8	39.9	0	0	0	0	110.1
14	V	49.4	Very low	46.1	Very low	123 Å²	123	151.5 Å²	151.5	75%	0.745	82%	0.822	S	S	*	*			trans	-84.2	115.6	168.4	-175.8	0	0	0	0	108.2	M12 T16	M12-V14 PolarHBondContact O-N 3.3Å; V14-T16 PolarHBondContact O-N 3.38Å; V14-T16 VanDerWaalsContact O-N 3.07Å
15	N	44.5	Very low	45.9	Very low	154 Å²	154	147.1 Å²	147.1	82%	0.824	81%	0.805	S	S	*	*			trans	-68.3	100.4	173.4	-93.6	-30.5	0	0	0	109.9	L17	N15-L17 PolarHBondContact O-N 3.45Å
16	T	51.7	Low	46.4	Very low	130 Å²	130	140.7 Å²	140.7	80%	0.798	81%	0.805	S	S	*	*			trans	-87.4	96.2	164.7	51.3	0	0	0	0	109.3	V14	V14-T16 PolarHBondContact O-N 3.38Å; V14-T16 VanDerWaalsContact O-N 3.07Å
17	L	49.6	Very low	46.6	Very low	160 Å²	160	138.9 Å²	138.9	84%	0.838	80%	0.801	S	S	*	*			trans	-124.1	132.2	160.4	-82	174.6	0	0	0	109.1	N15	N15-L17 PolarHBondContact O-N 3.45Å
18	Q	48	Very low	46.6	Very low	203 Å²	203	143.3 Å²	143.3	95%	0.949	81%	0.805	S	S	*	*			trans	99.1	98	159.8	-140.8	168.9	37.7	0	0	116.9
19	G	39.2	Very low	46.6	Very low	75 Å²	75	145 Å²	145	77%	0.773	81%	0.805	S	S	*	*			trans	172.5	34.4	167.6	0	0	0	0	0	115.4	K21	G19-K21 PolarHBondContact O-N 2.84Å
20	K	60.7	Low	46.6	Very low	212 Å²	212	142.1 Å²	142.1	92%	0.922	79%	0.794	S	S	*	*			trans	-78.3	86.4	178	-165.6	179.8	-172.4	177.6	0	109.8
21	K	51.4	Low	46.5	Very low	198 Å²	198	141.3 Å²	141.3	86%	0.861	79%	0.791	S	S	*	*			trans	152.2	103.9	151.6	-93.6	-170.1	174	-172.1	0	110.1	G19	G19-K21 PolarHBondContact O-N 2.84Å
22	M	40.4	Very low	46.7	Very low	151 Å²	151	144 Å²	144	74%	0.744	80%	0.797	S	S	*	*			trans	-173.3	80.5	137.4	-119.5	180	46.8	0	0	108.7
23	V	50.6	Low	47.4	Very low	141 Å²	141	140.4 Å²	140.4	86%	0.855	79%	0.788	S	S	*	*			trans	-105.2	138.1	152.1	174.9	0	0	0	0	103.5
24	E	49.6	Very low	47.6	Very low	191 Å²	191	141.4 Å²	141.4	89%	0.893	79%	0.788	S	S	*	*			trans	91.7	43.9	-178.5	-50.7	-171.8	155	0	0	118.2
25	S	42.3	Very low	47.3	Very low	72 Å²	72	140 Å²	140	50%	0.503	78%	0.784	S	S	.	*	S	Bend	trans	-132.4	115.1	142.8	39.7	0	0	0	0	108.4	L27	S25-L27 PolarHBondContact O-N 3Å
26	G	50.8	Low	47.5	Very low	82 Å²	82	142.4 Å²	142.4	85%	0.845	79%	0.79	S	S	*	*			trans	-58.9	90.8	-174.4	0	0	0	0	0	112.5	Q28	G26-Q28 PolarHBondContact O-N 2.91Å
27	L	44.8	Very low	47.5	Very low	153 Å²	153	140.6 Å²	140.6	80%	0.801	78%	0.783	S	S	*	*			trans	-87.8	100.9	156.7	-64	178.3	0	0	0	105.6	S25 S29	S25-L27 PolarHBondContact O-N 3Å; L27-S29 PolarHBondContact O-N 3.44Å; L27-S29 VanDerWaalsContact O-N 3.17Å
28	Q	45.6	Very low	47.8	Very low	188 Å²	188	143.3 Å²	143.3	88%	0.879	78%	0.782	S	S	*	*			trans	-41.7	124.5	163.7	-71.7	174.1	-20.9	0	0	107.5	G26 G30	G26-Q28 PolarHBondContact O-N 2.91Å; Q28-G30 VanDerWaalsContact C-N 3.26Å; Q28-G30 PolarHBondContact O-N 3.49Å
29	S	45.3	Very low	47.9	Very low	107 Å²	107	138.5 Å²	138.5	75%	0.748	77%	0.768	S	S	*	*			trans	-49.7	101.5	163.1	178.6	0	0	0	0	105.8	L27 D31	L27-S29 PolarHBondContact O-N 3.44Å; L27-S29 VanDerWaalsContact O-N 3.17Å; S29-D31 PolarHBondContact O-N 3.03Å
30	G	42.8	Very low	48.6	Very low	55 Å²	55	140.9 Å²	140.9	57%	0.567	77%	0.774	S	S	*	*			trans	-59.7	109.1	172.9	0	0	0	0	0	105.1	Q28 F32	Q28-G30 VanDerWaalsContact C-N 3.26Å; Q28-G30 PolarHBondContact O-N 3.49Å; G30-F32 PolarHBondContact O-N 3.04Å
31	D	45.2	Very low	48.6	Very low	135 Å²	135	135.6 Å²	135.6	72%	0.722	76%	0.762	S	S	*	*			trans	-50.7	116.2	171.5	-78.8	-32.7	0	0	0	106.5	S29 S33	S29-D31 PolarHBondContact O-N 3.03Å; D31-S33 PolarHBondContact O-N 3.48Å
32	F	44.8	Very low	49.1	Very low	203 Å²	203	133.4 Å²	133.4	89%	0.89	76%	0.759	S	S	*	*			trans	-70.5	59.3	161.3	-73.4	-85.1	0	0	0	108	G30 L34	G30-F32 PolarHBondContact O-N 3.04Å; F32-L34 PolarHBondContact O-N 2.8Å
33	S	52.5	Low	50.3	Low	92 Å²	92	129.2 Å²	129.2	64%	0.643	74%	0.743	S	S	*	*			trans	-67	91.7	157.7	-61.5	0	0	0	0	104.7	D31 S35	D31-S33 PolarHBondContact O-N 3.48Å; S33-S35 PolarHBondContact O-N 3.11Å
34	L	50	Low	51.6	Low	144 Å²	144	126.1 Å²	126.1	75%	0.754	73%	0.726	S	S	*	*			trans	-47.6	114.8	163.4	-71.2	169.1	0	0	0	105.8	F32 Q36	F32-L34 PolarHBondContact O-N 2.8Å; L34-Q36 PolarHBondContact O-N 3.38Å
35	S	44.5	Very low	52.9	Low	93 Å²	93	121.8 Å²	121.8	65%	0.65	71%	0.714	S	S	*	*			trans	-46.8	115.5	177	-75	0	0	0	0	108.3	S33 S37	S33-S35 PolarHBondContact O-N 3.11Å; S35-S37 PolarHBondContact O-N 2.9Å
36	Q	48.6	Very low	54.8	Low	205 Å²	205	121.1 Å²	121.1	96%	0.958	71%	0.713	S	S	*	*	S	Bend	trans	-70.7	40.7	177.6	-73.1	-173.5	-1.2	0	0	111.9	L34	L34-Q36 PolarHBondContact O-N 3.38Å
37	S	50.8	Low	56.5	Low	92 Å²	92	121.3 Å²	121.3	64%	0.643	70%	0.695	S	S	*	*			trans	-133.8	60.4	174	66.5	0	0	0	0	108.3	S35	S35-S37 PolarHBondContact O-N 2.9Å
38	W	55.3	Low	58.5	Low	217 Å²	217	117.9 Å²	117.9	82%	0.822	68%	0.677	S	S	*	*			trans	-66.4	129.5	150.8	-82.8	57.9	0	0	0	106.2	S40	W38-S40 PolarHBondContact O-N 3.38Å
39	P	49.8	Very low	60.5	Low	102 Å²	102	115.4 Å²	115.4	66%	0.662	67%	0.665	S	S	*	*			trans	-57.8	120.3	167.6	-11.4	25	0	0	0	106.1	C41	P39-C41 HydrophobicContact CB-CB 4.44Å; P39-C41 PolarHBondContact O-N 3.42Å
40	S	54.5	Low	62.7	Low	126 Å²	126	114.3 Å²	114.3	88%	0.881	65%	0.65	S	S	*	*			trans	-64.8	15.9	176	-31.1	0	0	0	0	113.1	W38	W38-S40 PolarHBondContact O-N 3.38Å
41	C	60.1	Low	65.1	Low	100 Å²	100	116.4 Å²	116.4	68%	0.676	65%	0.648	S	S	*	*			trans	-92.7	107.5	-176	-38.5	0	0	0	0	107.1	P39	P39-C41 HydrophobicContact CB-CB 4.44Å; P39-C41 PolarHBondContact O-N 3.42Å
42	L	62.4	Low	67.4	Low	153 Å²	153	116.8 Å²	116.8	80%	0.801	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-51.7	136.5	161.5	-76.2	161.8	0	0	0	108.1
43	P	66	Low	69.9	Low	62 Å²	62	114.3 Å²	114.3	40%	0.403	64%	0.636	S	S	.	*	P	Polyproline II helix	trans	-55.2	144	175.1	-15.9	26.8	0	0	0	108.7	D47 L48	P43-D47 HydrophobicContact CB-CB 4.3Å; P43-L48 HydrophobicContact CB-CD2 4.3Å; P43-L48 HydrophobicContact CB-CG 4.11Å; P43-L48 HydrophobicContact CG-CD2 3.97Å; P43-L48 HydrophobicContact CG-CG 4.27Å
44	P	78.1	Confident	71.9	Confident	76 Å²	76	116.4 Å²	116.4	49%	0.494	63%	0.634	S	S	.	*	P	Polyproline II helix	trans	-46.3	138.4	173.3	-27.2	33.5	0	0	0	110.4	A46 D47 L48	P44-A46 PolarHBondContact O-N 3.47Å; P44-D47 WeakPolarHBondContact CD-OD2 3.46Å; P44-D47 WeakPolarHBondContact O-CB 3.43Å; P44-D47 PolarHBondContact O-N 3.44Å; P44-L48 PolarHBondContact O-N 3.45Å
45	P	77.6	Confident	74.2	Confident	101 Å²	101	112.9 Å²	112.9	66%	0.656	62%	0.618	S	S	*	*	H	α-helix	trans	-50.6	-34.5	-175.6	-28.9	33.7	0	0	0	114.1	D47 L48 E49	P45-D47 PolarHBondContact O-N 2.89Å; P45-L48 PolarHBondContact O-N 3.24Å; P45-E49 PolarHBondContact O-N 2.99Å
46	A	81.6	Confident	76.6	Confident	57 Å²	57	110.5 Å²	110.5	47%	0.471	60%	0.604	S	S	.	*	H	α-helix	trans	-61.9	-38.1	175.6	0	0	0	0	0	113.4	P44 L48 E49 I50	P44-A46 PolarHBondContact O-N 3.47Å; A46-L48 VanDerWaalsContact C-N 3.35Å; A46-E49 PolarHBondContact O-N 3.41Å; A46-I50 WeakPolarHBondContact O-CD1 3.46Å; A46-I50 VanDerWaalsContact O-CG1 3.23Å; A46-I50 WeakPolarHBondContact O-CG1 3.38Å; A46-I50 PolarHBondContact O-N 2.97Å
47	D	85.5	Confident	78.9	Confident	87 Å²	87	101.7 Å²	101.7	47%	0.465	57%	0.568	S	S	.	*	H	α-helix	trans	-71.7	-32.9	179.2	-65.8	-26.7	0	0	0	111.4	P43 P44 P45 L51	P43-D47 HydrophobicContact CB-CB 4.3Å; P44-D47 WeakPolarHBondContact CD-OD2 3.46Å; P44-D47 WeakPolarHBondContact O-CB 3.43Å; P44-D47 PolarHBondContact O-N 3.44Å; P45-D47 PolarHBondContact O-N 2.89Å; D47-L51 WeakPolarHBondContact O-CB 3.38Å; D47-L51 PolarHBondContact O-N 3.03Å
48	L	86.9	Confident	81.2	Confident	81 Å²	81	101.6 Å²	101.6	42%	0.424	56%	0.564	S	S	.	*	H	α-helix	trans	-68.5	-41.2	173.4	-71	170.8	0	0	0	111.8	P43 P44 P45 A46 L51 Q52	P43-L48 HydrophobicContact CB-CD2 4.3Å; P43-L48 HydrophobicContact CB-CG 4.11Å; P43-L48 HydrophobicContact CG-CD2 3.97Å; P43-L48 HydrophobicContact CG-CG 4.27Å; P44-L48 PolarHBondContact O-N 3.45Å; P45-L48 PolarHBondContact O-N 3.24Å; A46-L48 VanDerWaalsContact C-N 3.35Å; L48-L51 PolarHBondContact O-N 3.43Å; L48-Q52 WeakPolarHBondContact O-CB 3.23Å; L48-Q52 PolarHBondContact O-N 2.98Å
49	E	89	Confident	83.2	Confident	135 Å²	135	97 Å²	97	63%	0.631	55%	0.551	S	S	*	*	H	α-helix	trans	-63.8	-44.1	174.9	-75.9	-179.4	177.2	0	0	111.9	P45 A46 L51 Q52 Q53	P45-E49 PolarHBondContact O-N 2.99Å; A46-E49 PolarHBondContact O-N 3.41Å; E49-L51 VanDerWaalsContact C-N 3.31Å; E49-L51 PolarHBondContact O-N 3.44Å; E49-Q52 PolarHBondContact O-N 3.35Å; E49-Q53 WeakPolarHBondContact O-CB 3.41Å; E49-Q53 PolarHBondContact O-N 3.43Å
50	I	91.6	Very high	85.5	Confident	84 Å²	84	100.1 Å²	100.1	43%	0.431	55%	0.55	S	S	.	.	H	α-helix	trans	-60.3	-43.7	175.1	-68.9	161.4	0	0	0	110.5	A46 Q53 K54	A46-I50 WeakPolarHBondContact O-CD1 3.46Å; A46-I50 VanDerWaalsContact O-CG1 3.23Å; A46-I50 WeakPolarHBondContact O-CG1 3.38Å; A46-I50 PolarHBondContact O-N 2.97Å; I50-Q53 PolarHBondContact O-N 2.9Å; I50-K54 HydrophobicContact CG2-CD 4.31Å; I50-K54 WeakPolarHBondContact O-CG 3.34Å; I50-K54 PolarHBondContact O-N 3.15Å
51	L	93.1	Very high	87.6	Confident	100 Å²	100	100.5 Å²	100.5	52%	0.524	54%	0.538	S	S	.	.	H	α-helix	trans	-64.2	-44	177.8	-175.6	63.3	0	0	0	111.2	D47 L48 E49 Q53 K54 V55	D47-L51 WeakPolarHBondContact O-CB 3.38Å; D47-L51 PolarHBondContact O-N 3.03Å; L48-L51 PolarHBondContact O-N 3.43Å; E49-L51 VanDerWaalsContact C-N 3.31Å; E49-L51 PolarHBondContact O-N 3.44Å; L51-Q53 VanDerWaalsContact C-N 3.33Å; L51-Q53 PolarHBondContact O-N 3.17Å; L51-K54 PolarHBondContact O-N 3.38Å; L51-V55 WeakPolarHBondContact O-CG2 3.36Å; L51-V55 PolarHBondContact O-N 2.94Å
52	Q	93.6	Very high	89.4	Confident	143 Å²	143	100.8 Å²	100.8	67%	0.668	53%	0.532	S	S	*	.	H	α-helix	trans	-62.1	-41.7	178.2	-171.4	171.1	18.8	0	0	111.6	L48 E49 V55 A56	L48-Q52 WeakPolarHBondContact O-CB 3.23Å; L48-Q52 PolarHBondContact O-N 2.98Å; E49-Q52 PolarHBondContact O-N 3.35Å; Q52-V55 PolarHBondContact O-N 3.09Å; Q52-A56 WeakPolarHBondContact O-CB 3.3Å; Q52-A56 PolarHBondContact O-N 3.16Å
53	Q	95.4	Very high	91.1	Very high	150 Å²	150	97.8 Å²	97.8	70%	0.701	51%	0.514	S	S	*	.	H	α-helix	trans	-64.8	-40.2	176.1	-169.5	171.9	8.3	0	0	112	E49 I50 L51 A56 G57	E49-Q53 WeakPolarHBondContact O-CB 3.41Å; E49-Q53 PolarHBondContact O-N 3.43Å; I50-Q53 PolarHBondContact O-N 2.9Å; L51-Q53 VanDerWaalsContact C-N 3.33Å; L51-Q53 PolarHBondContact O-N 3.17Å; Q53-A56 PolarHBondContact O-N 2.93Å; Q53-G57 PolarHBondContact O-N 2.78Å
54	K	96.4	Very high	92.6	Very high	136 Å²	136	98.9 Å²	98.9	59%	0.591	52%	0.516	S	S	*	.	H	α-helix	trans	-64.4	-44.5	174.4	-75.8	178	179.2	179.3	0	112.2	I50 L51 A56 G57 V58	I50-K54 HydrophobicContact CG2-CD 4.31Å; I50-K54 WeakPolarHBondContact O-CG 3.34Å; I50-K54 PolarHBondContact O-N 3.15Å; L51-K54 PolarHBondContact O-N 3.38Å; K54-A56 VanDerWaalsContact C-N 3.33Å; K54-A56 PolarHBondContact O-N 3.25Å; K54-G57 PolarHBondContact O-N 2.89Å; K54-G57 VanDerWaalsContact O-N 3.15Å; K54-V58 WeakPolarHBondContact O-CG2 3.37Å; K54-V58 PolarHBondContact O-N 2.91Å
55	V	96.4	Very high	93.6	Very high	71 Å²	71	101.9 Å²	101.9	43%	0.43	52%	0.522	S	S	.	.	H	α-helix	trans	-61	-43.9	176.6	170.2	0	0	0	0	110.6	L51 Q52 G57 V58 Q59	L51-V55 WeakPolarHBondContact O-CG2 3.36Å; L51-V55 PolarHBondContact O-N 2.94Å; Q52-V55 PolarHBondContact O-N 3.09Å; V55-G57 VanDerWaalsContact C-N 3.3Å; V55-G57 PolarHBondContact O-N 3Å; V55-V58 PolarHBondContact O-N 3.21Å; V55-Q59 HydrophobicContact CG1-CG 4.44Å; V55-Q59 WeakPolarHBondContact O-CB 3.34Å; V55-Q59 VanDerWaalsContact O-CG 3.3Å; V55-Q59 WeakPolarHBondContact O-CG 3.42Å; V55-Q59 PolarHBondContact O-N 3.49Å
56	A	96.3	Very high	94.6	Very high	43 Å²	43	102.2 Å²	102.2	36%	0.355	51%	0.513	S	S	.	.	H	α-helix	trans	-63.4	-35.8	175.5	0	0	0	0	0	112.5	Q52 Q53 K54 R60	Q52-A56 WeakPolarHBondContact O-CB 3.3Å; Q52-A56 PolarHBondContact O-N 3.16Å; Q53-A56 PolarHBondContact O-N 2.93Å; K54-A56 VanDerWaalsContact C-N 3.33Å; K54-A56 PolarHBondContact O-N 3.25Å; A56-R60 PolarHBondContact O-N 3.46Å; A56-R60 VanDerWaalsContact O-N 3.16Å
57	G	97.2	Very high	95.4	Very high	20 Å²	20	105.6 Å²	105.6	21%	0.206	52%	0.517	C	S	.	.	H	α-helix	trans	-63	-52.7	173.4	0	0	0	0	0	112.3	Q53 K54 V55 Q59 R60 E61	Q53-G57 PolarHBondContact O-N 2.78Å; K54-G57 PolarHBondContact O-N 2.89Å; K54-G57 VanDerWaalsContact O-N 3.15Å; V55-G57 VanDerWaalsContact C-N 3.3Å; V55-G57 PolarHBondContact O-N 3Å; G57-Q59 VanDerWaalsContact C-N 3.31Å; G57-Q59 PolarHBondContact O-N 3.3Å; G57-R60 WeakPolarHBondContact O-CB 3.42Å; G57-R60 PolarHBondContact O-N 2.96Å; G57-R60 VanDerWaalsContact O-N 3.09Å; G57-E61 PolarHBondContact O-N 3.35Å
58	V	97.8	Very high	96	Very high	90 Å²	90	106.4 Å²	106.4	55%	0.545	52%	0.518	S	S	.	.	H	α-helix	trans	-61.5	-39.2	178.6	172.9	0	0	0	0	111.6	K54 V55 R60 E61 L62	K54-V58 WeakPolarHBondContact O-CG2 3.37Å; K54-V58 PolarHBondContact O-N 2.91Å; V55-V58 PolarHBondContact O-N 3.21Å; V58-R60 VanDerWaalsContact C-N 3.3Å; V58-R60 PolarHBondContact O-N 3.44Å; V58-E61 PolarHBondContact O-N 2.96Å; V58-L62 WeakPolarHBondContact O-CB 3.38Å; V58-L62 PolarHBondContact O-N 3.48Å
59	Q	97.6	Very high	96.6	Very high	120 Å²	120	105 Å²	105	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-61.3	-39.8	175	-78.4	176.3	-11.2	0	0	112.1	V55 G57 L62 E63	V55-Q59 HydrophobicContact CG1-CG 4.44Å; V55-Q59 WeakPolarHBondContact O-CB 3.34Å; V55-Q59 VanDerWaalsContact O-CG 3.3Å; V55-Q59 WeakPolarHBondContact O-CG 3.42Å; V55-Q59 PolarHBondContact O-N 3.49Å; G57-Q59 VanDerWaalsContact C-N 3.31Å; G57-Q59 PolarHBondContact O-N 3.3Å; Q59-L62 PolarHBondContact O-N 2.99Å; Q59-E63 PolarHBondContact O-N 3.27Å; Q59-E63 VanDerWaalsContact O-N 3.11Å
60	R	98.2	Very high	97	Very high	167 Å²	167	102.5 Å²	102.5	63%	0.63	50%	0.503	S	S	*	.	H	α-helix	trans	-66.6	-47.3	176.4	-169.6	-174.4	-57.4	141.6	4.6	111.5	A56 G57 V58 L62 E63 D64	A56-R60 PolarHBondContact O-N 3.46Å; A56-R60 VanDerWaalsContact O-N 3.16Å; G57-R60 WeakPolarHBondContact O-CB 3.42Å; G57-R60 PolarHBondContact O-N 2.96Å; G57-R60 VanDerWaalsContact O-N 3.09Å; V58-R60 VanDerWaalsContact C-N 3.3Å; V58-R60 PolarHBondContact O-N 3.44Å; R60-L62 VanDerWaalsContact C-N 3.25Å; R60-L62 PolarHBondContact O-N 3.41Å; R60-E63 PolarHBondContact O-N 3.34Å; R60-E63 VanDerWaalsContact O-N 3.17Å; R60-D64 PolarHBondContact O-N 3.26Å
61	E	98.2	Very high	97.4	Very high	135 Å²	135	103.1 Å²	103.1	63%	0.631	50%	0.503	S	S	*	.	H	α-helix	trans	-58.8	-39.1	176.9	-71	172.3	-170.7	0	0	111.7	G57 V58 D64 F65	G57-E61 PolarHBondContact O-N 3.35Å; V58-E61 PolarHBondContact O-N 2.96Å; E61-D64 PolarHBondContact O-N 3.45Å; E61-F65 VanDerWaalsContact O-CB 3.28Å; E61-F65 WeakPolarHBondContact O-CB 3.34Å; E61-F65 PolarHBondContact O-N 2.79Å
62	L	98.3	Very high	97.6	Very high	106 Å²	106	100.9 Å²	100.9	56%	0.555	50%	0.496	S	S	*	.	H	α-helix	trans	-64.3	-42.6	176.3	-178.1	62.1	0	0	0	112.2	V58 Q59 R60 F65 K66	V58-L62 WeakPolarHBondContact O-CB 3.38Å; V58-L62 PolarHBondContact O-N 3.48Å; Q59-L62 PolarHBondContact O-N 2.99Å; R60-L62 VanDerWaalsContact C-N 3.25Å; R60-L62 PolarHBondContact O-N 3.41Å; L62-F65 PolarHBondContact O-N 3.47Å; L62-K66 VanDerWaalsContact O-CB 3.31Å; L62-K66 WeakPolarHBondContact O-CB 3.33Å; L62-K66 PolarHBondContact O-N 2.87Å
63	E	98.4	Very high	97.9	Very high	89 Å²	89	97.6 Å²	97.6	42%	0.416	48%	0.482	S	S	.	.	H	α-helix	trans	-67.3	-38	176.8	-73.1	-58.8	146.4	0	0	112.2	Q59 R60 K66 K67	Q59-E63 PolarHBondContact O-N 3.27Å; Q59-E63 VanDerWaalsContact O-N 3.11Å; R60-E63 PolarHBondContact O-N 3.34Å; R60-E63 VanDerWaalsContact O-N 3.17Å; E63-K66 PolarHBondContact O-N 2.99Å; E63-K66 IonicContact OE2-NZ 3.75Å; E63-K67 WeakPolarHBondContact O-CG 3.33Å; E63-K67 PolarHBondContact O-N 3.47Å
64	D	98.2	Very high	98	Very high	85 Å²	85	95.3 Å²	95.3	46%	0.455	47%	0.471	S	S	.	.	H	α-helix	trans	-68.8	-42	176.2	-69	-22.3	0	0	0	111.2	R60 E61 K66 K67 E68	R60-D64 PolarHBondContact O-N 3.26Å; E61-D64 PolarHBondContact O-N 3.45Å; D64-K66 VanDerWaalsContact C-N 3.34Å; D64-K66 PolarHBondContact O-N 2.89Å; D64-K67 PolarHBondContact O-N 2.75Å; D64-K67 IonicContact OD1-NZ 3.72Å; D64-E68 PolarHBondContact O-N 3.16Å
65	F	98.4	Very high	98.1	Very high	139 Å²	139	95.4 Å²	95.4	61%	0.61	47%	0.469	S	S	*	.	H	α-helix	trans	-59.3	-44.5	172.7	174.8	-99.5	0	0	0	111.9	E61 L62 K67 E68 T69	E61-F65 VanDerWaalsContact O-CB 3.28Å; E61-F65 WeakPolarHBondContact O-CB 3.34Å; E61-F65 PolarHBondContact O-N 2.79Å; L62-F65 PolarHBondContact O-N 3.47Å; F65-K67 VanDerWaalsContact C-N 3.35Å; F65-K67 PolarHBondContact O-N 2.93Å; F65-E68 PolarHBondContact O-N 2.96Å; F65-T69 WeakPolarHBondContact CE1-OG1 3.31Å; F65-T69 WeakPolarHBondContact CZ-OG1 3.28Å; F65-T69 WeakPolarHBondContact O-CB 3.46Å; F65-T69 PolarHBondContact O-N 3.3Å; F65-T69 PolarHBondContact O-OG1 2.85Å
66	K	98.4	Very high	98.2	Very high	108 Å²	108	98 Å²	98	47%	0.47	48%	0.479	S	S	.	.	H	α-helix	trans	-59.8	-44.6	176.8	175.9	-175	169.1	-168.1	0	111.5	L62 E63 D64 T69 L70	L62-K66 VanDerWaalsContact O-CB 3.31Å; L62-K66 WeakPolarHBondContact O-CB 3.33Å; L62-K66 PolarHBondContact O-N 2.87Å; E63-K66 PolarHBondContact O-N 2.99Å; E63-K66 IonicContact OE2-NZ 3.75Å; D64-K66 VanDerWaalsContact C-N 3.34Å; D64-K66 PolarHBondContact O-N 2.89Å; K66-T69 PolarHBondContact O-N 3.16Å; K66-L70 HydrophobicContact CG-CD1 4.16Å; K66-L70 WeakPolarHBondContact O-CB 3.46Å; K66-L70 WeakPolarHBondContact O-CG 3.39Å; K66-L70 PolarHBondContact O-N 3Å
67	K	98.5	Very high	98.3	Very high	128 Å²	128	100.6 Å²	100.6	56%	0.557	48%	0.484	S	S	*	.	H	α-helix	trans	-61.5	-47.2	176.8	-73.6	170.4	-170.8	163.1	0	111.7	E63 D64 F65 T69 L70 K71	E63-K67 WeakPolarHBondContact O-CG 3.33Å; E63-K67 PolarHBondContact O-N 3.47Å; D64-K67 PolarHBondContact O-N 2.75Å; D64-K67 IonicContact OD1-NZ 3.72Å; F65-K67 VanDerWaalsContact C-N 3.35Å; F65-K67 PolarHBondContact O-N 2.93Å; K67-T69 VanDerWaalsContact C-N 3.33Å; K67-T69 PolarHBondContact O-N 3.5Å; K67-L70 PolarHBondContact O-N 2.97Å; K67-K71 WeakPolarHBondContact O-CB 3.4Å; K67-K71 PolarHBondContact O-N 3.29Å
68	E	98.5	Very high	98.4	Very high	105 Å²	105	104.2 Å²	104.2	49%	0.491	50%	0.499	S	S	.	.	H	α-helix	trans	-67.4	-37	-178.7	-166.7	59	-148.9	0	0	111.8	D64 F65 K71 S72	D64-E68 PolarHBondContact O-N 3.16Å; F65-E68 PolarHBondContact O-N 2.96Å; E68-K71 PolarHBondContact O-N 2.89Å; E68-S72 WeakPolarHBondContact O-CB 3.49Å; E68-S72 PolarHBondContact O-N 2.86Å; E68-S72 PolarHBondContact O-OG 3.08Å
69	T	98.6	Very high	98.4	Very high	50 Å²	50	102.7 Å²	102.7	31%	0.307	49%	0.492	S	S	.	.	H	α-helix	trans	-63.7	-47	174.8	-58.1	0	0	0	0	111	F65 K66 K67 K71 S72 I73	F65-T69 WeakPolarHBondContact CE1-OG1 3.31Å; F65-T69 WeakPolarHBondContact CZ-OG1 3.28Å; F65-T69 WeakPolarHBondContact O-CB 3.46Å; F65-T69 PolarHBondContact O-N 3.3Å; F65-T69 PolarHBondContact O-OG1 2.85Å; K66-T69 PolarHBondContact O-N 3.16Å; K67-T69 VanDerWaalsContact C-N 3.33Å; K67-T69 PolarHBondContact O-N 3.5Å; T69-K71 VanDerWaalsContact C-N 3.32Å; T69-K71 PolarHBondContact O-N 3.19Å; T69-S72 WeakPolarHBondContact O-CB 3.43Å; T69-S72 PolarHBondContact O-N 3.34Å; T69-I73 HydrophobicContact CG2-CD1 4.01Å; T69-I73 VanDerWaalsContact O-CG1 3.31Å; T69-I73 WeakPolarHBondContact O-CG1 3.48Å; T69-I73 PolarHBondContact O-N 3.08Å
70	L	98.7	Very high	98.5	Very high	84 Å²	84	103.2 Å²	103.2	44%	0.44	49%	0.493	S	S	.	.	H	α-helix	trans	-61.4	-42.1	177.3	-76.4	170.8	0	0	0	111.9	K66 K67 S72 I73 H74	K66-L70 HydrophobicContact CG-CD1 4.16Å; K66-L70 WeakPolarHBondContact O-CB 3.46Å; K66-L70 WeakPolarHBondContact O-CG 3.39Å; K66-L70 PolarHBondContact O-N 3Å; K67-L70 PolarHBondContact O-N 2.97Å; L70-S72 VanDerWaalsContact C-N 3.32Å; L70-S72 PolarHBondContact O-N 3.14Å; L70-I73 PolarHBondContact O-N 3.36Å; L70-H74 PolarHBondContact O-CD2 3.41Å; L70-H74 VanDerWaalsContact O-CD2 3.3Å; L70-H74 PolarHBondContact O-N 2.9Å
71	K	98.6	Very high	98.5	Very high	97 Å²	97	99.3 Å²	99.3	42%	0.422	49%	0.49	S	S	.	.	H	α-helix	trans	-60.5	-44	175.4	-169.5	-170	-177.1	-163.3	0	111.5	K67 E68 T69 I73 H74 Y75	K67-K71 WeakPolarHBondContact O-CB 3.4Å; K67-K71 PolarHBondContact O-N 3.29Å; E68-K71 PolarHBondContact O-N 2.89Å; T69-K71 VanDerWaalsContact C-N 3.32Å; T69-K71 PolarHBondContact O-N 3.19Å; K71-I73 VanDerWaalsContact C-N 3.35Å; K71-H74 PolarHBondContact O-N 2.74Å; K71-Y75 HydrophobicContact CD-CE2 4.03Å; K71-Y75 WeakPolarHBondContact CE-OH 3.48Å; K71-Y75 HydrophobicContact CG-CD2 4.15Å; K71-Y75 HydrophobicContact CG-CE2 3.62Å; K71-Y75 WeakPolarHBondContact O-CD2 3.31Å; K71-Y75 PolarHBondContact O-N 3.09Å; K71-Y75 VanDerWaalsContact O-N 3.09Å
72	S	98.6	Very high	98.5	Very high	53 Å²	53	99.8 Å²	99.8	37%	0.371	49%	0.492	S	S	.	.	H	α-helix	trans	-63.7	-39.9	177	-59.8	0	0	0	0	112.2	E68 T69 L70 Y75 L76	E68-S72 WeakPolarHBondContact O-CB 3.49Å; E68-S72 PolarHBondContact O-N 2.86Å; E68-S72 PolarHBondContact O-OG 3.08Å; T69-S72 WeakPolarHBondContact O-CB 3.43Å; T69-S72 PolarHBondContact O-N 3.34Å; L70-S72 VanDerWaalsContact C-N 3.32Å; L70-S72 PolarHBondContact O-N 3.14Å; S72-Y75 PolarHBondContact O-N 3.33Å; S72-L76 PolarHBondContact O-N 2.91Å; S72-L76 VanDerWaalsContact O-N 3.08Å
73	I	98.6	Very high	98.5	Very high	74 Å²	74	100.6 Å²	100.6	38%	0.379	50%	0.495	S	S	.	.	H	α-helix	trans	-61	-47.3	175	-70.5	166.9	0	0	0	110.2	T69 L70 K71 Y75 L76 E77	T69-I73 HydrophobicContact CG2-CD1 4.01Å; T69-I73 VanDerWaalsContact O-CG1 3.31Å; T69-I73 WeakPolarHBondContact O-CG1 3.48Å; T69-I73 PolarHBondContact O-N 3.08Å; L70-I73 PolarHBondContact O-N 3.36Å; K71-I73 VanDerWaalsContact C-N 3.35Å; I73-Y75 PolarHBondContact O-N 2.89Å; I73-L76 CarbonylContact O-C 3.6Å; I73-L76 WeakPolarHBondContact O-CA 3.33Å; I73-L76 WeakPolarHBondContact O-CB 3.32Å; I73-L76 PolarHBondContact O-N 2.84Å; I73-L76 VanDerWaalsContact O-N 3.08Å; I73-E77 HydrophobicContact CG2-CG 4.26Å; I73-E77 WeakPolarHBondContact O-CG 3.41Å; I73-E77 PolarHBondContact O-N 3.33Å
74	H	98.7	Very high	98.5	Very high	101 Å²	101	100 Å²	100	47%	0.468	49%	0.494	S	S	.	.	H	α-helix	trans	-61.1	-41.9	178.4	-72.5	-42.8	0	0	0	112.8	L70 K71 L76 E77 D78	L70-H74 PolarHBondContact O-CD2 3.41Å; L70-H74 VanDerWaalsContact O-CD2 3.3Å; L70-H74 PolarHBondContact O-N 2.9Å; K71-H74 PolarHBondContact O-N 2.74Å; H74-L76 VanDerWaalsContact C-N 3.27Å; H74-L76 PolarHBondContact O-N 2.98Å; H74-E77 IonicContact CE1-OE2 3.69Å; H74-E77 IonicContact CG-OE2 3.44Å; H74-E77 IonicContact ND1-OE2 2.89Å; H74-E77 PolarHBondContact ND1-OE2 3.41Å; H74-E77 PolarHBondContact O-N 3.07Å; H74-D78 PolarHBondContact O-N 2.97Å
75	Y	98.6	Very high	98.5	Very high	139 Å²	139	97.6 Å²	97.6	55%	0.545	49%	0.49	S	S	.	.	H	α-helix	trans	-61	-37.4	174	-74	-57.5	0	0	0	113	K71 S72 I73 S79	K71-Y75 HydrophobicContact CD-CE2 4.03Å; K71-Y75 WeakPolarHBondContact CE-OH 3.48Å; K71-Y75 HydrophobicContact CG-CD2 4.15Å; K71-Y75 HydrophobicContact CG-CE2 3.62Å; K71-Y75 WeakPolarHBondContact O-CD2 3.31Å; K71-Y75 PolarHBondContact O-N 3.09Å; K71-Y75 VanDerWaalsContact O-N 3.09Å; S72-Y75 PolarHBondContact O-N 3.33Å; I73-Y75 PolarHBondContact O-N 2.89Å; Y75-S79 WeakPolarHBondContact O-CB 3.14Å; Y75-S79 PolarHBondContact O-N 3.31Å; Y75-S79 PolarHBondContact O-OG 3.21Å
76	L	98.6	Very high	98.5	Very high	125 Å²	125	93.7 Å²	93.7	65%	0.654	48%	0.483	S	S	*	.	H	α-helix	trans	-66.3	-42.4	174.7	-100.4	146.2	0	0	0	111.8	S72 I73 H74 S79 F80	S72-L76 PolarHBondContact O-N 2.91Å; S72-L76 VanDerWaalsContact O-N 3.08Å; I73-L76 CarbonylContact O-C 3.6Å; I73-L76 WeakPolarHBondContact O-CA 3.33Å; I73-L76 WeakPolarHBondContact O-CB 3.32Å; I73-L76 PolarHBondContact O-N 2.84Å; I73-L76 VanDerWaalsContact O-N 3.08Å; H74-L76 VanDerWaalsContact C-N 3.27Å; H74-L76 PolarHBondContact O-N 2.98Å; L76-S79 PolarHBondContact O-N 3.08Å; L76-F80 VanDerWaalsContact O-CB 3.25Å; L76-F80 WeakPolarHBondContact O-CB 3.45Å; L76-F80 PolarHBondContact O-N 3.41Å
77	E	98.6	Very high	98.5	Very high	97 Å²	97	92.3 Å²	92.3	45%	0.453	48%	0.481	S	S	.	.	H	α-helix	trans	-61.9	-46.5	176	-71.7	173.1	156.6	0	0	111.4	I73 H74 F80 C81	I73-E77 HydrophobicContact CG2-CG 4.26Å; I73-E77 WeakPolarHBondContact O-CG 3.41Å; I73-E77 PolarHBondContact O-N 3.33Å; H74-E77 IonicContact CE1-OE2 3.69Å; H74-E77 IonicContact CG-OE2 3.44Å; H74-E77 IonicContact ND1-OE2 2.89Å; H74-E77 PolarHBondContact ND1-OE2 3.41Å; H74-E77 PolarHBondContact O-N 3.07Å; E77-F80 PolarHBondContact O-N 3.22Å; E77-C81 PolarHBondContact O-N 3.46Å; E77-C81 PolarHBondContact O-SG 3.39Å
78	D	98.4	Very high	98.5	Very high	96 Å²	96	89.2 Å²	89.2	51%	0.513	47%	0.472	S	S	.	.	H	α-helix	trans	-61.9	-48.6	177.8	-70.6	-21.2	0	0	0	110.8	H74 F80 C81 E82	H74-D78 PolarHBondContact O-N 2.97Å; D78-F80 VanDerWaalsContact C-N 3.29Å; D78-F80 PolarHBondContact O-N 3.29Å; D78-C81 WeakPolarHBondContact O-CB 3.25Å; D78-C81 PolarHBondContact O-N 3.21Å; D78-C81 VanDerWaalsContact O-N 3.14Å; D78-E82 PolarHBondContact O-N 2.93Å
79	S	98.4	Very high	98.5	Very high	58 Å²	58	90.2 Å²	90.2	41%	0.406	48%	0.477	S	S	.	.	H	α-helix	trans	-60.7	-39.9	177.2	-57.7	0	0	0	0	111.8	Y75 L76 E82 M83	Y75-S79 WeakPolarHBondContact O-CB 3.14Å; Y75-S79 PolarHBondContact O-N 3.31Å; Y75-S79 PolarHBondContact O-OG 3.21Å; L76-S79 PolarHBondContact O-N 3.08Å; S79-E82 PolarHBondContact O-N 2.87Å; S79-M83 WeakPolarHBondContact O-CB 3.38Å; S79-M83 WeakPolarHBondContact O-CG 3.25Å; S79-M83 PolarHBondContact O-N 2.98Å
80	F	98.4	Very high	98.5	Very high	132 Å²	132	93.8 Å²	93.8	58%	0.579	49%	0.49	S	S	*	.	H	α-helix	trans	-64.3	-42.7	175.7	177.5	-97	0	0	0	111.5	L76 E77 D78 E82 M83 N84	L76-F80 VanDerWaalsContact O-CB 3.25Å; L76-F80 WeakPolarHBondContact O-CB 3.45Å; L76-F80 PolarHBondContact O-N 3.41Å; E77-F80 PolarHBondContact O-N 3.22Å; D78-F80 VanDerWaalsContact C-N 3.29Å; D78-F80 PolarHBondContact O-N 3.29Å; F80-E82 PolarHBondContact O-N 3.4Å; F80-M83 PolarHBondContact O-N 3.49Å; F80-N84 VanDerWaalsContact O-CB 3.25Å; F80-N84 WeakPolarHBondContact O-CB 3.34Å; F80-N84 PolarHBondContact O-N 3.44Å
81	C	98.3	Very high	98.4	Very high	85 Å²	85	95.5 Å²	95.5	57%	0.574	50%	0.496	S	S	*	.	H	α-helix	trans	-60.5	-44.7	176	-68.7	0	0	0	0	111.7	E77 D78 N84 G85	E77-C81 PolarHBondContact O-N 3.46Å; E77-C81 PolarHBondContact O-SG 3.39Å; D78-C81 WeakPolarHBondContact O-CB 3.25Å; D78-C81 PolarHBondContact O-N 3.21Å; D78-C81 VanDerWaalsContact O-N 3.14Å; C81-N84 PolarHBondContact O-N 2.87Å; C81-G85 PolarHBondContact O-N 3.29Å
82	E	98.3	Very high	98.4	Very high	144 Å²	144	95.8 Å²	95.8	67%	0.673	50%	0.499	S	S	*	.	H	α-helix	trans	-61.7	-48.7	176.6	-71.4	-177.5	177.2	0	0	112	D78 S79 F80 N84 G85 A86	D78-E82 PolarHBondContact O-N 2.93Å; S79-E82 PolarHBondContact O-N 2.87Å; F80-E82 PolarHBondContact O-N 3.4Å; E82-N84 VanDerWaalsContact C-N 3.31Å; E82-N84 PolarHBondContact O-N 2.91Å; E82-G85 PolarHBondContact O-N 3.44Å; E82-A86 PolarHBondContact O-N 3.4Å
83	M	98.3	Very high	98.4	Very high	123 Å²	123	99.5 Å²	99.5	61%	0.606	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-41.6	177.2	-74.4	-171.6	-64.8	0	0	111.8	S79 F80 G85 A86 L87	S79-M83 WeakPolarHBondContact O-CB 3.38Å; S79-M83 WeakPolarHBondContact O-CG 3.25Å; S79-M83 PolarHBondContact O-N 2.98Å; F80-M83 PolarHBondContact O-N 3.49Å; M83-G85 VanDerWaalsContact C-N 3.34Å; M83-A86 PolarHBondContact O-N 3.11Å; M83-L87 WeakPolarHBondContact O-CB 3.48Å; M83-L87 PolarHBondContact O-N 2.97Å
84	N	98.4	Very high	98.4	Very high	77 Å²	77	97.6 Å²	97.6	41%	0.412	51%	0.505	S	S	.	.	H	α-helix	trans	-66	-38.9	178.2	-167.8	61.7	0	0	0	111.4	F80 C81 E82 L87 V88	F80-N84 VanDerWaalsContact O-CB 3.25Å; F80-N84 WeakPolarHBondContact O-CB 3.34Å; F80-N84 PolarHBondContact O-N 3.44Å; C81-N84 PolarHBondContact O-N 2.87Å; E82-N84 VanDerWaalsContact C-N 3.31Å; E82-N84 PolarHBondContact O-N 2.91Å; N84-L87 PolarHBondContact O-N 3.17Å; N84-V88 WeakPolarHBondContact O-CG2 3.35Å; N84-V88 PolarHBondContact O-N 2.78Å; N84-V88 VanDerWaalsContact O-N 3.08Å
85	G	98.1	Very high	98.4	Very high	35 Å²	35	95.3 Å²	95.3	36%	0.361	50%	0.504	S	S	.	.	H	α-helix	trans	-60.2	-44.7	172.2	0	0	0	0	0	112.6	C81 E82 M83 V88 Q89	C81-G85 PolarHBondContact O-N 3.29Å; E82-G85 PolarHBondContact O-N 3.44Å; M83-G85 VanDerWaalsContact C-N 3.34Å; G85-V88 PolarHBondContact O-N 3.05Å; G85-Q89 WeakPolarHBondContact O-CG 3.46Å; G85-Q89 PolarHBondContact O-N 3.04Å
86	A	98.4	Very high	98.4	Very high	56 Å²	56	96.4 Å²	96.4	46%	0.463	51%	0.507	S	S	.	.	H	α-helix	trans	-64.1	-39.4	175.9	0	0	0	0	0	112.4	E82 M83 Q89 Q90	E82-A86 PolarHBondContact O-N 3.4Å; M83-A86 PolarHBondContact O-N 3.11Å; A86-Q89 PolarHBondContact O-N 3.26Å; A86-Q90 PolarHBondContact O-N 3.5Å
87	L	98.6	Very high	98.4	Very high	80 Å²	80	94.1 Å²	94.1	42%	0.419	50%	0.498	S	S	.	.	H	α-helix	trans	-60.5	-47.6	177.2	-179.6	62.7	0	0	0	111.5	M83 N84 Q89 Q90 E91	M83-L87 WeakPolarHBondContact O-CB 3.48Å; M83-L87 PolarHBondContact O-N 2.97Å; N84-L87 PolarHBondContact O-N 3.17Å; L87-Q89 VanDerWaalsContact C-N 3.32Å; L87-Q89 PolarHBondContact O-N 2.93Å; L87-Q90 WeakPolarHBondContact O-CB 3.43Å; L87-Q90 PolarHBondContact O-N 2.82Å; L87-Q90 VanDerWaalsContact O-N 3.11Å; L87-E91 WeakPolarHBondContact O-CG 3.44Å; L87-E91 PolarHBondContact O-N 3.39Å
88	V	98.5	Very high	98.4	Very high	63 Å²	63	97.3 Å²	97.3	38%	0.382	51%	0.506	S	S	.	.	H	α-helix	trans	-59.3	-43.9	177.6	172.3	0	0	0	0	111.1	N84 G85 Q90 E91 E92	N84-V88 WeakPolarHBondContact O-CG2 3.35Å; N84-V88 PolarHBondContact O-N 2.78Å; N84-V88 VanDerWaalsContact O-N 3.08Å; G85-V88 PolarHBondContact O-N 3.05Å; V88-Q90 VanDerWaalsContact C-N 3.31Å; V88-Q90 PolarHBondContact O-N 3.07Å; V88-E91 PolarHBondContact O-N 3.33Å; V88-E92 PolarHBondContact O-N 3.48Å
89	Q	98.4	Very high	98.4	Very high	126 Å²	126	97 Å²	97	59%	0.589	50%	0.502	S	S	*	.	H	α-helix	trans	-61.5	-40.1	176.3	-69.7	179.9	4.1	0	0	112.2	G85 A86 L87 E92 Q93	G85-Q89 WeakPolarHBondContact O-CG 3.46Å; G85-Q89 PolarHBondContact O-N 3.04Å; A86-Q89 PolarHBondContact O-N 3.26Å; L87-Q89 VanDerWaalsContact C-N 3.32Å; L87-Q89 PolarHBondContact O-N 2.93Å; Q89-E92 PolarHBondContact O-N 2.88Å; Q89-Q93 WeakPolarHBondContact O-CG 3.42Å; Q89-Q93 PolarHBondContact O-N 2.89Å
90	Q	98.3	Very high	98.4	Very high	124 Å²	124	101.5 Å²	101.5	58%	0.579	51%	0.51	S	S	*	.	H	α-helix	trans	-65	-40.9	177.1	-171.6	-176.6	5.2	0	0	111.7	A86 L87 V88 Q93 A94	A86-Q90 PolarHBondContact O-N 3.5Å; L87-Q90 WeakPolarHBondContact O-CB 3.43Å; L87-Q90 PolarHBondContact O-N 2.82Å; L87-Q90 VanDerWaalsContact O-N 3.11Å; V88-Q90 VanDerWaalsContact C-N 3.31Å; V88-Q90 PolarHBondContact O-N 3.07Å; Q90-Q93 PolarHBondContact O-N 3.45Å; Q90-A94 WeakPolarHBondContact O-CB 3.31Å; Q90-A94 PolarHBondContact O-N 3.32Å
91	E	98.4	Very high	98.4	Very high	120 Å²	120	100 Å²	100	56%	0.561	51%	0.508	S	S	*	.	H	α-helix	trans	-62.7	-43.1	176.8	-72.4	-177.2	160.6	0	0	111.9	L87 V88 Q93 A94 A95	L87-E91 WeakPolarHBondContact O-CG 3.44Å; L87-E91 PolarHBondContact O-N 3.39Å; V88-E91 PolarHBondContact O-N 3.33Å; E91-Q93 PolarHBondContact O-N 2.95Å; E91-A94 PolarHBondContact O-N 3.34Å; E91-A95 WeakPolarHBondContact O-CB 3.36Å; E91-A95 PolarHBondContact O-N 3.49Å
92	E	98.4	Very high	98.4	Very high	104 Å²	104	103.1 Å²	103.1	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-61.1	-44.7	174.3	-72.7	-173.6	-171.3	0	0	112	V88 Q89 A95 R96	V88-E92 PolarHBondContact O-N 3.48Å; Q89-E92 PolarHBondContact O-N 2.88Å; E92-A95 PolarHBondContact O-N 3.25Å; E92-R96 VanDerWaalsContact O-CG 3.31Å; E92-R96 WeakPolarHBondContact O-CG 3.36Å; E92-R96 PolarHBondContact O-N 3.42Å; E92-R96 IonicContact OE2-NH2 3.94Å
93	Q	98.3	Very high	98.4	Very high	130 Å²	130	100.1 Å²	100.1	61%	0.607	49%	0.493	S	S	*	.	H	α-helix	trans	-62.5	-43.7	176.8	-72.9	-178.3	3.3	0	0	111.5	Q89 Q90 E91 A95 R96 V97	Q89-Q93 WeakPolarHBondContact O-CG 3.42Å; Q89-Q93 PolarHBondContact O-N 2.89Å; Q90-Q93 PolarHBondContact O-N 3.45Å; E91-Q93 PolarHBondContact O-N 2.95Å; Q93-A95 VanDerWaalsContact C-N 3.32Å; Q93-A95 PolarHBondContact O-N 2.99Å; Q93-R96 PolarHBondContact O-N 2.93Å; Q93-V97 WeakPolarHBondContact O-CG2 3.44Å; Q93-V97 PolarHBondContact O-N 3.32Å
94	A	98.4	Very high	98.4	Very high	34 Å²	34	98.9 Å²	98.9	28%	0.281	49%	0.486	S	S	.	.	H	α-helix	trans	-61.6	-41.4	176.7	0	0	0	0	0	111.4	Q90 E91 V97 R98	Q90-A94 WeakPolarHBondContact O-CB 3.31Å; Q90-A94 PolarHBondContact O-N 3.32Å; E91-A94 PolarHBondContact O-N 3.34Å; A94-V97 PolarHBondContact O-N 3.13Å; A94-R98 WeakPolarHBondContact O-CB 3.49Å; A94-R98 VanDerWaalsContact O-CG 3.28Å; A94-R98 WeakPolarHBondContact O-CG 3.46Å; A94-R98 PolarHBondContact O-N 3.22Å
95	A	98.4	Very high	98.4	Very high	54 Å²	54	100.3 Å²	100.3	45%	0.446	49%	0.49	S	S	.	.	H	α-helix	trans	-61.5	-44.6	175.1	0	0	0	0	0	111.8	E91 E92 Q93 V97 R98 Q99	E91-A95 WeakPolarHBondContact O-CB 3.36Å; E91-A95 PolarHBondContact O-N 3.49Å; E92-A95 PolarHBondContact O-N 3.25Å; Q93-A95 VanDerWaalsContact C-N 3.32Å; Q93-A95 PolarHBondContact O-N 2.99Å; A95-V97 PolarHBondContact O-N 2.86Å; A95-R98 PolarHBondContact O-N 2.94Å; A95-Q99 PolarHBondContact O-N 3.31Å
96	R	98.4	Very high	98.4	Very high	162 Å²	162	103.3 Å²	103.3	61%	0.611	50%	0.498	S	S	*	.	H	α-helix	trans	-62	-42.4	176.2	-68.4	172.1	-165.2	-126.2	7.8	112.3	E92 Q93 Q99 R100	E92-R96 VanDerWaalsContact O-CG 3.31Å; E92-R96 WeakPolarHBondContact O-CG 3.36Å; E92-R96 PolarHBondContact O-N 3.42Å; E92-R96 IonicContact OE2-NH2 3.94Å; Q93-R96 PolarHBondContact O-N 2.93Å; R96-Q99 PolarHBondContact O-N 3.41Å; R96-R100 WeakPolarHBondContact O-CG 3.49Å; R96-R100 PolarHBondContact O-N 3.09Å; R96-R100 VanDerWaalsContact O-N 3.09Å
97	V	98.6	Very high	98.3	Very high	77 Å²	77	107.7 Å²	107.7	47%	0.467	50%	0.502	S	S	.	.	H	α-helix	trans	-63.7	-46.7	176.7	171.6	0	0	0	0	110.8	Q93 A94 A95 Q99 R100 L101	Q93-V97 WeakPolarHBondContact O-CG2 3.44Å; Q93-V97 PolarHBondContact O-N 3.32Å; A94-V97 PolarHBondContact O-N 3.13Å; A95-V97 PolarHBondContact O-N 2.86Å; V97-Q99 VanDerWaalsContact C-N 3.28Å; V97-Q99 PolarHBondContact O-N 3.16Å; V97-R100 PolarHBondContact O-N 2.93Å; V97-L101 PolarHBondContact O-N 3.37Å
98	R	98.5	Very high	98.3	Very high	163 Å²	163	105.6 Å²	105.6	62%	0.615	50%	0.5	S	S	*	.	H	α-helix	trans	-58.7	-41	177	-73.9	173.5	-174.4	149.3	1.6	111.8	A94 A95 L101 R102	A94-R98 WeakPolarHBondContact O-CB 3.49Å; A94-R98 VanDerWaalsContact O-CG 3.28Å; A94-R98 WeakPolarHBondContact O-CG 3.46Å; A94-R98 PolarHBondContact O-N 3.22Å; A95-R98 PolarHBondContact O-N 2.94Å; R98-L101 PolarHBondContact O-N 3.36Å; R98-R102 WeakPolarHBondContact O-CG 3.43Å; R98-R102 PolarHBondContact O-N 3.37Å; R98-R102 VanDerWaalsContact O-N 3.16Å
99	Q	98.4	Very high	98.3	Very high	89 Å²	89	106.6 Å²	106.6	42%	0.416	50%	0.502	S	S	.	.	H	α-helix	trans	-63.2	-47.9	177.3	-179.7	56.8	26.9	0	0	111.9	A95 R96 V97 L101 R102 E103	A95-Q99 PolarHBondContact O-N 3.31Å; R96-Q99 PolarHBondContact O-N 3.41Å; V97-Q99 VanDerWaalsContact C-N 3.28Å; V97-Q99 PolarHBondContact O-N 3.16Å; Q99-L101 VanDerWaalsContact C-N 3.29Å; Q99-L101 PolarHBondContact O-N 3.4Å; Q99-R102 WeakPolarHBondContact O-CB 3.28Å; Q99-R102 PolarHBondContact O-N 2.97Å; Q99-E103 PolarHBondContact NE2-OE1 3.44Å; Q99-E103 PolarHBondContact O-N 3.26Å; Q99-E103 VanDerWaalsContact O-N 3.13Å
100	R	98.4	Very high	98.3	Very high	153 Å²	153	104.8 Å²	104.8	58%	0.577	50%	0.5	S	S	*	.	H	α-helix	trans	-61.4	-37.3	176.9	-71.1	-172.5	-61.4	-145.8	1	112.9	R96 V97 R102 E103 E104	R96-R100 WeakPolarHBondContact O-CG 3.49Å; R96-R100 PolarHBondContact O-N 3.09Å; R96-R100 VanDerWaalsContact O-N 3.09Å; V97-R100 PolarHBondContact O-N 2.93Å; R100-R102 VanDerWaalsContact C-N 3.34Å; R100-E103 PolarHBondContact O-N 3.48Å; R100-E104 PolarHBondContact O-N 3.32Å
101	L	98.6	Very high	98.3	Very high	102 Å²	102	107 Å²	107	53%	0.534	50%	0.503	S	S	.	.	H	α-helix	trans	-62.1	-44.2	177.5	-173.7	66.4	0	0	0	111	V97 R98 Q99 E103 E104 E105	V97-L101 PolarHBondContact O-N 3.37Å; R98-L101 PolarHBondContact O-N 3.36Å; Q99-L101 VanDerWaalsContact C-N 3.29Å; Q99-L101 PolarHBondContact O-N 3.4Å; L101-E103 VanDerWaalsContact C-N 3.33Å; L101-E103 PolarHBondContact O-N 2.87Å; L101-E104 PolarHBondContact O-N 3.28Å; L101-E105 WeakPolarHBondContact O-CG 3.47Å; L101-E105 PolarHBondContact O-N 3.46Å
102	R	98.3	Very high	98.3	Very high	149 Å²	149	106.1 Å²	106.1	56%	0.562	50%	0.502	S	S	*	.	H	α-helix	trans	-60.4	-42.4	175.8	-69.2	173.7	-177.8	178	-0.9	112.1	R98 Q99 R100 E104 E105 D106	R98-R102 WeakPolarHBondContact O-CG 3.43Å; R98-R102 PolarHBondContact O-N 3.37Å; R98-R102 VanDerWaalsContact O-N 3.16Å; Q99-R102 WeakPolarHBondContact O-CB 3.28Å; Q99-R102 PolarHBondContact O-N 2.97Å; R100-R102 VanDerWaalsContact C-N 3.34Å; R102-E104 VanDerWaalsContact C-N 3.34Å; R102-E104 PolarHBondContact O-N 2.69Å; R102-E105 WeakPolarHBondContact O-CB 3.25Å; R102-E105 PolarHBondContact O-N 3.06Å; R102-D106 PolarHBondContact O-N 3.25Å
103	E	98.2	Very high	98.2	Very high	81 Å²	81	107.4 Å²	107.4	38%	0.379	51%	0.506	S	S	.	.	H	α-helix	trans	-64.1	-38.6	177.7	-70.1	168.4	-164.8	0	0	112.4	Q99 R100 L101 D106 R107	Q99-E103 PolarHBondContact NE2-OE1 3.44Å; Q99-E103 PolarHBondContact O-N 3.26Å; Q99-E103 VanDerWaalsContact O-N 3.13Å; R100-E103 PolarHBondContact O-N 3.48Å; L101-E103 VanDerWaalsContact C-N 3.33Å; L101-E103 PolarHBondContact O-N 2.87Å; E103-D106 PolarHBondContact O-N 3.02Å; E103-R107 WeakPolarHBondContact O-CB 3.49Å; E103-R107 VanDerWaalsContact O-CG 3.25Å; E103-R107 WeakPolarHBondContact O-CG 3.36Å; E103-R107 PolarHBondContact O-N 3.33Å
104	E	98.1	Very high	98.2	Very high	98 Å²	98	104.7 Å²	104.7	46%	0.458	50%	0.498	S	S	.	.	H	α-helix	trans	-69.6	-37.6	174.2	-77	-59.4	128	0	0	112.5	R100 L101 R102 R107 G108	R100-E104 PolarHBondContact O-N 3.32Å; L101-E104 PolarHBondContact O-N 3.28Å; R102-E104 VanDerWaalsContact C-N 3.34Å; R102-E104 PolarHBondContact O-N 2.69Å; E104-R107 PolarHBondContact O-N 3.46Å; E104-R107 WeakPolarHBondContact OE1-CD 3.38Å; E104-R107 IonicContact OE1-CZ 3.85Å; E104-R107 IonicContact OE1-NE 2.69Å; E104-R107 IonicContact OE1-NH1 3.57Å; E104-R107 PolarHBondContact OE1-NH1 3.02Å; E104-G108 PolarHBondContact O-N 3.43Å
105	E	98.1	Very high	98.2	Very high	107 Å²	107	106.7 Å²	106.7	50%	0.5	50%	0.504	S	S	.	.	H	α-helix	trans	-59.8	-47.3	171.3	-73.9	172.4	172.6	0	0	110.8	L101 R102 R107 G108 I109	L101-E105 WeakPolarHBondContact O-CG 3.47Å; L101-E105 PolarHBondContact O-N 3.46Å; R102-E105 WeakPolarHBondContact O-CB 3.25Å; R102-E105 PolarHBondContact O-N 3.06Å; E105-R107 PolarHBondContact O-N 2.97Å; E105-G108 CarbonylContact O-C 3.53Å; E105-G108 WeakPolarHBondContact O-CA 3.34Å; E105-G108 PolarHBondContact O-N 3.39Å; E105-G108 VanDerWaalsContact O-N 3.1Å; E105-I109 VanDerWaalsContact O-CG1 3.29Å; E105-I109 WeakPolarHBondContact O-CG1 3.41Å; E105-I109 PolarHBondContact O-N 2.91Å
106	D	98.1	Very high	98.2	Very high	98 Å²	98	108 Å²	108	52%	0.524	51%	0.507	S	S	.	.	H	α-helix	trans	-61.2	-43.1	177.3	-76.6	-26	0	0	0	111.9	R102 E103 G108 I109 V110	R102-D106 PolarHBondContact O-N 3.25Å; E103-D106 PolarHBondContact O-N 3.02Å; D106-G108 VanDerWaalsContact C-N 3.31Å; D106-G108 PolarHBondContact O-N 2.89Å; D106-I109 PolarHBondContact O-N 3.25Å; D106-V110 WeakPolarHBondContact O-CG2 3.42Å; D106-V110 PolarHBondContact O-N 3.1Å
107	R	97.9	Very high	98.1	Very high	148 Å²	148	107.1 Å²	107.1	56%	0.558	51%	0.507	S	S	*	.	H	α-helix	trans	-60.6	-42.1	172.9	-74.3	170	-179.5	-177.3	1.9	111.5	E103 E104 E105 V110 R111	E103-R107 WeakPolarHBondContact O-CB 3.49Å; E103-R107 VanDerWaalsContact O-CG 3.25Å; E103-R107 WeakPolarHBondContact O-CG 3.36Å; E103-R107 PolarHBondContact O-N 3.33Å; E104-R107 PolarHBondContact O-N 3.46Å; E104-R107 WeakPolarHBondContact OE1-CD 3.38Å; E104-R107 IonicContact OE1-CZ 3.85Å; E104-R107 IonicContact OE1-NE 2.69Å; E104-R107 IonicContact OE1-NH1 3.57Å; E104-R107 PolarHBondContact OE1-NH1 3.02Å; E105-R107 PolarHBondContact O-N 2.97Å; R107-V110 PolarHBondContact O-N 3.45Å; R107-R111 WeakPolarHBondContact O-CB 3.37Å; R107-R111 PolarHBondContact O-N 3.39Å
108	G	97.8	Very high	98.1	Very high	36 Å²	36	108 Å²	108	37%	0.371	51%	0.509	S	S	.	.	H	α-helix	trans	-60.7	-43.8	174.8	0	0	0	0	0	112.2	E104 E105 D106 R111 N112	E104-G108 PolarHBondContact O-N 3.43Å; E105-G108 CarbonylContact O-C 3.53Å; E105-G108 WeakPolarHBondContact O-CA 3.34Å; E105-G108 PolarHBondContact O-N 3.39Å; E105-G108 VanDerWaalsContact O-N 3.1Å; D106-G108 VanDerWaalsContact C-N 3.31Å; D106-G108 PolarHBondContact O-N 2.89Å; G108-R111 PolarHBondContact O-N 3.29Å; G108-N112 VanDerWaalsContact O-CB 3.26Å; G108-N112 WeakPolarHBondContact O-CB 3.49Å; G108-N112 PolarHBondContact O-N 3.39Å
109	I	98.1	Very high	98.1	Very high	83 Å²	83	105 Å²	105	43%	0.426	50%	0.504	S	S	.	.	H	α-helix	trans	-63.1	-47.7	176.7	-69.7	164.7	0	0	0	110.6	E105 D106 R111 N112 K113	E105-I109 VanDerWaalsContact O-CG1 3.29Å; E105-I109 WeakPolarHBondContact O-CG1 3.41Å; E105-I109 PolarHBondContact O-N 2.91Å; D106-I109 PolarHBondContact O-N 3.25Å; I109-R111 PolarHBondContact O-N 2.8Å; I109-N112 PolarHBondContact O-N 3.45Å; I109-K113 HydrophobicContact CG2-CD 4.17Å; I109-K113 HydrophobicContact CG2-CG 4.5Å; I109-K113 WeakPolarHBondContact O-CB 3.35Å; I109-K113 WeakPolarHBondContact O-CG 3.34Å; I109-K113 PolarHBondContact O-N 2.86Å
110	V	98.3	Very high	98.1	Very high	89 Å²	89	103.9 Å²	103.9	54%	0.539	51%	0.505	S	S	.	.	H	α-helix	trans	-61.1	-46.4	178	172.6	0	0	0	0	110.6	D106 R107 N112 K113 V114	D106-V110 WeakPolarHBondContact O-CG2 3.42Å; D106-V110 PolarHBondContact O-N 3.1Å; R107-V110 PolarHBondContact O-N 3.45Å; V110-N112 PolarHBondContact O-N 2.93Å; V110-K113 PolarHBondContact O-N 3.42Å; V110-V114 WeakPolarHBondContact O-CG2 3.29Å; V110-V114 PolarHBondContact O-N 2.85Å
111	R	98	Very high	98	Very high	171 Å²	171	104.7 Å²	104.7	65%	0.645	51%	0.508	S	S	*	.	H	α-helix	trans	-58.8	-47.1	176	-174.5	-172.2	-61.8	172.3	3.1	111.5	R107 G108 I109 V114 L115	R107-R111 WeakPolarHBondContact O-CB 3.37Å; R107-R111 PolarHBondContact O-N 3.39Å; G108-R111 PolarHBondContact O-N 3.29Å; I109-R111 PolarHBondContact O-N 2.8Å; R111-V114 PolarHBondContact O-N 3.26Å; R111-L115 HydrophobicContact CG-CD1 3.94Å; R111-L115 HydrophobicContact CG-CG 4.38Å; R111-L115 WeakPolarHBondContact O-CB 3.06Å; R111-L115 WeakPolarHBondContact O-CG 3.45Å; R111-L115 PolarHBondContact O-N 2.81Å
112	N	98.1	Very high	98	Very high	100 Å²	100	103.9 Å²	103.9	54%	0.535	50%	0.501	S	S	.	.	H	α-helix	trans	-62	-44.8	179.4	-173	-19.7	0	0	0	111.1	G108 I109 V110 V114 L115 T116	G108-N112 VanDerWaalsContact O-CB 3.26Å; G108-N112 WeakPolarHBondContact O-CB 3.49Å; G108-N112 PolarHBondContact O-N 3.39Å; I109-N112 PolarHBondContact O-N 3.45Å; V110-N112 PolarHBondContact O-N 2.93Å; N112-V114 VanDerWaalsContact C-N 3.34Å; N112-V114 PolarHBondContact O-N 2.89Å; N112-L115 PolarHBondContact O-N 2.85Å; N112-T116 WeakPolarHBondContact O-CB 3.15Å; N112-T116 PolarHBondContact O-N 3.36Å; N112-T116 PolarHBondContact O-OG1 3.23Å; N112-T116 PolarHBondContact OD1-OG1 3.11Å; N112-T116 VanDerWaalsContact OD1-OG1 3.13Å
113	K	98.1	Very high	98	Very high	131 Å²	131	102.9 Å²	102.9	57%	0.57	50%	0.501	S	S	*	.	H	α-helix	trans	-55.3	-49.9	174.6	-77.1	176.9	178	179.1	0	111.1	I109 V110 T116 F117	I109-K113 HydrophobicContact CG2-CD 4.17Å; I109-K113 HydrophobicContact CG2-CG 4.5Å; I109-K113 WeakPolarHBondContact O-CB 3.35Å; I109-K113 WeakPolarHBondContact O-CG 3.34Å; I109-K113 PolarHBondContact O-N 2.86Å; V110-K113 PolarHBondContact O-N 3.42Å; K113-T116 WeakPolarHBondContact O-CB 3.47Å; K113-T116 PolarHBondContact O-N 3.31Å; K113-F117 WeakPolarHBondContact O-CD2 3.48Å; K113-F117 PolarHBondContact O-N 3.5Å
114	V	98.3	Very high	98	Very high	74 Å²	74	104.8 Å²	104.8	45%	0.448	51%	0.51	S	S	.	.	H	α-helix	trans	-60.9	-48.2	178.3	172.4	0	0	0	0	111.5	V110 R111 N112 T116 F117 L118	V110-V114 WeakPolarHBondContact O-CG2 3.29Å; V110-V114 PolarHBondContact O-N 2.85Å; R111-V114 PolarHBondContact O-N 3.26Å; N112-V114 VanDerWaalsContact C-N 3.34Å; N112-V114 PolarHBondContact O-N 2.89Å; V114-T116 VanDerWaalsContact C-N 3.31Å; V114-T116 PolarHBondContact O-N 2.99Å; V114-F117 PolarHBondContact O-N 3.13Å; V114-F117 VanDerWaalsContact O-N 3.11Å; V114-L118 HydrophobicContact CG1-CD1 3.57Å; V114-L118 HydrophobicContact CG1-CG 4.14Å; V114-L118 WeakPolarHBondContact O-CG 3.29Å; V114-L118 PolarHBondContact O-N 3.39Å
115	L	98.1	Very high	98	Very high	75 Å²	75	105.5 Å²	105.5	39%	0.393	52%	0.516	S	S	.	.	H	α-helix	trans	-62.2	-38	179.6	-73.1	175.3	0	0	0	112.5	R111 N112 F117 L118 L119	R111-L115 HydrophobicContact CG-CD1 3.94Å; R111-L115 HydrophobicContact CG-CG 4.38Å; R111-L115 WeakPolarHBondContact O-CB 3.06Å; R111-L115 WeakPolarHBondContact O-CG 3.45Å; R111-L115 PolarHBondContact O-N 2.81Å; N112-L115 PolarHBondContact O-N 2.85Å; L115-F117 PolarHBondContact O-N 2.84Å; L115-L118 PolarHBondContact O-N 2.94Å; L115-L119 HydrophobicContact CB-CD1 4.01Å; L115-L119 HydrophobicContact CB-CG 4.31Å; L115-L119 HydrophobicContact CD2-CD1 4.45Å; L115-L119 HydrophobicContact CD2-CD2 4.49Å; L115-L119 HydrophobicContact CD2-CG 4.28Å; L115-L119 VanDerWaalsContact O-CB 3.29Å; L115-L119 WeakPolarHBondContact O-CB 3.28Å; L115-L119 VanDerWaalsContact O-CG 3.28Å; L115-L119 WeakPolarHBondContact O-CG 3.26Å; L115-L119 PolarHBondContact O-N 3.25Å
116	T	97.8	Very high	98	Very high	83 Å²	83	108.7 Å²	108.7	51%	0.509	52%	0.524	S	S	.	.	H	α-helix	trans	-57.6	-33.3	175.7	-63	0	0	0	0	111.8	N112 K113 V114 P120	N112-T116 WeakPolarHBondContact O-CB 3.15Å; N112-T116 PolarHBondContact O-N 3.36Å; N112-T116 PolarHBondContact O-OG1 3.23Å; N112-T116 PolarHBondContact OD1-OG1 3.11Å; N112-T116 VanDerWaalsContact OD1-OG1 3.13Å; K113-T116 WeakPolarHBondContact O-CB 3.47Å; K113-T116 PolarHBondContact O-N 3.31Å; V114-T116 VanDerWaalsContact C-N 3.31Å; V114-T116 PolarHBondContact O-N 2.99Å; T116-P120 WeakPolarHBondContact O-CD 3.36Å; T116-P120 VanDerWaalsContact O-CG 3.32Å; T116-P120 WeakPolarHBondContact O-CG 3.32Å
117	F	96.9	Very high	98	Very high	143 Å²	143	107.9 Å²	107.9	63%	0.627	52%	0.517	S	S	*	.	H	α-helix	trans	-84.3	-39.3	175.3	-70.6	-71.6	0	0	0	113.9	K113 V114 L115	K113-F117 WeakPolarHBondContact O-CD2 3.48Å; K113-F117 PolarHBondContact O-N 3.5Å; V114-F117 PolarHBondContact O-N 3.13Å; V114-F117 VanDerWaalsContact O-N 3.11Å; L115-F117 PolarHBondContact O-N 2.84Å
118	L	98.1	Very high	98	Very high	95 Å²	95	105.8 Å²	105.8	50%	0.497	51%	0.513	S	S	.	.	H	α-helix	trans	-80.7	-40.3	-172.9	-66.8	-178.3	0	0	0	113.1	V114 L115 R121 E122	V114-L118 HydrophobicContact CG1-CD1 3.57Å; V114-L118 HydrophobicContact CG1-CG 4.14Å; V114-L118 WeakPolarHBondContact O-CG 3.29Å; V114-L118 PolarHBondContact O-N 3.39Å; L115-L118 PolarHBondContact O-N 2.94Å; L118-R121 PolarHBondContact O-N 3.18Å; L118-E122 PolarHBondContact O-N 2.89Å
119	L	98.1	Very high	98	Very high	100 Å²	100	107.4 Å²	107.4	52%	0.524	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-44.1	-175.2	-69.4	173.2	0	0	0	113.2	L115 R121 E122 K123	L115-L119 HydrophobicContact CB-CD1 4.01Å; L115-L119 HydrophobicContact CB-CG 4.31Å; L115-L119 HydrophobicContact CD2-CD1 4.45Å; L115-L119 HydrophobicContact CD2-CD2 4.49Å; L115-L119 HydrophobicContact CD2-CG 4.28Å; L115-L119 VanDerWaalsContact O-CB 3.29Å; L115-L119 WeakPolarHBondContact O-CB 3.28Å; L115-L119 VanDerWaalsContact O-CG 3.28Å; L115-L119 WeakPolarHBondContact O-CG 3.26Å; L115-L119 PolarHBondContact O-N 3.25Å; L119-R121 VanDerWaalsContact C-N 3.29Å; L119-R121 PolarHBondContact O-N 3.37Å; L119-E122 PolarHBondContact O-N 3.01Å; L119-K123 WeakPolarHBondContact O-CB 3.42Å; L119-K123 PolarHBondContact O-N 3.45Å
120	P	98.2	Very high	97.9	Very high	66 Å²	66	109.6 Å²	109.6	43%	0.429	53%	0.525	S	S	.	.	H	α-helix	trans	-62.4	-37.2	176.7	-24.1	35.7	0	0	0	112.8	T116 K123 Q124	T116-P120 WeakPolarHBondContact O-CD 3.36Å; T116-P120 VanDerWaalsContact O-CG 3.32Å; T116-P120 WeakPolarHBondContact O-CG 3.32Å; P120-K123 PolarHBondContact O-N 3.36Å; P120-Q124 WeakPolarHBondContact O-CG 3.32Å; P120-Q124 PolarHBondContact O-N 2.93Å
121	R	97.3	Very high	97.9	Very high	170 Å²	170	111.4 Å²	111.4	64%	0.642	52%	0.522	S	S	*	.	H	α-helix	trans	-70.8	-42.5	-180	-68.5	-180	176.2	-176.5	0.1	112	L118 L119 K123 Q124 L125	L118-R121 PolarHBondContact O-N 3.18Å; L119-R121 VanDerWaalsContact C-N 3.29Å; L119-R121 PolarHBondContact O-N 3.37Å; R121-K123 VanDerWaalsContact C-N 3.32Å; R121-Q124 PolarHBondContact O-N 2.97Å; R121-L125 WeakPolarHBondContact O-CB 3.41Å; R121-L125 PolarHBondContact O-N 3.48Å
122	E	98.1	Very high	97.8	Very high	84 Å²	84	108.1 Å²	108.1	39%	0.393	52%	0.516	S	S	.	.	H	α-helix	trans	-60.2	-45	174	-174.9	-81.3	159.4	0	0	110.6	L118 L119 Q124 L125 R126	L118-E122 PolarHBondContact O-N 2.89Å; L119-E122 PolarHBondContact O-N 3.01Å; E122-Q124 PolarHBondContact O-N 2.73Å; E122-L125 PolarHBondContact O-N 2.89Å; E122-R126 WeakPolarHBondContact O-CB 3.43Å; E122-R126 PolarHBondContact O-N 3.24Å; E122-R126 IonicContact OE1-CZ 3.82Å; E122-R126 VanDerWaalsContact OE1-CZ 3.25Å; E122-R126 IonicContact OE1-NE 2.73Å; E122-R126 PolarHBondContact OE1-NE 3.16Å; E122-R126 IonicContact OE1-NH2 3.25Å; E122-R126 PolarHBondContact OE1-NH2 2.94Å
123	K	98.1	Very high	97.7	Very high	129 Å²	129	109 Å²	109	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-58.5	-48.8	176.1	-177.8	179.6	175	-177.3	0	111.8	L119 P120 R121 L125 R126 E127	L119-K123 WeakPolarHBondContact O-CB 3.42Å; L119-K123 PolarHBondContact O-N 3.45Å; P120-K123 PolarHBondContact O-N 3.36Å; R121-K123 VanDerWaalsContact C-N 3.32Å; K123-L125 VanDerWaalsContact C-N 3.33Å; K123-L125 PolarHBondContact O-N 3.12Å; K123-R126 PolarHBondContact O-N 3.49Å; K123-E127 WeakPolarHBondContact CE-OE1 3.41Å; K123-E127 WeakPolarHBondContact O-CG 3.39Å; K123-E127 PolarHBondContact O-N 3.3Å
124	Q	97.9	Very high	97.6	Very high	120 Å²	120	106.2 Å²	106.2	56%	0.561	51%	0.509	S	S	*	.	H	α-helix	trans	-60	-42.2	177.4	-77.3	177.6	-21.8	0	0	112.4	P120 R121 E122 E127 H128	P120-Q124 WeakPolarHBondContact O-CG 3.32Å; P120-Q124 PolarHBondContact O-N 2.93Å; R121-Q124 PolarHBondContact O-N 2.97Å; E122-Q124 PolarHBondContact O-N 2.73Å; Q124-E127 PolarHBondContact O-N 2.89Å; Q124-H128 PolarHBondContact O-N 3.43Å
125	L	98.2	Very high	97.5	Very high	113 Å²	113	108.1 Å²	108.1	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-63.7	-45.7	177.9	-177.9	63.2	0	0	0	110.9	R121 E122 K123 E127 H128 C129	R121-L125 WeakPolarHBondContact O-CB 3.41Å; R121-L125 PolarHBondContact O-N 3.48Å; E122-L125 PolarHBondContact O-N 2.89Å; K123-L125 VanDerWaalsContact C-N 3.33Å; K123-L125 PolarHBondContact O-N 3.12Å; L125-E127 VanDerWaalsContact C-N 3.32Å; L125-E127 PolarHBondContact O-N 3.46Å; L125-H128 PolarHBondContact O-N 3.4Å; L125-H128 VanDerWaalsContact O-N 3.16Å; L125-C129 PolarHBondContact O-N 3.17Å; L125-C129 PolarHBondContact O-SG 2.9Å; L125-C129 VanDerWaalsContact O-SG 3.33Å
126	R	98.2	Very high	97.2	Very high	174 Å²	174	110 Å²	110	66%	0.657	53%	0.526	S	S	*	.	H	α-helix	trans	-59.2	-43.2	176.9	-171.8	-176.3	-70	-123	1.2	111.7	E122 K123 C129 K130	E122-R126 WeakPolarHBondContact O-CB 3.43Å; E122-R126 PolarHBondContact O-N 3.24Å; E122-R126 IonicContact OE1-CZ 3.82Å; E122-R126 VanDerWaalsContact OE1-CZ 3.25Å; E122-R126 IonicContact OE1-NE 2.73Å; E122-R126 PolarHBondContact OE1-NE 3.16Å; E122-R126 IonicContact OE1-NH2 3.25Å; E122-R126 PolarHBondContact OE1-NH2 2.94Å; K123-R126 PolarHBondContact O-N 3.49Å; R126-C129 PolarHBondContact O-N 3.3Å; R126-K130 WeakPolarHBondContact O-CB 3.1Å; R126-K130 PolarHBondContact O-N 3.01Å
127	E	98.2	Very high	97	Very high	81 Å²	81	110.3 Å²	110.3	38%	0.379	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-41.3	174.9	-73	173.4	-169.6	0	0	112.4	K123 Q124 L125 K130 R131	K123-E127 WeakPolarHBondContact CE-OE1 3.41Å; K123-E127 WeakPolarHBondContact O-CG 3.39Å; K123-E127 PolarHBondContact O-N 3.3Å; Q124-E127 PolarHBondContact O-N 2.89Å; L125-E127 VanDerWaalsContact C-N 3.32Å; L125-E127 PolarHBondContact O-N 3.46Å; E127-K130 PolarHBondContact O-N 3.33Å; E127-R131 WeakPolarHBondContact O-CG 3.3Å; E127-R131 PolarHBondContact O-N 3.42Å
128	H	97.9	Very high	96.6	Very high	104 Å²	104	107.1 Å²	107.1	48%	0.481	51%	0.513	S	S	.	.	H	α-helix	trans	-63.7	-45.9	176.3	-109	-74	0	0	0	112.6	Q124 L125 K130 R131 L132	Q124-H128 PolarHBondContact O-N 3.43Å; L125-H128 PolarHBondContact O-N 3.4Å; L125-H128 VanDerWaalsContact O-N 3.16Å; H128-K130 VanDerWaalsContact C-N 3.3Å; H128-K130 PolarHBondContact O-N 2.96Å; H128-R131 PolarHBondContact CD2-NH2 3.02Å; H128-R131 PolarHBondContact NE2-NH2 2.9Å; H128-R131 VanDerWaalsContact NE2-NH2 3.17Å; H128-R131 PolarHBondContact O-N 2.88Å; H128-L132 PolarHBondContact O-N 3.27Å
129	C	97.5	Very high	96	Very high	70 Å²	70	111.5 Å²	111.5	47%	0.473	52%	0.523	S	S	.	.	H	α-helix	trans	-59.8	-43.2	176.5	-68.9	0	0	0	0	111.1	L125 R126 L132 E133	L125-C129 PolarHBondContact O-N 3.17Å; L125-C129 PolarHBondContact O-SG 2.9Å; L125-C129 VanDerWaalsContact O-SG 3.33Å; R126-C129 PolarHBondContact O-N 3.3Å; C129-L132 PolarHBondContact O-N 3.45Å; C129-E133 WeakPolarHBondContact O-CB 3.47Å; C129-E133 PolarHBondContact O-N 3Å
130	K	97.2	Very high	95.3	Very high	130 Å²	130	108.7 Å²	108.7	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-61.1	-46.6	176.4	-173	176.4	-179.1	-179.5	0	112.2	R126 E127 H128 L132 E133 D134	R126-K130 WeakPolarHBondContact O-CB 3.1Å; R126-K130 PolarHBondContact O-N 3.01Å; E127-K130 PolarHBondContact O-N 3.33Å; H128-K130 VanDerWaalsContact C-N 3.3Å; H128-K130 PolarHBondContact O-N 2.96Å; K130-L132 VanDerWaalsContact C-N 3.29Å; K130-L132 PolarHBondContact O-N 3.23Å; K130-E133 PolarHBondContact O-N 3.37Å; K130-D134 VanDerWaalsContact O-CG 3.3Å; K130-D134 PolarHBondContact O-N 2.91Å
131	R	97.3	Very high	94.6	Very high	127 Å²	127	112 Å²	112	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-59.5	-40.3	176.3	-74.8	-170.2	-70.6	-104.3	4.2	112.5	E127 H128 L135	E127-R131 WeakPolarHBondContact O-CG 3.3Å; E127-R131 PolarHBondContact O-N 3.42Å; H128-R131 PolarHBondContact CD2-NH2 3.02Å; H128-R131 PolarHBondContact NE2-NH2 2.9Å; H128-R131 VanDerWaalsContact NE2-NH2 3.17Å; H128-R131 PolarHBondContact O-N 2.88Å; R131-L135 WeakPolarHBondContact O-CB 3.46Å; R131-L135 PolarHBondContact O-N 3.41Å; R131-L135 VanDerWaalsContact O-N 3.14Å
132	L	96.8	Very high	93.8	Very high	101 Å²	101	108.7 Å²	108.7	53%	0.529	52%	0.517	S	S	.	.	H	α-helix	trans	-66.2	-43.9	176.6	-80.2	161.3	0	0	0	111.6	H128 C129 K130 L135 L136	H128-L132 PolarHBondContact O-N 3.27Å; C129-L132 PolarHBondContact O-N 3.45Å; K130-L132 VanDerWaalsContact C-N 3.29Å; K130-L132 PolarHBondContact O-N 3.23Å; L132-L135 PolarHBondContact O-N 2.97Å; L132-L136 WeakPolarHBondContact O-CB 3.5Å; L132-L136 VanDerWaalsContact O-CG 3.3Å; L132-L136 WeakPolarHBondContact O-CG 3.48Å; L132-L136 PolarHBondContact O-N 3.37Å
133	E	96.4	Very high	92.8	Very high	118 Å²	118	107.5 Å²	107.5	55%	0.551	52%	0.522	S	S	*	.	H	α-helix	trans	-59.8	-49.5	176.3	-176.4	175.7	-162.8	0	0	111.3	C129 K130 L135 L136 L137	C129-E133 WeakPolarHBondContact O-CB 3.47Å; C129-E133 PolarHBondContact O-N 3Å; K130-E133 PolarHBondContact O-N 3.37Å; E133-L135 VanDerWaalsContact C-N 3.3Å; E133-L135 PolarHBondContact O-N 3.34Å; E133-L136 PolarHBondContact O-N 3.35Å; E133-L137 HydrophobicContact CG-CD1 3.96Å; E133-L137 HydrophobicContact CG-CG 4.44Å; E133-L137 WeakPolarHBondContact O-CB 3.43Å; E133-L137 VanDerWaalsContact O-CG 3.3Å; E133-L137 WeakPolarHBondContact O-CG 3.47Å; E133-L137 PolarHBondContact O-N 3.14Å
134	D	95.8	Very high	91.7	Very high	73 Å²	73	106.3 Å²	106.3	39%	0.39	52%	0.521	S	S	.	.	H	α-helix	trans	-56.1	-45.5	177.6	-69.8	-28	0	0	0	111.2	K130 L137 D138	K130-D134 VanDerWaalsContact O-CG 3.3Å; K130-D134 PolarHBondContact O-N 2.91Å; D134-L137 PolarHBondContact O-N 3.05Å; D134-D138 WeakPolarHBondContact O-CB 3.3Å; D134-D138 PolarHBondContact O-N 3.2Å
135	L	95.1	Very high	90.7	Very high	115 Å²	115	109 Å²	109	60%	0.602	53%	0.526	S	S	*	.	H	α-helix	trans	-66.5	-38.3	179.6	-169	129.2	0	0	0	113	R131 L132 E133 R139	R131-L135 WeakPolarHBondContact O-CB 3.46Å; R131-L135 PolarHBondContact O-N 3.41Å; R131-L135 VanDerWaalsContact O-N 3.14Å; L132-L135 PolarHBondContact O-N 2.97Å; E133-L135 VanDerWaalsContact C-N 3.3Å; E133-L135 PolarHBondContact O-N 3.34Å; L135-R139 WeakPolarHBondContact O-CB 3.45Å; L135-R139 PolarHBondContact O-N 2.9Å
136	L	93.6	Very high	89.6	Confident	114 Å²	114	106.4 Å²	106.4	60%	0.597	52%	0.521	S	S	*	.	H	α-helix	trans	-68.4	-40.2	175.9	-72.3	173.8	0	0	0	111.5	L132 E133 G140	L132-L136 WeakPolarHBondContact O-CB 3.5Å; L132-L136 VanDerWaalsContact O-CG 3.3Å; L132-L136 WeakPolarHBondContact O-CG 3.48Å; L132-L136 PolarHBondContact O-N 3.37Å; E133-L136 PolarHBondContact O-N 3.35Å; L136-G140 PolarHBondContact O-N 3.34Å
137	L	92.9	Very high	88.5	Confident	89 Å²	89	101.9 Å²	101.9	47%	0.466	51%	0.513	S	S	.	.	H	α-helix	trans	-66.8	-42.2	176.4	-69.4	173.4	0	0	0	111.7	E133 D134 G140 R141	E133-L137 HydrophobicContact CG-CD1 3.96Å; E133-L137 HydrophobicContact CG-CG 4.44Å; E133-L137 WeakPolarHBondContact O-CB 3.43Å; E133-L137 VanDerWaalsContact O-CG 3.3Å; E133-L137 WeakPolarHBondContact O-CG 3.47Å; E133-L137 PolarHBondContact O-N 3.14Å; D134-L137 PolarHBondContact O-N 3.05Å; L137-G140 PolarHBondContact O-N 2.65Å; L137-R141 WeakPolarHBondContact O-CG 3.39Å; L137-R141 PolarHBondContact O-N 2.99Å
138	D	87.6	Confident	87.3	Confident	76 Å²	76	104.6 Å²	104.6	41%	0.406	52%	0.523	S	S	.	.	H	α-helix	trans	-61.3	-49	175.2	-79.7	-21.8	0	0	0	111.8	D134 G140 R141 D142	D134-D138 WeakPolarHBondContact O-CB 3.3Å; D134-D138 PolarHBondContact O-N 3.2Å; D138-G140 VanDerWaalsContact C-N 3.28Å; D138-G140 PolarHBondContact O-N 2.92Å; D138-R141 WeakPolarHBondContact O-CB 3.37Å; D138-R141 PolarHBondContact O-N 3.31Å; D138-R141 VanDerWaalsContact O-N 3.11Å; D138-R141 IonicContact OD1-CZ 2.89Å; D138-R141 IonicContact OD1-NE 2.65Å; D138-R141 PolarHBondContact OD1-NE 3.46Å; D138-R141 IonicContact OD1-NH2 3.44Å; D138-R141 PolarHBondContact OD1-NH2 3.03Å; D138-D142 PolarHBondContact O-N 2.87Å
139	R	86	Confident	86	Confident	187 Å²	187	107.2 Å²	107.2	71%	0.706	53%	0.533	S	S	*	.	H	α-helix	trans	-60.5	-38	176.9	-169.4	178.5	-178.5	-150.4	-0.1	112.3	L135 A143	L135-R139 WeakPolarHBondContact O-CB 3.45Å; L135-R139 PolarHBondContact O-N 2.9Å; R139-A143 WeakPolarHBondContact O-CB 3.31Å; R139-A143 PolarHBondContact O-N 3.11Å
140	G	82.9	Confident	84.4	Confident	41 Å²	41	107.7 Å²	107.7	42%	0.423	54%	0.537	S	S	.	.	H	α-helix	trans	-64.9	-42.1	174.4	0	0	0	0	0	112.8	L136 L137 D138 A143 L144	L136-G140 PolarHBondContact O-N 3.34Å; L137-G140 PolarHBondContact O-N 2.65Å; D138-G140 VanDerWaalsContact C-N 3.28Å; D138-G140 PolarHBondContact O-N 2.92Å; G140-A143 PolarHBondContact O-N 3.44Å; G140-L144 PolarHBondContact O-N 3.04Å
141	R	84.6	Confident	82.9	Confident	137 Å²	137	109.7 Å²	109.7	52%	0.517	55%	0.549	S	S	.	.	H	α-helix	trans	-63.9	-41.7	175.2	-75.6	-171.6	-78.2	-127.8	4.5	112.1	L137 D138 L144 R145	L137-R141 WeakPolarHBondContact O-CG 3.39Å; L137-R141 PolarHBondContact O-N 2.99Å; D138-R141 WeakPolarHBondContact O-CB 3.37Å; D138-R141 PolarHBondContact O-N 3.31Å; D138-R141 VanDerWaalsContact O-N 3.11Å; D138-R141 IonicContact OD1-CZ 2.89Å; D138-R141 IonicContact OD1-NE 2.65Å; D138-R141 PolarHBondContact OD1-NE 3.46Å; D138-R141 IonicContact OD1-NH2 3.44Å; D138-R141 PolarHBondContact OD1-NH2 3.03Å; R141-L144 PolarHBondContact O-N 3.13Å; R141-R145 WeakPolarHBondContact O-CG 3.41Å; R141-R145 PolarHBondContact O-N 3.07Å
142	D	80.8	Confident	80.9	Confident	100 Å²	100	107.7 Å²	107.7	54%	0.535	56%	0.559	S	S	.	*	H	α-helix	trans	-66.1	-41.7	178	-72.6	-23.7	0	0	0	111.8	D138 L144 R145 A146	D138-D142 PolarHBondContact O-N 2.87Å; D142-L144 VanDerWaalsContact C-N 3.32Å; D142-L144 PolarHBondContact O-N 3.43Å; D142-R145 PolarHBondContact O-N 3.25Å; D142-A146 WeakPolarHBondContact O-CB 3.48Å; D142-A146 PolarHBondContact O-N 2.9Å
143	A	76.3	Confident	78.6	Confident	59 Å²	59	112.6 Å²	112.6	49%	0.488	59%	0.586	S	S	.	*	H	α-helix	trans	-61.2	-39.9	173.4	0	0	0	0	0	112.3	R139 G140 A146 T147	R139-A143 WeakPolarHBondContact O-CB 3.31Å; R139-A143 PolarHBondContact O-N 3.11Å; G140-A143 PolarHBondContact O-N 3.44Å; A143-A146 PolarHBondContact O-N 3.08Å; A143-T147 PolarHBondContact O-N 2.77Å; A143-T147 VanDerWaalsContact O-N 3.07Å; A143-T147 PolarHBondContact O-OG1 3.47Å
144	L	75.9	Confident	77.7	Confident	103 Å²	103	112.4 Å²	112.4	54%	0.539	59%	0.588	S	S	.	*	H	α-helix	trans	-69.4	-34.7	176.7	-146.8	92.5	0	0	0	112.4	G140 R141 D142 T147 K148	G140-L144 PolarHBondContact O-N 3.04Å; R141-L144 PolarHBondContact O-N 3.13Å; D142-L144 VanDerWaalsContact C-N 3.32Å; D142-L144 PolarHBondContact O-N 3.43Å; L144-T147 VanDerWaalsContact CA-OG1 3.31Å; L144-T147 WeakPolarHBondContact CA-OG1 3.43Å; L144-T147 PolarHBondContact O-OG1 3.17Å; L144-T147 VanDerWaalsContact O-OG1 3.08Å; L144-K148 WeakPolarHBondContact O-CG 3.34Å; L144-K148 PolarHBondContact O-N 3.31Å; L144-K148 VanDerWaalsContact O-N 3.13Å
145	R	76.7	Confident	76.8	Confident	176 Å²	176	114.4 Å²	114.4	66%	0.664	60%	0.598	S	S	*	*	H	α-helix	trans	-70.8	-39.1	174.3	-78.1	-179.8	178.5	-160.8	0.2	111.6	R141 D142 K148 K149	R141-R145 WeakPolarHBondContact O-CG 3.41Å; R141-R145 PolarHBondContact O-N 3.07Å; D142-R145 PolarHBondContact O-N 3.25Å; R145-K148 PolarHBondContact O-N 3.44Å; R145-K149 PolarHBondContact O-N 2.9Å
146	A	74.9	Confident	75.8	Confident	59 Å²	59	114.4 Å²	114.4	49%	0.488	60%	0.598	S	S	.	*	H	α-helix	trans	-64.6	-40.8	176.8	0	0	0	0	0	112.1	D142 A143 K149 S150	D142-A146 WeakPolarHBondContact O-CB 3.48Å; D142-A146 PolarHBondContact O-N 2.9Å; A143-A146 PolarHBondContact O-N 3.08Å; A146-K149 PolarHBondContact O-N 3.13Å; A146-S150 PolarHBondContact O-N 2.73Å; A146-S150 PolarHBondContact O-OG 3.18Å
147	T	73.7	Confident	74.7	Confident	80 Å²	80	114.4 Å²	114.4	49%	0.491	60%	0.598	S	S	.	*	H	α-helix	trans	-67.6	-39.3	174.9	32.7	0	0	0	0	112.8	A143 L144 S150 Q151	A143-T147 PolarHBondContact O-N 2.77Å; A143-T147 VanDerWaalsContact O-N 3.07Å; A143-T147 PolarHBondContact O-OG1 3.47Å; L144-T147 VanDerWaalsContact CA-OG1 3.31Å; L144-T147 WeakPolarHBondContact CA-OG1 3.43Å; L144-T147 PolarHBondContact O-OG1 3.17Å; L144-T147 VanDerWaalsContact O-OG1 3.08Å; T147-S150 WeakPolarHBondContact CA-OG 3.36Å; T147-S150 PolarHBondContact O-N 3.43Å; T147-S150 PolarHBondContact O-OG 3.37Å; T147-S150 VanDerWaalsContact O-OG 3.13Å; T147-Q151 PolarHBondContact O-N 3.5Å
148	K	74.3	Confident	73.6	Confident	138 Å²	138	116 Å²	116	60%	0.6	61%	0.606	S	S	*	*	H	α-helix	trans	-66.3	-35	174.8	-75.1	179	179	-175.4	0	113.6	L144 R145 A152	L144-K148 WeakPolarHBondContact O-CG 3.34Å; L144-K148 PolarHBondContact O-N 3.31Å; L144-K148 VanDerWaalsContact O-N 3.13Å; R145-K148 PolarHBondContact O-N 3.44Å; K148-A152 PolarHBondContact O-N 3.05Å
149	K	69.8	Low	72.7	Confident	159 Å²	159	118.7 Å²	118.7	69%	0.691	62%	0.62	S	S	*	*	H	α-helix	trans	-67.9	-37.8	174.5	-79.6	-177.6	174.9	-175.6	0	112.4	R145 A146 Q151 A152	R145-K149 PolarHBondContact O-N 2.9Å; A146-K149 PolarHBondContact O-N 3.13Å; K149-Q151 VanDerWaalsContact C-N 3.33Å; K149-A152 PolarHBondContact O-N 3.34Å
150	S	65.1	Low	71.7	Confident	80 Å²	80	113.8 Å²	113.8	56%	0.559	61%	0.614	S	S	*	*	H	α-helix	trans	-78.5	-12.8	179.5	35.9	0	0	0	0	114.5	A146 T147	A146-S150 PolarHBondContact O-N 2.73Å; A146-S150 PolarHBondContact O-OG 3.18Å; T147-S150 WeakPolarHBondContact CA-OG 3.36Å; T147-S150 PolarHBondContact O-N 3.43Å; T147-S150 PolarHBondContact O-OG 3.37Å; T147-S150 VanDerWaalsContact O-OG 3.13Å
151	Q	64.9	Low	70.8	Confident	172 Å²	172	119.4 Å²	119.4	80%	0.804	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.3	-7.8	169.5	-98.6	-173.4	-15.3	0	0	113.8	T147 K149	T147-Q151 PolarHBondContact O-N 3.5Å; K149-Q151 VanDerWaalsContact C-N 3.33Å
152	A	55.8	Low	69.7	Low	85 Å²	85	117.9 Å²	117.9	70%	0.702	64%	0.638	S	S	*	*			trans	-105.9	0.2	-177.3	0	0	0	0	0	113.6	K148 K149	K148-A152 PolarHBondContact O-N 3.05Å; K149-A152 PolarHBondContact O-N 3.34Å
153	D	48.2	Very low	68.7	Low	204 Å²	204	119.5 Å²	119.5	100%	1.091	65%	0.647	S	S	*	*			trans	-99.3	0	164.3	-75.7	-28.8	0	0	0	109.4

Retrieved 153 of 153 residues in 92.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).