A0A2K5KRJ4_CERAT Loading...

Beta-defensin

Has antibacterial activity.

AlphaFold DB , UniProt , Accession A0A2K5KRJ4, Species CERAT (Cercocebus atys, Sooty mangabey), Gene n/a, Length 70 aa.

						>A0A2K5KRJ4_CERAT|A0A2K5KRJ4
MPGAMKIFFFIFAALILLAQIFQARTAIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.1	Low	74.6	Confident	224 Å²	224	122.9 Å²	122.9	100%	1.103	63%	0.633	S	S	*	*				0	78.2	0	-69.9	157.4	145	0	0	110.1
2	P	61.1	Low	75.8	Confident	109 Å²	109	123.8 Å²	123.8	71%	0.708	63%	0.63	S	S	*	*			trans	-95	-16.1	-169.5	0.4	20.2	0	0	0	114.4
3	G	61.3	Low	77	Confident	43 Å²	43	117.4 Å²	117.4	44%	0.443	61%	0.607	S	S	.	*	H	α-helix	trans	-77.4	-38.2	-175.7	0	0	0	0	0	114.3	M5 K6 I7	G3-M5 PolarHBondContact O-N 3.35Å; G3-K6 PolarHBondContact O-N 3.21Å; G3-I7 PolarHBondContact O-N 3.29Å
4	A	65.2	Low	78	Confident	54 Å²	54	112.4 Å²	112.4	45%	0.446	59%	0.591	S	S	.	*	H	α-helix	trans	-64	-42.5	-177.3	0	0	0	0	0	112.5	K6 I7 F8	A4-K6 VanDerWaalsContact C-N 3.27Å; A4-K6 PolarHBondContact O-N 3.14Å; A4-I7 PolarHBondContact O-N 3.33Å; A4-I7 VanDerWaalsContact O-N 3.16Å; A4-F8 HydrophobicContact CB-CE2 4.36Å; A4-F8 WeakPolarHBondContact O-CD2 3.45Å; A4-F8 PolarHBondContact O-N 3.14Å; A4-F8 VanDerWaalsContact O-N 3.08Å
5	M	73.2	Confident	78.8	Confident	154 Å²	154	111.5 Å²	111.5	76%	0.759	59%	0.586	S	S	*	*	H	α-helix	trans	-56.7	-39.4	176.8	-99.9	179.2	177.1	0	0	112.7	G3 F9	G3-M5 PolarHBondContact O-N 3.35Å; M5-F9 WeakPolarHBondContact O-CB 3.47Å; M5-F9 PolarHBondContact O-N 3.43Å; M5-F9 VanDerWaalsContact O-N 3.09Å
6	K	76.4	Confident	79.3	Confident	138 Å²	138	111 Å²	111	60%	0.6	58%	0.583	S	S	*	*	H	α-helix	trans	-66.9	-42.6	179.2	-62.3	178.6	88.6	111.2	0	110.9	G3 A4 F9 F10	G3-K6 PolarHBondContact O-N 3.21Å; A4-K6 VanDerWaalsContact C-N 3.27Å; A4-K6 PolarHBondContact O-N 3.14Å; K6-F9 WeakPolarHBondContact O-CB 3.45Å; K6-F9 PolarHBondContact O-N 2.9Å; K6-F10 HydrophobicContact CB-CE2 4.28Å; K6-F10 WeakPolarHBondContact O-CD2 3.46Å; K6-F10 PolarHBondContact O-N 3.25Å
7	I	82.4	Confident	79.8	Confident	105 Å²	105	110.8 Å²	110.8	54%	0.538	58%	0.582	S	S	.	*	H	α-helix	trans	-62.4	-47.3	179	-62.4	168.4	0	0	0	110.9	G3 A4 F9 F10 I11	G3-I7 PolarHBondContact O-N 3.29Å; A4-I7 PolarHBondContact O-N 3.33Å; A4-I7 VanDerWaalsContact O-N 3.16Å; I7-F9 VanDerWaalsContact C-N 3.29Å; I7-F9 PolarHBondContact O-N 3.23Å; I7-F10 PolarHBondContact O-N 3.23Å; I7-I11 HydrophobicContact CG2-CD1 3.93Å; I7-I11 WeakPolarHBondContact O-CG1 3.1Å; I7-I11 PolarHBondContact O-N 2.82Å
8	F	84.3	Confident	80.1	Confident	129 Å²	129	110.8 Å²	110.8	57%	0.566	58%	0.581	S	S	*	*	H	α-helix	trans	-57.9	-44.1	175.4	-74.7	-70	0	0	0	111.5	A4 F10 I11 F12	A4-F8 HydrophobicContact CB-CE2 4.36Å; A4-F8 WeakPolarHBondContact O-CD2 3.45Å; A4-F8 PolarHBondContact O-N 3.14Å; A4-F8 VanDerWaalsContact O-N 3.08Å; F8-F10 VanDerWaalsContact C-N 3.34Å; F8-F10 PolarHBondContact O-N 2.92Å; F8-I11 PolarHBondContact O-N 2.95Å; F8-F12 VanDerWaalsContact O-CD2 3.32Å; F8-F12 WeakPolarHBondContact O-CD2 3.47Å; F8-F12 PolarHBondContact O-N 3.22Å
9	F	84.8	Confident	80.1	Confident	161 Å²	161	107.6 Å²	107.6	71%	0.706	57%	0.573	S	S	*	*	H	α-helix	trans	-59.4	-43.5	179	-151.8	-88.5	0	0	0	112.6	M5 K6 I7 F12 A13	M5-F9 WeakPolarHBondContact O-CB 3.47Å; M5-F9 PolarHBondContact O-N 3.43Å; M5-F9 VanDerWaalsContact O-N 3.09Å; K6-F9 WeakPolarHBondContact O-CB 3.45Å; K6-F9 PolarHBondContact O-N 2.9Å; I7-F9 VanDerWaalsContact C-N 3.29Å; I7-F9 PolarHBondContact O-N 3.23Å; F9-F12 PolarHBondContact O-N 2.04Å; F9-A13 WeakPolarHBondContact O-CB 3.32Å; F9-A13 PolarHBondContact O-N 2.86Å
10	F	86.4	Confident	80.1	Confident	146 Å²	146	108.5 Å²	108.5	64%	0.64	57%	0.573	S	S	*	*	H	α-helix	trans	-64.9	-40	176.2	-72.3	-62.4	0	0	0	112.7	K6 I7 F8 A13 A14	K6-F10 HydrophobicContact CB-CE2 4.28Å; K6-F10 WeakPolarHBondContact O-CD2 3.46Å; K6-F10 PolarHBondContact O-N 3.25Å; I7-F10 PolarHBondContact O-N 3.23Å; F8-F10 VanDerWaalsContact C-N 3.34Å; F8-F10 PolarHBondContact O-N 2.92Å; F10-A13 PolarHBondContact O-N 3.35Å; F10-A14 WeakPolarHBondContact O-CB 3.47Å; F10-A14 PolarHBondContact O-N 3.45Å
11	I	89.4	Confident	80	Confident	89 Å²	89	107.1 Å²	107.1	46%	0.456	57%	0.566	S	S	.	*	H	α-helix	trans	-62.6	-47.9	176.5	-66.8	169	0	0	0	110.3	I7 F8 A13 A14 L15	I7-I11 HydrophobicContact CG2-CD1 3.93Å; I7-I11 WeakPolarHBondContact O-CG1 3.1Å; I7-I11 PolarHBondContact O-N 2.82Å; F8-I11 PolarHBondContact O-N 2.95Å; I11-A13 PolarHBondContact O-N 2.85Å; I11-A14 PolarHBondContact O-N 2.83Å; I11-L15 HydrophobicContact CG2-CD1 4.11Å; I11-L15 HydrophobicContact CG2-CG 4.5Å; I11-L15 WeakPolarHBondContact O-CG 3.04Å; I11-L15 PolarHBondContact O-N 3.11Å
12	F	89.7	Confident	81	Confident	134 Å²	134	103.3 Å²	103.3	59%	0.588	54%	0.543	S	S	*	.	H	α-helix	trans	-60.3	-44.9	177.3	-89.8	-81	0	0	0	112.1	F8 F9 A14 L15 I16	F8-F12 VanDerWaalsContact O-CD2 3.32Å; F8-F12 WeakPolarHBondContact O-CD2 3.47Å; F8-F12 PolarHBondContact O-N 3.22Å; F9-F12 PolarHBondContact O-N 2.04Å; F12-A14 VanDerWaalsContact C-N 3.33Å; F12-A14 PolarHBondContact O-N 3.42Å; F12-L15 PolarHBondContact O-N 2.9Å; F12-I16 VanDerWaalsContact O-CG1 3.31Å; F12-I16 WeakPolarHBondContact O-CG1 3.04Å; F12-I16 PolarHBondContact O-N 3.34Å
13	A	90.4	Very high	81.5	Confident	40 Å²	40	104.1 Å²	104.1	33%	0.331	54%	0.537	S	S	.	.	H	α-helix	trans	-59.6	-43.2	176.4	0	0	0	0	0	112	F9 F10 I11 I16 L17	F9-A13 WeakPolarHBondContact O-CB 3.32Å; F9-A13 PolarHBondContact O-N 2.86Å; F10-A13 PolarHBondContact O-N 3.35Å; I11-A13 PolarHBondContact O-N 2.85Å; A13-I16 PolarHBondContact O-N 2.03Å; A13-L17 WeakPolarHBondContact O-CG 3.28Å; A13-L17 PolarHBondContact O-N 2.02Å
14	A	91.8	Very high	82.2	Confident	47 Å²	47	104.4 Å²	104.4	39%	0.388	54%	0.536	S	S	.	.	H	α-helix	trans	-63.3	-41.1	176.8	0	0	0	0	0	112.4	F10 I11 F12 L17 L18	F10-A14 WeakPolarHBondContact O-CB 3.47Å; F10-A14 PolarHBondContact O-N 3.45Å; I11-A14 PolarHBondContact O-N 2.83Å; F12-A14 VanDerWaalsContact C-N 3.33Å; F12-A14 PolarHBondContact O-N 3.42Å; A14-L17 PolarHBondContact O-N 3.12Å; A14-L18 WeakPolarHBondContact O-CG 3.19Å; A14-L18 PolarHBondContact O-N 2.98Å
15	L	89.3	Confident	82.8	Confident	100 Å²	100	110.4 Å²	110.4	52%	0.524	55%	0.547	S	S	.	.	H	α-helix	trans	-64.2	-41.4	176.6	-69.8	172.7	0	0	0	112.1	I11 F12 L18 A19	I11-L15 HydrophobicContact CG2-CD1 4.11Å; I11-L15 HydrophobicContact CG2-CG 4.5Å; I11-L15 WeakPolarHBondContact O-CG 3.04Å; I11-L15 PolarHBondContact O-N 3.11Å; F12-L15 PolarHBondContact O-N 2.9Å; L15-L18 PolarHBondContact O-N 3.43Å; L15-A19 WeakPolarHBondContact O-CB 3.4Å; L15-A19 PolarHBondContact O-N 2.76Å
16	I	87.6	Confident	83.1	Confident	103 Å²	103	104.6 Å²	104.6	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-62.6	-46.1	176.6	-66.8	164.3	0	0	0	110.5	F12 A13 L18 A19 Q20	F12-I16 VanDerWaalsContact O-CG1 3.31Å; F12-I16 WeakPolarHBondContact O-CG1 3.04Å; F12-I16 PolarHBondContact O-N 3.34Å; A13-I16 PolarHBondContact O-N 2.03Å; I16-L18 VanDerWaalsContact C-N 3.35Å; I16-L18 PolarHBondContact O-N 2.9Å; I16-A19 PolarHBondContact O-N 3.26Å; I16-Q20 PolarHBondContact O-N 3.03Å; I16-Q20 VanDerWaalsContact O-N 3.08Å
17	L	87.1	Confident	83.5	Confident	108 Å²	108	99 Å²	99	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-58.5	-45.8	176.3	-78.8	160.6	0	0	0	111.7	A13 A14 A19 Q20 I21	A13-L17 WeakPolarHBondContact O-CG 3.28Å; A13-L17 PolarHBondContact O-N 2.02Å; A14-L17 PolarHBondContact O-N 3.12Å; L17-A19 VanDerWaalsContact C-N 3.34Å; L17-A19 PolarHBondContact O-N 2.86Å; L17-Q20 PolarHBondContact O-N 3.08Å; L17-I21 WeakPolarHBondContact O-CD1 3.21Å; L17-I21 VanDerWaalsContact O-CG1 3.26Å; L17-I21 WeakPolarHBondContact O-CG1 3.05Å; L17-I21 PolarHBondContact O-N 3.38Å
18	L	85.6	Confident	83.6	Confident	110 Å²	110	99 Å²	99	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-62.3	-40.8	177.3	-74.7	169.5	0	0	0	112.3	A14 L15 I16 Q20 I21 F22	A14-L18 WeakPolarHBondContact O-CG 3.19Å; A14-L18 PolarHBondContact O-N 2.98Å; L15-L18 PolarHBondContact O-N 3.43Å; I16-L18 VanDerWaalsContact C-N 3.35Å; I16-L18 PolarHBondContact O-N 2.9Å; L18-Q20 PolarHBondContact O-N 3.48Å; L18-I21 PolarHBondContact O-N 2.96Å; L18-F22 WeakPolarHBondContact O-CB 3.48Å; L18-F22 PolarHBondContact O-N 3.41Å
19	A	80.5	Confident	83.8	Confident	50 Å²	50	98.6 Å²	98.6	41%	0.413	50%	0.499	S	S	.	.	H	α-helix	trans	-61.3	-43.9	177.5	0	0	0	0	0	111.7	L15 I16 L17 F22 Q23	L15-A19 WeakPolarHBondContact O-CB 3.4Å; L15-A19 PolarHBondContact O-N 2.76Å; I16-A19 PolarHBondContact O-N 3.26Å; L17-A19 VanDerWaalsContact C-N 3.34Å; L17-A19 PolarHBondContact O-N 2.86Å; A19-F22 PolarHBondContact O-N 3.32Å; A19-Q23 WeakPolarHBondContact O-CB 3.1Å; A19-Q23 VanDerWaalsContact O-CG 3.32Å; A19-Q23 WeakPolarHBondContact O-CG 3.07Å; A19-Q23 PolarHBondContact O-N 2.94Å
20	Q	79.9	Confident	84	Confident	126 Å²	126	96 Å²	96	59%	0.589	49%	0.485	S	S	*	.	H	α-helix	trans	-65.3	-42.9	176.7	-68.5	-160	-16.6	0	0	112.3	I16 L17 L18 F22 Q23 A24	I16-Q20 PolarHBondContact O-N 3.03Å; I16-Q20 VanDerWaalsContact O-N 3.08Å; L17-Q20 PolarHBondContact O-N 3.08Å; L18-Q20 PolarHBondContact O-N 3.48Å; Q20-F22 VanDerWaalsContact C-N 3.31Å; Q20-F22 PolarHBondContact O-N 2.92Å; Q20-Q23 PolarHBondContact O-N 3.49Å; Q20-A24 WeakPolarHBondContact O-CB 3.4Å; Q20-A24 PolarHBondContact O-N 3.3Å
21	I	77.8	Confident	84.1	Confident	80 Å²	80	90.8 Å²	90.8	41%	0.41	47%	0.468	S	S	.	.	H	α-helix	trans	-61.7	-41.9	176.8	-65.7	163.2	0	0	0	110.6	L17 L18 A24 R25	L17-I21 WeakPolarHBondContact O-CD1 3.21Å; L17-I21 VanDerWaalsContact O-CG1 3.26Å; L17-I21 WeakPolarHBondContact O-CG1 3.05Å; L17-I21 PolarHBondContact O-N 3.38Å; L18-I21 PolarHBondContact O-N 2.96Å; I21-A24 PolarHBondContact O-N 3.43Å; I21-R25 HydrophobicContact CG2-CG 4.48Å; I21-R25 WeakPolarHBondContact O-CB 3.46Å; I21-R25 WeakPolarHBondContact O-CG 3.35Å; I21-R25 PolarHBondContact O-N 3.25Å
22	F	76.2	Confident	84.3	Confident	143 Å²	143	91.4 Å²	91.4	63%	0.627	47%	0.472	S	S	*	.	H	α-helix	trans	-67.4	-41.4	179.7	-164.7	-94.6	0	0	0	112.1	L18 A19 Q20 T26	L18-F22 WeakPolarHBondContact O-CB 3.48Å; L18-F22 PolarHBondContact O-N 3.41Å; A19-F22 PolarHBondContact O-N 3.32Å; Q20-F22 VanDerWaalsContact C-N 3.31Å; Q20-F22 PolarHBondContact O-N 2.92Å; F22-T26 WeakPolarHBondContact O-CB 3.49Å; F22-T26 PolarHBondContact O-N 3.31Å; F22-T26 PolarHBondContact O-OG1 3.39Å
23	Q	72	Confident	84.4	Confident	126 Å²	126	88.5 Å²	88.5	59%	0.589	46%	0.462	S	S	*	.	H	α-helix	trans	-62.2	-47.5	173.8	-74.1	177.6	-2.3	0	0	111.5	A19 Q20 R25 T26 A27	A19-Q23 WeakPolarHBondContact O-CB 3.1Å; A19-Q23 VanDerWaalsContact O-CG 3.32Å; A19-Q23 WeakPolarHBondContact O-CG 3.07Å; A19-Q23 PolarHBondContact O-N 2.94Å; Q20-Q23 PolarHBondContact O-N 3.49Å; Q23-R25 PolarHBondContact O-N 2.9Å; Q23-T26 PolarHBondContact O-N 3Å; Q23-A27 PolarHBondContact O-N 2.91Å
24	A	75.5	Confident	84.6	Confident	50 Å²	50	86.8 Å²	86.8	41%	0.413	45%	0.447	S	S	.	.	H	α-helix	trans	-60.1	-46.1	177.7	0	0	0	0	0	112.1	Q20 I21 T26 A27 I28	Q20-A24 WeakPolarHBondContact O-CB 3.4Å; Q20-A24 PolarHBondContact O-N 3.3Å; I21-A24 PolarHBondContact O-N 3.43Å; A24-T26 VanDerWaalsContact C-N 3.31Å; A24-T26 PolarHBondContact O-N 2.91Å; A24-A27 PolarHBondContact O-N 3.29Å; A24-I28 WeakPolarHBondContact O-CD1 3.44Å; A24-I28 VanDerWaalsContact O-CG1 3.24Å; A24-I28 WeakPolarHBondContact O-CG1 3.4Å; A24-I28 PolarHBondContact O-N 3.44Å
25	R	79.3	Confident	84.7	Confident	180 Å²	180	92.2 Å²	92.2	68%	0.679	46%	0.462	S	S	*	.	H	α-helix	trans	-59.2	-41.8	174.8	-77.2	-176.8	-172.8	-173.7	3.5	112.2	I21 Q23 I28 H29	I21-R25 HydrophobicContact CG2-CG 4.48Å; I21-R25 WeakPolarHBondContact O-CB 3.46Å; I21-R25 WeakPolarHBondContact O-CG 3.35Å; I21-R25 PolarHBondContact O-N 3.25Å; Q23-R25 PolarHBondContact O-N 2.9Å; R25-I28 PolarHBondContact O-N 3.02Å; R25-H29 WeakPolarHBondContact O-CB 3.4Å; R25-H29 PolarHBondContact O-N 3.4Å
26	T	79.6	Confident	84.9	Confident	31 Å²	31	97.3 Å²	97.3	19%	0.19	47%	0.474	C	S	.	.	H	α-helix	trans	-65.7	-41.5	179.8	-54.3	0	0	0	0	111.7	F22 Q23 A24 H29 R30	F22-T26 WeakPolarHBondContact O-CB 3.49Å; F22-T26 PolarHBondContact O-N 3.31Å; F22-T26 PolarHBondContact O-OG1 3.39Å; Q23-T26 PolarHBondContact O-N 3Å; A24-T26 VanDerWaalsContact C-N 3.31Å; A24-T26 PolarHBondContact O-N 2.91Å; T26-H29 PolarHBondContact O-N 2.88Å; T26-R30 WeakPolarHBondContact O-CG 3.46Å; T26-R30 PolarHBondContact O-N 3.33Å; T26-R30 VanDerWaalsContact O-N 3.12Å
27	A	83.3	Confident	85.1	Confident	20 Å²	20	97.2 Å²	97.2	17%	0.165	47%	0.473	C	S	.	.	H	α-helix	trans	-63.2	-47	175.8	0	0	0	0	0	111.4	Q23 A24 H29 R30 A31 R56	Q23-A27 PolarHBondContact O-N 2.91Å; A24-A27 PolarHBondContact O-N 3.29Å; A27-H29 VanDerWaalsContact C-N 3.35Å; A27-H29 PolarHBondContact O-N 3.08Å; A27-R30 PolarHBondContact O-N 3.29Å; A27-A31 WeakPolarHBondContact O-CB 2.96Å; A27-A31 PolarHBondContact O-N 3.4Å; A27-R56 WeakPolarHBondContact CB-O 3.48Å
28	I	85.1	Confident	85.5	Confident	106 Å²	106	98.7 Å²	98.7	54%	0.544	48%	0.477	S	S	.	.	H	α-helix	trans	-59.6	-45	177.3	-67.5	163.7	0	0	0	111.1	A24 R25 R30 A31 L32	A24-I28 WeakPolarHBondContact O-CD1 3.44Å; A24-I28 VanDerWaalsContact O-CG1 3.24Å; A24-I28 WeakPolarHBondContact O-CG1 3.4Å; A24-I28 PolarHBondContact O-N 3.44Å; R25-I28 PolarHBondContact O-N 3.02Å; I28-R30 VanDerWaalsContact C-N 3.34Å; I28-R30 PolarHBondContact O-N 3.14Å; I28-A31 PolarHBondContact O-N 2.92Å; I28-L32 HydrophobicContact CG2-CD1 3.99Å; I28-L32 WeakPolarHBondContact O-CB 3.03Å; I28-L32 PolarHBondContact O-N 3.4Å
29	H	88.4	Confident	85.9	Confident	120 Å²	120	93.9 Å²	93.9	56%	0.556	45%	0.454	S	S	*	.	H	α-helix	trans	-61.4	-42.8	179.3	-171.5	-91.4	0	0	0	111.9	R25 T26 A27 L32 I33	R25-H29 WeakPolarHBondContact O-CB 3.4Å; R25-H29 PolarHBondContact O-N 3.4Å; T26-H29 PolarHBondContact O-N 2.88Å; A27-H29 VanDerWaalsContact C-N 3.35Å; A27-H29 PolarHBondContact O-N 3.08Å; H29-L32 PolarHBondContact O-N 3.44Å; H29-I33 VanDerWaalsContact CE1-CD1 3.45Å; H29-I33 WeakPolarHBondContact CE1-CD1 3.38Å; H29-I33 WeakPolarHBondContact ND1-CD1 2.97Å; H29-I33 WeakPolarHBondContact O-CG1 3.43Å; H29-I33 PolarHBondContact O-N 3.35Å
30	R	88.6	Confident	86.5	Confident	107 Å²	107	94.9 Å²	94.9	40%	0.404	45%	0.45	S	S	.	.	H	α-helix	trans	-68.3	-38.6	176.8	-72.3	-175.6	176.9	-162	-0.8	112.6	T26 A27 I28 L32 I33 C34 G54	T26-R30 WeakPolarHBondContact O-CG 3.46Å; T26-R30 PolarHBondContact O-N 3.33Å; T26-R30 VanDerWaalsContact O-N 3.12Å; A27-R30 PolarHBondContact O-N 3.29Å; I28-R30 VanDerWaalsContact C-N 3.34Å; I28-R30 PolarHBondContact O-N 3.14Å; R30-L32 VanDerWaalsContact C-N 3.34Å; R30-I33 PolarHBondContact O-N 2.97Å; R30-C34 WeakPolarHBondContact O-CB 3.46Å; R30-C34 PolarHBondContact O-N 3.35Å; R30-G54 WeakPolarHBondContact CD-O 3.36Å
31	A	90.1	Very high	87.2	Confident	36 Å²	36	90.5 Å²	90.5	30%	0.298	43%	0.433	S	S	.	.	H	α-helix	trans	-62.2	-41.3	173.6	0	0	0	0	0	111.8	A27 I28 C34 K35	A27-A31 WeakPolarHBondContact O-CB 2.96Å; A27-A31 PolarHBondContact O-N 3.4Å; I28-A31 PolarHBondContact O-N 2.92Å; A31-C34 WeakPolarHBondContact O-CB 3.4Å; A31-C34 PolarHBondContact O-N 3.49Å; A31-K35 WeakPolarHBondContact O-CB 3.47Å; A31-K35 PolarHBondContact O-N 3.24Å
32	L	91.9	Very high	87.9	Confident	102 Å²	102	90.3 Å²	90.3	53%	0.534	43%	0.431	S	S	.	.	H	α-helix	trans	-62.3	-43.4	173.8	-96.9	154.4	0	0	0	112.6	I28 H29 R30 C34 K35 R36	I28-L32 HydrophobicContact CG2-CD1 3.99Å; I28-L32 WeakPolarHBondContact O-CB 3.03Å; I28-L32 PolarHBondContact O-N 3.4Å; H29-L32 PolarHBondContact O-N 3.44Å; R30-L32 VanDerWaalsContact C-N 3.34Å; L32-C34 VanDerWaalsContact C-N 3.35Å; L32-K35 PolarHBondContact O-N 3.38Å; L32-R36 WeakPolarHBondContact O-CB 3.44Å; L32-R36 PolarHBondContact O-N 2.77Å
33	I	93.4	Very high	88.8	Confident	74 Å²	74	85.8 Å²	85.8	38%	0.379	42%	0.42	S	S	.	.	H	α-helix	trans	-61.4	-45.7	173.8	-69.2	167.8	0	0	0	110.4	H29 R30 K35 R36 M37	H29-I33 VanDerWaalsContact CE1-CD1 3.45Å; H29-I33 WeakPolarHBondContact CE1-CD1 3.38Å; H29-I33 WeakPolarHBondContact ND1-CD1 2.97Å; H29-I33 WeakPolarHBondContact O-CG1 3.43Å; H29-I33 PolarHBondContact O-N 3.35Å; R30-I33 PolarHBondContact O-N 2.97Å; I33-K35 VanDerWaalsContact C-N 3.31Å; I33-K35 PolarHBondContact O-N 2.96Å; I33-R36 WeakPolarHBondContact O-CB 3.34Å; I33-R36 PolarHBondContact O-N 3.18Å; I33-R36 VanDerWaalsContact O-N 3.14Å; I33-M37 WeakPolarHBondContact O-CG 3.42Å; I33-M37 PolarHBondContact O-N 3.01Å
34	C	94.5	Very high	89.8	Confident	3 Å²	3	87 Å²	87	2%	0.02	43%	0.425	C	S	.	.	H	α-helix	trans	-57.1	-47.2	178.2	-174.6	0	0	0	0	111.2	R30 A31 L32 R36 M37 G39 H40 C63	R30-C34 WeakPolarHBondContact O-CB 3.46Å; R30-C34 PolarHBondContact O-N 3.35Å; A31-C34 WeakPolarHBondContact O-CB 3.4Å; A31-C34 PolarHBondContact O-N 3.49Å; L32-C34 VanDerWaalsContact C-N 3.35Å; C34-R36 VanDerWaalsContact C-N 3.34Å; C34-R36 PolarHBondContact O-N 3.02Å; C34-M37 WeakPolarHBondContact O-CB 3.29Å; C34-M37 PolarHBondContact O-N 3.42Å; C34-M37 VanDerWaalsContact O-N 3.12Å; C34-G39 WeakPolarHBondContact O-CA 3.46Å; C34-G39 PolarHBondContact O-N 3.26Å; C34-G39 VanDerWaalsContact SG-C 3.58Å; C34-H40 VanDerWaalsContact SG-C 3.59Å; C34-H40 PolarHBondContact SG-O 3.24Å; C34-C63 WeakPolarHBondContact CA-SG 3.02Å; C34-C63 HydrophobicContact CB-CB 3.81Å; C34-C63 WeakPolarHBondContact CB-SG 3.28Å; C34-C63 VanDerWaalsContact SG-CA 3.51Å; C34-C63 WeakPolarHBondContact SG-CB 3.4Å; C34-C63 CovalentContact SG-SG 2.02Å; C34-C63 PolarHBondContact SG-SG 2.89Å
35	K	93.3	Very high	90.7	Very high	162 Å²	162	86.4 Å²	86.4	70%	0.704	42%	0.418	S	S	*	.	H	α-helix	trans	-62.8	-38.1	176.8	-162.4	174.3	-174.9	178.4	0	112.5	A31 L32 I33 M37 E38	A31-K35 WeakPolarHBondContact O-CB 3.47Å; A31-K35 PolarHBondContact O-N 3.24Å; L32-K35 PolarHBondContact O-N 3.38Å; I33-K35 VanDerWaalsContact C-N 3.31Å; I33-K35 PolarHBondContact O-N 2.96Å; K35-M37 VanDerWaalsContact C-N 3.26Å; K35-M37 PolarHBondContact O-N 3.46Å; K35-E38 PolarHBondContact O-N 3.12Å
36	R	94.2	Very high	91.4	Very high	206 Å²	206	82.2 Å²	82.2	78%	0.777	41%	0.408	S	S	*	.	H	α-helix	trans	-63.5	-31.7	174.9	-172.6	-175.7	-63.9	173.7	0.3	112.3	L32 I33 C34 E38	L32-R36 WeakPolarHBondContact O-CB 3.44Å; L32-R36 PolarHBondContact O-N 2.77Å; I33-R36 WeakPolarHBondContact O-CB 3.34Å; I33-R36 PolarHBondContact O-N 3.18Å; I33-R36 VanDerWaalsContact O-N 3.14Å; C34-R36 VanDerWaalsContact C-N 3.34Å; C34-R36 PolarHBondContact O-N 3.02Å; R36-E38 PolarHBondContact O-N 3.04Å
37	M	91.6	Very high	92	Very high	102 Å²	102	87.1 Å²	87.1	50%	0.502	44%	0.438	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.8	9.1	174.3	-64.2	-85.5	-74.1	0	0	112.7	I33 C34 K35 G39 I52 K65	I33-M37 WeakPolarHBondContact O-CG 3.42Å; I33-M37 PolarHBondContact O-N 3.01Å; C34-M37 WeakPolarHBondContact O-CB 3.29Å; C34-M37 PolarHBondContact O-N 3.42Å; C34-M37 VanDerWaalsContact O-N 3.12Å; K35-M37 VanDerWaalsContact C-N 3.26Å; K35-M37 PolarHBondContact O-N 3.46Å; M37-G39 PolarHBondContact O-N 3.39Å; M37-I52 HydrophobicContact CB-CD1 3.79Å; M37-I52 HydrophobicContact CE-CD1 4.18Å; M37-K65 VanDerWaalsContact O-CD 3.29Å; M37-K65 WeakPolarHBondContact O-CD 3.07Å; M37-K65 VanDerWaalsContact O-CE 3.28Å; M37-K65 WeakPolarHBondContact O-CE 3.36Å; M37-K65 PolarHBondContact O-NZ 3.09Å
38	E	94.2	Very high	92.4	Very high	138 Å²	138	91.2 Å²	91.2	65%	0.645	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.8	25.9	-170.8	-49.3	159.1	-88.8	0	0	113.1	K35 R36 K65	K35-E38 PolarHBondContact O-N 3.12Å; R36-E38 PolarHBondContact O-N 3.04Å; E38-K65 IonicContact OE1-NZ 3.35Å; E38-K65 PolarHBondContact OE1-NZ 3.38Å
39	G	94.1	Very high	92.9	Very high	10 Å²	10	86.7 Å²	86.7	10%	0.103	43%	0.429	C	S	.	.			trans	-95.2	174.1	171.2	0	0	0	0	0	112.2	C34 M37 C64	C34-G39 WeakPolarHBondContact O-CA 3.46Å; C34-G39 PolarHBondContact O-N 3.26Å; C34-G39 VanDerWaalsContact SG-C 3.58Å; M37-G39 PolarHBondContact O-N 3.39Å; G39-C64 CarbonylContact C-O 3.53Å; G39-C64 WeakPolarHBondContact CA-O 3.37Å
40	H	93.5	Very high	93.1	Very high	71 Å²	71	83.7 Å²	83.7	33%	0.329	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	159	171	60.8	-72.2	0	0	0	110.1	C34 E49 C63 C64	C34-H40 VanDerWaalsContact SG-C 3.59Å; C34-H40 PolarHBondContact SG-O 3.24Å; H40-E49 VanDerWaalsContact CE1-CD 3.47Å; H40-E49 IonicContact CE1-OE1 2.86Å; H40-E49 PolarHBondContact CE1-OE1 2.97Å; H40-E49 IonicContact CE1-OE2 3.77Å; H40-E49 PolarHBondContact CE1-OE2 3.44Å; H40-E49 IonicContact NE2-OE1 3.14Å; H40-E49 IonicContact NE2-OE2 3.21Å; H40-E49 PolarHBondContact NE2-OE2 3.4Å; H40-C63 WeakPolarHBondContact O-CA 3.24Å; H40-C64 PolarHBondContact N-O 3.36Å; H40-C64 PolarHBondContact ND1-O 2.91Å; H40-C64 PolarHBondContact O-N 3.43Å
41	C	93.8	Very high	93.4	Very high	34 Å²	34	84.8 Å²	84.8	23%	0.23	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	126.8	-177.9	-56.3	0	0	0	0	110	C55 Y62	C41-C55 HydrophobicContact CB-CB 3.57Å; C41-C55 WeakPolarHBondContact CB-SG 3.42Å; C41-C55 WeakPolarHBondContact SG-CB 3.47Å; C41-C55 CovalentContact SG-SG 2.03Å; C41-C55 PolarHBondContact SG-SG 3.37Å; C41-Y62 CarbonylContact C-O 3.35Å; C41-Y62 WeakPolarHBondContact CA-O 3.46Å
42	E	94.2	Very high	93.6	Very high	76 Å²	76	86.1 Å²	86.1	36%	0.355	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	157.2	-177.1	-160.2	53.6	-95.5	0	0	112.1	E44 T60 P61 Y62	E42-E44 VanDerWaalsContact C-N 3.34Å; E42-E44 WeakPolarHBondContact CG-O 3.32Å; E42-T60 CarbonylContact O-C 3.41Å; E42-T60 WeakPolarHBondContact O-CA 3.26Å; E42-P61 WeakPolarHBondContact O-CD 2.97Å; E42-Y62 PolarHBondContact N-O 2.97Å; E42-Y62 PolarHBondContact O-N 3.26Å; E42-Y62 VanDerWaalsContact O-N 3.11Å
43	A	93.9	Very high	93.6	Very high	48 Å²	48	82.8 Å²	82.8	40%	0.397	42%	0.419	S	S	.	.	S	Bend	trans	-59.9	-44.9	173.1	0	0	0	0	0	111.3	L59 Y62	A43-L59 WeakPolarHBondContact CA-O 3.46Å; A43-L59 WeakPolarHBondContact CB-O 3.48Å; A43-Y62 WeakPolarHBondContact O-CD2 3.38Å; A43-Y62 WeakPolarHBondContact O-CE2 3.31Å
44	E	93.5	Very high	93.5	Very high	150 Å²	150	80.7 Å²	80.7	70%	0.701	42%	0.415	S	S	*	.	S	Bend	trans	-146.4	143.3	174.1	-66.8	-162.5	145.3	0	0	109.2	E42 Y62	E42-E44 VanDerWaalsContact C-N 3.34Å; E42-E44 WeakPolarHBondContact CG-O 3.32Å; E44-Y62 HydrophobicContact CG-CE2 4.49Å
45	C	94.4	Very high	93.3	Very high	38 Å²	38	80.6 Å²	80.6	26%	0.257	42%	0.415	S	S	.	.			trans	-75.2	140.6	177.3	-57.2	0	0	0	0	111	E49 C64	C45-E49 HydrophobicContact CB-CB 4.31Å; C45-C64 WeakPolarHBondContact CA-SG 3.44Å; C45-C64 HydrophobicContact CB-CB 3.78Å; C45-C64 WeakPolarHBondContact CB-SG 3.39Å; C45-C64 WeakPolarHBondContact SG-CB 3.34Å; C45-C64 CovalentContact SG-SG 2.04Å; C45-C64 PolarHBondContact SG-SG 3.29Å
46	L	93.1	Very high	92.8	Very high	92 Å²	92	80 Å²	80	48%	0.482	41%	0.408	S	S	.	.			trans	-65.5	159.3	175	-62.5	170.9	0	0	0	111.2	F48 E49	L46-F48 HydrophobicContact CB-CD1 4.12Å; L46-F48 HydrophobicContact CB-CE1 3.75Å; L46-F48 HydrophobicContact CB-CE2 4.29Å; L46-F48 HydrophobicContact CB-CZ 3.86Å; L46-F48 HydrophobicContact CD1-CE1 3.75Å; L46-F48 HydrophobicContact CD1-CE2 4.06Å; L46-F48 HydrophobicContact CD1-CZ 3.28Å; L46-F48 HydrophobicContact CG-CE1 4.31Å; L46-F48 HydrophobicContact CG-CZ 4.19Å; L46-F48 PolarHBondContact O-N 3.46Å; L46-F48 VanDerWaalsContact O-N 3.14Å; L46-E49 HydrophobicContact CB-CG 4.08Å; L46-E49 WeakPolarHBondContact O-CB 3.46Å; L46-E49 PolarHBondContact O-N 3.04Å
47	T	92.7	Very high	92	Very high	134 Å²	134	71.9 Å²	71.9	82%	0.822	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	-28.2	-175.9	53.9	0	0	0	0	113.9	E49	T47-E49 VanDerWaalsContact C-N 3.33Å
48	F	92.1	Very high	91.3	Very high	107 Å²	107	76.4 Å²	76.4	47%	0.469	41%	0.405	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.2	4.6	177	58	-97.2	0	0	0	113.7	L46 K66 R67	L46-F48 HydrophobicContact CB-CD1 4.12Å; L46-F48 HydrophobicContact CB-CE1 3.75Å; L46-F48 HydrophobicContact CB-CE2 4.29Å; L46-F48 HydrophobicContact CB-CZ 3.86Å; L46-F48 HydrophobicContact CD1-CE1 3.75Å; L46-F48 HydrophobicContact CD1-CE2 4.06Å; L46-F48 HydrophobicContact CD1-CZ 3.28Å; L46-F48 HydrophobicContact CG-CE1 4.31Å; L46-F48 HydrophobicContact CG-CZ 4.19Å; L46-F48 PolarHBondContact O-N 3.46Å; L46-F48 VanDerWaalsContact O-N 3.14Å; F48-K66 HydrophobicContact CE2-CG 4.46Å; F48-R67 VanDerWaalsContact O-CG 3.32Å; F48-R67 WeakPolarHBondContact O-CG 3.49Å; F48-R67 PolarHBondContact O-N 3.2Å
49	E	94.4	Very high	90.8	Very high	11 Å²	11	76.7 Å²	76.7	5%	0.051	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	166.7	179.7	-58.2	-168.2	146.1	0	0	110.8	H40 C45 L46 T47 C64 K65 K66	H40-E49 VanDerWaalsContact CE1-CD 3.47Å; H40-E49 IonicContact CE1-OE1 2.86Å; H40-E49 PolarHBondContact CE1-OE1 2.97Å; H40-E49 IonicContact CE1-OE2 3.77Å; H40-E49 PolarHBondContact CE1-OE2 3.44Å; H40-E49 IonicContact NE2-OE1 3.14Å; H40-E49 IonicContact NE2-OE2 3.21Å; H40-E49 PolarHBondContact NE2-OE2 3.4Å; C45-E49 HydrophobicContact CB-CB 4.31Å; L46-E49 HydrophobicContact CB-CG 4.08Å; L46-E49 WeakPolarHBondContact O-CB 3.46Å; L46-E49 PolarHBondContact O-N 3.04Å; T47-E49 VanDerWaalsContact C-N 3.33Å; E49-C64 HydrophobicContact CB-CB 4.48Å; E49-C64 WeakPolarHBondContact OE2-CB 3.42Å; E49-K65 CarbonylContact C-O 3.46Å; E49-K65 WeakPolarHBondContact CA-O 3.32Å; E49-K65 WeakPolarHBondContact CB-O 3.45Å; E49-K66 HydrophobicContact CG-CG 4.32Å; E49-K66 WeakPolarHBondContact OE1-CG 3.45Å
50	V	94.3	Very high	90.7	Very high	56 Å²	56	78.2 Å²	78.2	34%	0.339	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	135.1	174.7	-69.7	0	0	0	0	109.5	I52 C64 K65 R67	V50-I52 HydrophobicContact CG2-CG2 3.91Å; V50-I52 PolarHBondContact O-N 3.03Å; V50-C64 WeakPolarHBondContact O-CA 3.43Å; V50-K65 HydrophobicContact CG2-CB 4.42Å; V50-K65 WeakPolarHBondContact CG2-O 3.35Å; V50-K65 PolarHBondContact N-O 3.48Å; V50-K65 PolarHBondContact O-N 3.29Å; V50-R67 HydrophobicContact CG1-CG 3.72Å
51	K	94.5	Very high	90.6	Very high	130 Å²	130	77.1 Å²	77.1	57%	0.565	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.3	113.3	169.7	178.6	-179.5	167.9	178.3	0	108.6	Y62	K51-Y62 HydrophobicContact CD-CD1 3.8Å; K51-Y62 HydrophobicContact CD-CE1 4.23Å; K51-Y62 HydrophobicContact CD-CG 4.3Å; K51-Y62 HydrophobicContact CG-CD1 4.44Å
52	I	94.4	Very high	90.6	Very high	65 Å²	65	79.4 Å²	79.4	33%	0.333	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	-9.6	179.8	59.7	166.7	0	0	0	112.9	M37 V50 C63 K65	M37-I52 HydrophobicContact CB-CD1 3.79Å; M37-I52 HydrophobicContact CE-CD1 4.18Å; V50-I52 HydrophobicContact CG2-CG2 3.91Å; V50-I52 PolarHBondContact O-N 3.03Å; I52-C63 HydrophobicContact CG1-CB 4.17Å; I52-C63 WeakPolarHBondContact CG1-O 3.41Å; I52-C63 VanDerWaalsContact CG1-SG 3.53Å; I52-C63 PolarHBondContact N-O 2.95Å; I52-K65 HydrophobicContact CD1-CB 3.95Å; I52-K65 HydrophobicContact CD1-CD 4.37Å; I52-K65 HydrophobicContact CG1-CB 4.4Å; I52-K65 HydrophobicContact CG2-CB 4.23Å
53	G	91.8	Very high	90.7	Very high	32 Å²	32	76 Å²	76	33%	0.33	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	175.4	-154.4	-179.6	0	0	0	0	0	112.8	C63	G53-C63 PolarHBondContact O-N 3.45Å
54	G	91.6	Very high	90.8	Very high	30 Å²	30	73.7 Å²	73.7	31%	0.309	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.6	142.8	176.7	0	0	0	0	0	113.3	R30 P61	R30-G54 WeakPolarHBondContact CD-O 3.36Å; G54-P61 CarbonylContact C-O 3.43Å; G54-P61 WeakPolarHBondContact CA-O 3.47Å
55	C	90.1	Very high	90.9	Very high	1 Å²	1	68.8 Å²	68.8	1%	0.007	36%	0.363	C	S	.	.			trans	-93.3	-12.6	179.2	-68.8	0	0	0	0	113.9	C41 A57 T60 P61	C41-C55 HydrophobicContact CB-CB 3.57Å; C41-C55 WeakPolarHBondContact CB-SG 3.42Å; C41-C55 WeakPolarHBondContact SG-CB 3.47Å; C41-C55 CovalentContact SG-SG 2.03Å; C41-C55 PolarHBondContact SG-SG 3.37Å; C55-A57 PolarHBondContact O-N 3.01Å; C55-A57 VanDerWaalsContact O-N 3.08Å; C55-T60 WeakPolarHBondContact CB-O 3.35Å; C55-P61 PolarHBondContact N-O 3.42Å
56	R	81.8	Confident	90.8	Very high	149 Å²	149	73.9 Å²	73.9	56%	0.562	38%	0.381	S	S	*	.			trans	51.1	31.6	178.5	-153.2	-174.9	-170.9	-176.6	3	113.1	A27	A27-R56 WeakPolarHBondContact CB-O 3.48Å
57	A	78.8	Confident	90.6	Very high	35 Å²	35	76.9 Å²	76.9	29%	0.289	39%	0.386	S	S	.	.			trans	-92	141.5	164.3	0	0	0	0	0	108	C55 L59 T60	C55-A57 PolarHBondContact O-N 3.01Å; C55-A57 VanDerWaalsContact O-N 3.08Å; A57-L59 VanDerWaalsContact C-N 3.27Å; A57-L59 PolarHBondContact O-N 3.25Å; A57-T60 WeakPolarHBondContact CB-OG1 3.44Å; A57-T60 CarbonylContact O-C 3.58Å; A57-T60 PolarHBondContact O-N 2.98Å
58	E	75.8	Confident	89.9	Confident	197 Å²	197	78.3 Å²	78.3	92%	0.921	38%	0.38	S	S	*	.	S	Bend	trans	-55	-41.2	-173.3	-115	-179.7	162	0	0	112.9
59	L	83.6	Confident	88.7	Confident	145 Å²	145	83.1 Å²	83.1	76%	0.759	40%	0.401	S	S	*	.	S	Bend	trans	-95.6	-16.2	-179.6	-70.7	103.8	0	0	0	114.3	A43 A57	A43-L59 WeakPolarHBondContact CA-O 3.46Å; A43-L59 WeakPolarHBondContact CB-O 3.48Å; A57-L59 VanDerWaalsContact C-N 3.27Å; A57-L59 PolarHBondContact O-N 3.25Å
60	T	91.7	Very high	87	Confident	41 Å²	41	93.3 Å²	93.3	25%	0.252	46%	0.456	S	S	.	.			trans	-133.9	71.1	-176	53.1	0	0	0	0	110.9	E42 C55 A57 Y62	E42-T60 CarbonylContact O-C 3.41Å; E42-T60 WeakPolarHBondContact O-CA 3.26Å; C55-T60 WeakPolarHBondContact CB-O 3.35Å; A57-T60 WeakPolarHBondContact CB-OG1 3.44Å; A57-T60 CarbonylContact O-C 3.58Å; A57-T60 PolarHBondContact O-N 2.98Å; T60-Y62 VanDerWaalsContact C-N 3.33Å; T60-Y62 PolarHBondContact O-N 2.98Å
61	P	92	Very high	86.6	Confident	49 Å²	49	95.2 Å²	95.2	32%	0.318	46%	0.462	S	S	.	.			trans	-74.9	-20.7	-171.1	30.5	-34	0	0	0	113.1	E42 G54 C55	E42-P61 WeakPolarHBondContact O-CD 2.97Å; G54-P61 CarbonylContact C-O 3.43Å; G54-P61 WeakPolarHBondContact CA-O 3.47Å; C55-P61 PolarHBondContact N-O 3.42Å
62	Y	94.6	Very high	86.2	Confident	81 Å²	81	93.4 Å²	93.4	32%	0.318	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	145.3	-173	-57.7	-51.6	0	0	0	113.1	C41 E42 A43 E44 K51 T60	C41-Y62 CarbonylContact C-O 3.35Å; C41-Y62 WeakPolarHBondContact CA-O 3.46Å; E42-Y62 PolarHBondContact N-O 2.97Å; E42-Y62 PolarHBondContact O-N 3.26Å; E42-Y62 VanDerWaalsContact O-N 3.11Å; A43-Y62 WeakPolarHBondContact O-CD2 3.38Å; A43-Y62 WeakPolarHBondContact O-CE2 3.31Å; E44-Y62 HydrophobicContact CG-CE2 4.49Å; K51-Y62 HydrophobicContact CD-CD1 3.8Å; K51-Y62 HydrophobicContact CD-CE1 4.23Å; K51-Y62 HydrophobicContact CD-CG 4.3Å; K51-Y62 HydrophobicContact CG-CD1 4.44Å; T60-Y62 VanDerWaalsContact C-N 3.33Å; T60-Y62 PolarHBondContact O-N 2.98Å
63	C	95.6	Very high	85.8	Confident	5 Å²	5	94.9 Å²	94.9	3%	0.034	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	114.8	167.2	179.9	0	0	0	0	108.9	C34 H40 I52 G53	C34-C63 WeakPolarHBondContact CA-SG 3.02Å; C34-C63 HydrophobicContact CB-CB 3.81Å; C34-C63 WeakPolarHBondContact CB-SG 3.28Å; C34-C63 VanDerWaalsContact SG-CA 3.51Å; C34-C63 WeakPolarHBondContact SG-CB 3.4Å; C34-C63 CovalentContact SG-SG 2.02Å; C34-C63 PolarHBondContact SG-SG 2.89Å; H40-C63 WeakPolarHBondContact O-CA 3.24Å; I52-C63 HydrophobicContact CG1-CB 4.17Å; I52-C63 WeakPolarHBondContact CG1-O 3.41Å; I52-C63 VanDerWaalsContact CG1-SG 3.53Å; I52-C63 PolarHBondContact N-O 2.95Å; G53-C63 PolarHBondContact O-N 3.45Å
64	C	95.7	Very high	85.4	Confident	0 Å²	0	98.6 Å²	98.6	0%	0	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	138.8	-174.3	-53.8	0	0	0	0	110.1	G39 H40 C45 E49 V50	G39-C64 CarbonylContact C-O 3.53Å; G39-C64 WeakPolarHBondContact CA-O 3.37Å; H40-C64 PolarHBondContact N-O 3.36Å; H40-C64 PolarHBondContact ND1-O 2.91Å; H40-C64 PolarHBondContact O-N 3.43Å; C45-C64 WeakPolarHBondContact CA-SG 3.44Å; C45-C64 HydrophobicContact CB-CB 3.78Å; C45-C64 WeakPolarHBondContact CB-SG 3.39Å; C45-C64 WeakPolarHBondContact SG-CB 3.34Å; C45-C64 CovalentContact SG-SG 2.04Å; C45-C64 PolarHBondContact SG-SG 3.29Å; E49-C64 HydrophobicContact CB-CB 4.48Å; E49-C64 WeakPolarHBondContact OE2-CB 3.42Å; V50-C64 WeakPolarHBondContact O-CA 3.43Å
65	K	95.5	Very high	85	Confident	47 Å²	47	102.9 Å²	102.9	20%	0.204	48%	0.481	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	137.7	175.9	-174	174	-174.3	160.4	0	109.5	M37 E38 E49 V50 I52 R67	M37-K65 VanDerWaalsContact O-CD 3.29Å; M37-K65 WeakPolarHBondContact O-CD 3.07Å; M37-K65 VanDerWaalsContact O-CE 3.28Å; M37-K65 WeakPolarHBondContact O-CE 3.36Å; M37-K65 PolarHBondContact O-NZ 3.09Å; E38-K65 IonicContact OE1-NZ 3.35Å; E38-K65 PolarHBondContact OE1-NZ 3.38Å; E49-K65 CarbonylContact C-O 3.46Å; E49-K65 WeakPolarHBondContact CA-O 3.32Å; E49-K65 WeakPolarHBondContact CB-O 3.45Å; V50-K65 HydrophobicContact CG2-CB 4.42Å; V50-K65 WeakPolarHBondContact CG2-O 3.35Å; V50-K65 PolarHBondContact N-O 3.48Å; V50-K65 PolarHBondContact O-N 3.29Å; I52-K65 HydrophobicContact CD1-CB 3.95Å; I52-K65 HydrophobicContact CD1-CD 4.37Å; I52-K65 HydrophobicContact CG1-CB 4.4Å; I52-K65 HydrophobicContact CG2-CB 4.23Å; K65-R67 PolarHBondContact O-N 3.16Å
66	K	93.3	Very high	84.7	Confident	145 Å²	145	109.7 Å²	109.7	63%	0.63	51%	0.513	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.5	135.2	172.3	-71.2	-173.9	178.8	-178.5	0	110.1	F48 E49 K68	F48-K66 HydrophobicContact CE2-CG 4.46Å; E49-K66 HydrophobicContact CG-CG 4.32Å; E49-K66 WeakPolarHBondContact OE1-CG 3.45Å; K66-K68 PolarHBondContact O-N 2.94Å
67	R	87.9	Confident	84.9	Confident	155 Å²	155	106.9 Å²	106.9	59%	0.585	51%	0.509	S	S	*	.	P	Polyproline II helix	trans	-59.8	130.4	168.6	-68.3	175.2	-169.1	-155	4.3	108	F48 V50 K65 K69	F48-R67 VanDerWaalsContact O-CG 3.32Å; F48-R67 WeakPolarHBondContact O-CG 3.49Å; F48-R67 PolarHBondContact O-N 3.2Å; V50-R67 HydrophobicContact CG1-CG 3.72Å; K65-R67 PolarHBondContact O-N 3.16Å; R67-K69 PolarHBondContact O-N 3.34Å
68	K	79.5	Confident	85.4	Confident	164 Å²	164	112.5 Å²	112.5	71%	0.713	53%	0.526	S	S	*	.	P	Polyproline II helix	trans	-65.1	127.2	164.1	-80.1	-173.5	174.9	-178	0	106.2	K66 D70	K66-K68 PolarHBondContact O-N 2.94Å; K68-D70 PolarHBondContact O-N 3.08Å
69	K	67	Low	86.2	Confident	207 Å²	207	105.4 Å²	105.4	90%	0.9	49%	0.493	S	S	*	.			trans	-74.5	106.3	170.9	-155.4	176.4	-174.4	-178.6	0	104.7	R67	R67-K69 PolarHBondContact O-N 3.34Å
70	D	57.5	Low	86.4	Confident	226 Å²	226	101.8 Å²	101.8	100%	1.209	47%	0.469	S	S	*	.			trans	-61	0	171.3	-67.3	-49.6	0	0	0	110.6	K68	K68-D70 PolarHBondContact O-N 3.08Å

Retrieved 70 of 70 residues in 211.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).