A0A2K5MY36_CERAT Loading...

Synaptonemal complex central element protein 3

AlphaFold DB , UniProt , Accession A0A2K5MY36, Species CERAT (Cercocebus atys, Sooty mangabey), Gene SYCE3, Length 88 aa.

						>A0A2K5MY36_CERAT|A0A2K5MY36|SYCE3
MADADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.1	Low	72.2	Confident	246 Å²	246	124.5 Å²	124.5	100%	1.212	66%	0.655	S	S	*	*				0	119.3	0	-67.9	-163.1	175.3	0	0	106	D3	M1-D3 PolarHBondContact O-N 3.22Å
2	A	58.6	Low	73.7	Confident	107 Å²	107	122.6 Å²	122.6	88%	0.884	65%	0.646	S	S	*	*	P	Polyproline II helix	trans	-71.1	120.4	177.3	0	0	0	0	0	107.6	A4	A2-A4 PolarHBondContact O-N 3.22Å
3	D	63.6	Low	75.1	Confident	139 Å²	139	120.1 Å²	120.1	74%	0.743	63%	0.633	S	S	*	*	P	Polyproline II helix	trans	-64.4	128.6	171.5	-145.8	-20.4	0	0	0	107	M1 R9	M1-D3 PolarHBondContact O-N 3.22Å; D3-R9 IonicContact OD1-NH2 2.93Å; D3-R9 PolarHBondContact OD1-NH2 3.47Å
4	A	67.4	Low	76.4	Confident	50 Å²	50	118.6 Å²	118.6	41%	0.413	62%	0.623	S	S	.	*	P	Polyproline II helix	trans	-59	141.3	-175.9	0	0	0	0	0	111.1	A2	A2-A4 PolarHBondContact O-N 3.22Å
5	D	77.1	Confident	77.6	Confident	96 Å²	96	118 Å²	118	51%	0.513	62%	0.619	S	S	.	*	P	Polyproline II helix	trans	-56.6	128.7	-177.3	-166.3	2.9	0	0	0	109.9	E7 E8 R9	D5-E7 PolarHBondContact O-N 2.79Å; D5-E8 HydrophobicContact CB-CB 4.43Å; D5-E8 WeakPolarHBondContact O-CB 3.37Å; D5-E8 PolarHBondContact O-N 3.36Å; D5-R9 PolarHBondContact O-N 3.01Å
6	P	74.6	Confident	78.7	Confident	101 Å²	101	119.2 Å²	119.2	66%	0.656	62%	0.618	S	S	*	*	H	α-helix	trans	-51.4	-27.7	-179.9	12.4	-29.9	0	0	0	115	N10	P6-N10 PolarHBondContact O-N 3.45Å
7	E	75.4	Confident	79.7	Confident	134 Å²	134	120.6 Å²	120.6	63%	0.626	62%	0.623	S	S	*	*	H	α-helix	trans	-69.9	-42.9	174.4	-69.1	-164.9	164.2	0	0	112.7	D5 R9 N10 Y11	D5-E7 PolarHBondContact O-N 2.79Å; E7-R9 VanDerWaalsContact C-N 3.32Å; E7-R9 PolarHBondContact O-N 3.48Å; E7-N10 WeakPolarHBondContact O-CB 3.47Å; E7-N10 PolarHBondContact O-N 3.11Å; E7-Y11 VanDerWaalsContact O-CD2 3.3Å; E7-Y11 WeakPolarHBondContact O-CD2 3.4Å; E7-Y11 PolarHBondContact O-N 3.38Å
8	E	74.5	Confident	80.6	Confident	122 Å²	122	119.7 Å²	119.7	57%	0.57	62%	0.619	S	S	*	*	H	α-helix	trans	-63.2	-41.3	179.2	-163.2	172.4	-158.5	0	0	110.8	D5 N10 Y11 D12	D5-E8 HydrophobicContact CB-CB 4.43Å; D5-E8 WeakPolarHBondContact O-CB 3.37Å; D5-E8 PolarHBondContact O-N 3.36Å; E8-N10 PolarHBondContact O-N 3.05Å; E8-Y11 PolarHBondContact O-N 3.45Å; E8-D12 PolarHBondContact O-N 3.07Å
9	R	78.4	Confident	81.4	Confident	128 Å²	128	116.1 Å²	116.1	48%	0.483	61%	0.605	S	S	.	*	H	α-helix	trans	-62.7	-31.2	173.8	-161	179.6	-61.6	-165.3	4	112.5	D3 D5 E7 N13	D3-R9 IonicContact OD1-NH2 2.93Å; D3-R9 PolarHBondContact OD1-NH2 3.47Å; D5-R9 PolarHBondContact O-N 3.01Å; E7-R9 VanDerWaalsContact C-N 3.32Å; E7-R9 PolarHBondContact O-N 3.48Å; R9-N13 PolarHBondContact O-N 3.2Å; R9-N13 PolarHBondContact O-ND2 3.06Å; R9-N13 VanDerWaalsContact O-ND2 3.07Å
10	N	85	Confident	82.2	Confident	96 Å²	96	113.8 Å²	113.8	51%	0.513	59%	0.594	S	S	.	*	H	α-helix	trans	-75.7	-40.7	178.1	-170.7	31.7	0	0	0	112.2	P6 E7 E8 N13 M14	P6-N10 PolarHBondContact O-N 3.45Å; E7-N10 WeakPolarHBondContact O-CB 3.47Å; E7-N10 PolarHBondContact O-N 3.11Å; E8-N10 PolarHBondContact O-N 3.05Å; N10-N13 PolarHBondContact O-N 3.38Å; N10-M14 PolarHBondContact O-N 2.9Å
11	Y	89.1	Confident	82.9	Confident	151 Å²	151	113.9 Å²	113.9	59%	0.592	59%	0.594	S	S	*	*	H	α-helix	trans	-62.8	-43.3	173.9	-84.7	-79.5	0	0	0	112.1	E7 E8 N13 M14 L15	E7-Y11 VanDerWaalsContact O-CD2 3.3Å; E7-Y11 WeakPolarHBondContact O-CD2 3.4Å; E7-Y11 PolarHBondContact O-N 3.38Å; E8-Y11 PolarHBondContact O-N 3.45Å; Y11-N13 VanDerWaalsContact C-N 3.31Å; Y11-N13 PolarHBondContact O-N 3.18Å; Y11-M14 PolarHBondContact O-N 2.88Å; Y11-L15 WeakPolarHBondContact O-CG 3.46Å; Y11-L15 PolarHBondContact O-N 3.37Å
12	D	90.6	Very high	85.1	Confident	101 Å²	101	107 Å²	107	54%	0.54	56%	0.562	S	S	.	*	H	α-helix	trans	-60.9	-40.1	176	-84.8	-10.6	0	0	0	112.4	E8 L15 K16	E8-D12 PolarHBondContact O-N 3.07Å; D12-L15 PolarHBondContact O-N 3.01Å; D12-K16 WeakPolarHBondContact O-CB 3.46Å; D12-K16 PolarHBondContact O-N 3.03Å
13	N	92.2	Very high	87	Confident	90 Å²	90	107.6 Å²	107.6	48%	0.481	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-42.2	175.4	-73	-25.2	0	0	0	111.7	R9 N10 Y11 K16 M17	R9-N13 PolarHBondContact O-N 3.2Å; R9-N13 PolarHBondContact O-ND2 3.06Å; R9-N13 VanDerWaalsContact O-ND2 3.07Å; N10-N13 PolarHBondContact O-N 3.38Å; Y11-N13 VanDerWaalsContact C-N 3.31Å; Y11-N13 PolarHBondContact O-N 3.18Å; N13-K16 PolarHBondContact O-N 3.28Å; N13-M17 WeakPolarHBondContact O-CG 3.48Å; N13-M17 PolarHBondContact O-N 3.3Å
14	M	93.3	Very high	88.6	Confident	100 Å²	100	106.5 Å²	106.5	49%	0.493	54%	0.539	S	S	.	.	H	α-helix	trans	-65	-42.8	177.5	-170.5	-176.5	-60.9	0	0	111.9	N10 Y11 K16 M17 L18	N10-M14 PolarHBondContact O-N 2.9Å; Y11-M14 PolarHBondContact O-N 2.88Å; M14-K16 VanDerWaalsContact C-N 3.3Å; M14-K16 PolarHBondContact O-N 3.5Å; M14-M17 PolarHBondContact O-N 2.93Å; M14-L18 HydrophobicContact CG-CD1 4.39Å; M14-L18 PolarHBondContact O-N 3.12Å
15	L	94.8	Very high	90	Very high	109 Å²	109	108.3 Å²	108.3	57%	0.571	54%	0.541	S	S	*	.	H	α-helix	trans	-61.3	-40.3	175.4	-75.3	171	0	0	0	111.7	Y11 D12 L18 S19	Y11-L15 WeakPolarHBondContact O-CG 3.46Å; Y11-L15 PolarHBondContact O-N 3.37Å; D12-L15 PolarHBondContact O-N 3.01Å; L15-L18 PolarHBondContact O-N 3.21Å; L15-S19 WeakPolarHBondContact O-CB 3.5Å; L15-S19 PolarHBondContact O-N 2.97Å
16	K	95.1	Very high	90.9	Very high	137 Å²	137	109 Å²	109	60%	0.596	54%	0.541	S	S	*	.	H	α-helix	trans	-63.9	-46.5	176	-172.2	171.2	-179.2	177.5	0	112	D12 N13 M14 L18 S19 D20	D12-K16 WeakPolarHBondContact O-CB 3.46Å; D12-K16 PolarHBondContact O-N 3.03Å; N13-K16 PolarHBondContact O-N 3.28Å; M14-K16 VanDerWaalsContact C-N 3.3Å; M14-K16 PolarHBondContact O-N 3.5Å; K16-L18 VanDerWaalsContact C-N 3.33Å; K16-L18 PolarHBondContact O-N 3.49Å; K16-S19 PolarHBondContact O-N 3.47Å; K16-D20 VanDerWaalsContact O-CG 3.3Å; K16-D20 PolarHBondContact O-N 3.41Å
17	M	95.3	Very high	92	Very high	143 Å²	143	110.3 Å²	110.3	70%	0.704	54%	0.537	S	S	*	.	H	α-helix	trans	-59.9	-41.7	176.3	-72.3	-179.8	64.7	0	0	112.5	N13 M14 D20 L21	N13-M17 WeakPolarHBondContact O-CG 3.48Å; N13-M17 PolarHBondContact O-N 3.3Å; M14-M17 PolarHBondContact O-N 2.93Å; M17-D20 PolarHBondContact O-N 3.48Å; M17-L21 WeakPolarHBondContact O-CB 3.38Å; M17-L21 PolarHBondContact O-N 2.93Å
18	L	95.7	Very high	92.9	Very high	104 Å²	104	109.4 Å²	109.4	55%	0.545	54%	0.536	S	S	.	.	H	α-helix	trans	-65.2	-43	176.1	-79	167.4	0	0	0	112.1	M14 L15 K16 L21 N22	M14-L18 HydrophobicContact CG-CD1 4.39Å; M14-L18 PolarHBondContact O-N 3.12Å; L15-L18 PolarHBondContact O-N 3.21Å; K16-L18 VanDerWaalsContact C-N 3.33Å; K16-L18 PolarHBondContact O-N 3.49Å; L18-L21 PolarHBondContact O-N 2.92Å; L18-N22 WeakPolarHBondContact O-CB 3.49Å; L18-N22 PolarHBondContact O-N 3.5Å
19	S	96.6	Very high	93.9	Very high	52 Å²	52	108.4 Å²	108.4	36%	0.364	53%	0.534	S	S	.	.	H	α-helix	trans	-60.7	-45.1	176	165.4	0	0	0	0	111.6	L15 K16 N22 K23	L15-S19 WeakPolarHBondContact O-CB 3.5Å; L15-S19 PolarHBondContact O-N 2.97Å; K16-S19 PolarHBondContact O-N 3.47Å; S19-N22 PolarHBondContact O-N 3.38Å; S19-K23 WeakPolarHBondContact O-CG 3.5Å; S19-K23 PolarHBondContact O-N 2.93Å; S19-K23 VanDerWaalsContact O-N 3.09Å
20	D	96.8	Very high	94.8	Very high	70 Å²	70	107.8 Å²	107.8	37%	0.374	54%	0.536	S	S	.	.	H	α-helix	trans	-66.2	-43.2	-178.9	-68.3	-19.1	0	0	0	110.9	K16 M17 N22 K23 D24	K16-D20 VanDerWaalsContact O-CG 3.3Å; K16-D20 PolarHBondContact O-N 3.41Å; M17-D20 PolarHBondContact O-N 3.48Å; D20-N22 VanDerWaalsContact C-N 3.32Å; D20-N22 PolarHBondContact O-N 2.79Å; D20-K23 PolarHBondContact O-N 3.29Å; D20-D24 PolarHBondContact O-N 2.86Å
21	L	96.8	Very high	95.3	Very high	115 Å²	115	107.3 Å²	107.3	60%	0.602	53%	0.531	S	S	*	.	H	α-helix	trans	-60.4	-41	174.5	-178.9	62.1	0	0	0	112.5	M17 L18 K23 D24 L25	M17-L21 WeakPolarHBondContact O-CB 3.38Å; M17-L21 PolarHBondContact O-N 2.93Å; L18-L21 PolarHBondContact O-N 2.92Å; L21-K23 VanDerWaalsContact C-N 3.34Å; L21-D24 PolarHBondContact O-N 3.17Å; L21-L25 WeakPolarHBondContact O-CB 3.35Å; L21-L25 PolarHBondContact O-N 2.9Å
22	N	96.6	Very high	95.5	Very high	101 Å²	101	105.9 Å²	105.9	54%	0.54	53%	0.531	S	S	.	.	H	α-helix	trans	-65.1	-40	179.3	-165.8	56.1	0	0	0	111.7	L18 S19 D20 L25 E26	L18-N22 WeakPolarHBondContact O-CB 3.49Å; L18-N22 PolarHBondContact O-N 3.5Å; S19-N22 PolarHBondContact O-N 3.38Å; D20-N22 VanDerWaalsContact C-N 3.32Å; D20-N22 PolarHBondContact O-N 2.79Å; N22-L25 PolarHBondContact O-N 2.91Å; N22-E26 WeakPolarHBondContact O-CB 3.4Å; N22-E26 PolarHBondContact O-N 3.32Å
23	K	97.6	Very high	95.6	Very high	121 Å²	121	107.5 Å²	107.5	53%	0.526	54%	0.535	S	S	.	.	H	α-helix	trans	-64.3	-42.8	175.2	-73	172.2	-176.2	171.2	0	112.2	S19 D20 L21 L25 E26 K27	S19-K23 WeakPolarHBondContact O-CG 3.5Å; S19-K23 PolarHBondContact O-N 2.93Å; S19-K23 VanDerWaalsContact O-N 3.09Å; D20-K23 PolarHBondContact O-N 3.29Å; L21-K23 VanDerWaalsContact C-N 3.34Å; K23-L25 VanDerWaalsContact C-N 3.3Å; K23-L25 PolarHBondContact O-N 3.17Å; K23-E26 PolarHBondContact O-N 2.71Å; K23-K27 WeakPolarHBondContact O-CB 3.42Å; K23-K27 PolarHBondContact O-N 3.37Å
24	D	97.3	Very high	95.7	Very high	115 Å²	115	108.2 Å²	108.2	62%	0.615	53%	0.534	S	S	*	.	H	α-helix	trans	-64.5	-38.5	178.3	-74.9	-17.5	0	0	0	111.4	D20 L21 L28	D20-D24 PolarHBondContact O-N 2.86Å; L21-D24 PolarHBondContact O-N 3.17Å; D24-L28 WeakPolarHBondContact O-CB 3.34Å; D24-L28 PolarHBondContact O-N 3.44Å
25	L	96.9	Very high	95.6	Very high	89 Å²	89	108.5 Å²	108.5	47%	0.466	54%	0.537	S	S	.	.	H	α-helix	trans	-66	-45.4	175.3	-177.6	61.4	0	0	0	112	L21 N22 K23 K27 L28 L29	L21-L25 WeakPolarHBondContact O-CB 3.35Å; L21-L25 PolarHBondContact O-N 2.9Å; N22-L25 PolarHBondContact O-N 2.91Å; K23-L25 VanDerWaalsContact C-N 3.3Å; K23-L25 PolarHBondContact O-N 3.17Å; L25-K27 VanDerWaalsContact C-N 3.34Å; L25-K27 PolarHBondContact O-N 3.48Å; L25-L28 WeakPolarHBondContact O-CB 3.45Å; L25-L28 PolarHBondContact O-N 2.95Å; L25-L29 HydrophobicContact CG-CD1 4.26Å; L25-L29 WeakPolarHBondContact O-CG 3.31Å; L25-L29 PolarHBondContact O-N 3.37Å
26	E	96.4	Very high	95.5	Very high	109 Å²	109	106 Å²	106	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-58.4	-47.4	177.6	-172.7	168.3	-154.2	0	0	110.9	N22 K23 L28 L29 E30	N22-E26 WeakPolarHBondContact O-CB 3.4Å; N22-E26 PolarHBondContact O-N 3.32Å; K23-E26 PolarHBondContact O-N 2.71Å; E26-L28 VanDerWaalsContact C-N 3.32Å; E26-L28 PolarHBondContact O-N 2.94Å; E26-L29 WeakPolarHBondContact O-CB 3.47Å; E26-L29 PolarHBondContact O-N 3.45Å; E26-L29 VanDerWaalsContact O-N 3.15Å; E26-E30 WeakPolarHBondContact O-CG 3.32Å; E26-E30 PolarHBondContact O-N 2.91Å
27	K	96.8	Very high	95.5	Very high	129 Å²	129	102.8 Å²	102.8	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-61.1	-39.2	176.4	-173.1	178.1	179.3	-177.9	0	112.9	K23 L25 L29 E30 E31	K23-K27 WeakPolarHBondContact O-CB 3.42Å; K23-K27 PolarHBondContact O-N 3.37Å; L25-K27 VanDerWaalsContact C-N 3.34Å; L25-K27 PolarHBondContact O-N 3.48Å; K27-L29 VanDerWaalsContact C-N 3.35Å; K27-E30 PolarHBondContact O-N 2.97Å; K27-E31 PolarHBondContact O-N 3.38Å; K27-E31 VanDerWaalsContact O-N 3.08Å
28	L	96	Very high	95.2	Very high	116 Å²	116	101 Å²	101	61%	0.607	51%	0.51	S	S	*	.	H	α-helix	trans	-64.4	-41.8	176.4	-179.6	65.6	0	0	0	111.4	D24 L25 E26 E31 M32	D24-L28 WeakPolarHBondContact O-CB 3.34Å; D24-L28 PolarHBondContact O-N 3.44Å; L25-L28 WeakPolarHBondContact O-CB 3.45Å; L25-L28 PolarHBondContact O-N 2.95Å; E26-L28 VanDerWaalsContact C-N 3.32Å; E26-L28 PolarHBondContact O-N 2.94Å; L28-E31 PolarHBondContact O-N 3.21Å; L28-M32 WeakPolarHBondContact O-CB 3.37Å; L28-M32 PolarHBondContact O-N 2.91Å
29	L	95.6	Very high	94.9	Very high	101 Å²	101	98.6 Å²	98.6	53%	0.529	51%	0.505	S	S	.	.	H	α-helix	trans	-64.2	-43.1	177.2	-70.2	172.2	0	0	0	111.4	L25 E26 K27 M32 E33	L25-L29 HydrophobicContact CG-CD1 4.26Å; L25-L29 WeakPolarHBondContact O-CG 3.31Å; L25-L29 PolarHBondContact O-N 3.37Å; E26-L29 WeakPolarHBondContact O-CB 3.47Å; E26-L29 PolarHBondContact O-N 3.45Å; E26-L29 VanDerWaalsContact O-N 3.15Å; K27-L29 VanDerWaalsContact C-N 3.35Å; L29-M32 PolarHBondContact O-N 3.13Å; L29-E33 WeakPolarHBondContact O-CB 3.3Å; L29-E33 PolarHBondContact O-N 2.92Å
30	E	96.4	Very high	94.6	Very high	115 Å²	115	100.7 Å²	100.7	54%	0.537	52%	0.516	S	S	.	.	H	α-helix	trans	-60.3	-45.6	176.1	-71.8	176.9	166.6	0	0	112.3	E26 K27 M32 E33 K34	E26-E30 WeakPolarHBondContact O-CG 3.32Å; E26-E30 PolarHBondContact O-N 2.91Å; K27-E30 PolarHBondContact O-N 2.97Å; E30-M32 VanDerWaalsContact C-N 3.35Å; E30-M32 PolarHBondContact O-N 3.45Å; E30-E33 PolarHBondContact O-N 2.96Å; E30-K34 WeakPolarHBondContact O-CB 3.48Å; E30-K34 PolarHBondContact O-N 3.46Å
31	E	95.6	Very high	94.2	Very high	85 Å²	85	105 Å²	105	40%	0.397	53%	0.527	S	S	.	.	H	α-helix	trans	-66.4	-37.6	177.3	-72.2	-67.9	174.8	0	0	111.7	K27 L28 K34 I35	K27-E31 PolarHBondContact O-N 3.38Å; K27-E31 VanDerWaalsContact O-N 3.08Å; L28-E31 PolarHBondContact O-N 3.21Å; E31-K34 PolarHBondContact O-N 3.39Å; E31-K34 IonicContact OE2-NZ 3.42Å; E31-K34 PolarHBondContact OE2-NZ 2.91Å; E31-I35 VanDerWaalsContact O-CG1 3.28Å; E31-I35 WeakPolarHBondContact O-CG1 3.43Å; E31-I35 PolarHBondContact O-N 3.08Å
32	M	93.1	Very high	93.7	Very high	122 Å²	122	105.3 Å²	105.3	60%	0.601	53%	0.527	S	S	*	.	H	α-helix	trans	-65.3	-41.5	175.6	-175.2	176	177.9	0	0	112.1	L28 L29 E30 I35 S36	L28-M32 WeakPolarHBondContact O-CB 3.37Å; L28-M32 PolarHBondContact O-N 2.91Å; L29-M32 PolarHBondContact O-N 3.13Å; E30-M32 VanDerWaalsContact C-N 3.35Å; E30-M32 PolarHBondContact O-N 3.45Å; M32-I35 PolarHBondContact O-N 3.33Å; M32-S36 WeakPolarHBondContact O-CB 3.43Å; M32-S36 PolarHBondContact O-N 2.64Å; M32-S36 PolarHBondContact O-OG 2.92Å
33	E	93.6	Very high	93	Very high	134 Å²	134	103 Å²	103	63%	0.626	52%	0.522	S	S	*	.	H	α-helix	trans	-60.6	-49.2	174.8	-178.8	177	177.9	0	0	110.5	L29 E30 I35 S36 V37	L29-E33 WeakPolarHBondContact O-CB 3.3Å; L29-E33 PolarHBondContact O-N 2.92Å; E30-E33 PolarHBondContact O-N 2.96Å; E33-I35 PolarHBondContact O-N 3.28Å; E33-S36 WeakPolarHBondContact O-CB 3.35Å; E33-S36 PolarHBondContact O-N 3.46Å; E33-S36 VanDerWaalsContact O-N 3.1Å; E33-V37 WeakPolarHBondContact O-CG2 3.5Å; E33-V37 PolarHBondContact O-N 2.94Å
34	K	93.5	Very high	92.2	Very high	105 Å²	105	104.1 Å²	104.1	46%	0.457	52%	0.524	S	S	.	.	H	α-helix	trans	-57.2	-46.2	177.8	177.4	-177.2	164.7	-161.4	0	112.3	E30 E31 S36 V37 Q38	E30-K34 WeakPolarHBondContact O-CB 3.48Å; E30-K34 PolarHBondContact O-N 3.46Å; E31-K34 PolarHBondContact O-N 3.39Å; E31-K34 IonicContact OE2-NZ 3.42Å; E31-K34 PolarHBondContact OE2-NZ 2.91Å; K34-S36 VanDerWaalsContact C-N 3.32Å; K34-S36 PolarHBondContact O-N 2.77Å; K34-V37 PolarHBondContact O-N 3.37Å; K34-Q38 WeakPolarHBondContact O-CB 3.39Å; K34-Q38 WeakPolarHBondContact O-CG 3.4Å; K34-Q38 PolarHBondContact O-N 3.27Å
35	I	92.2	Very high	91.5	Very high	106 Å²	106	102.5 Å²	102.5	54%	0.544	52%	0.516	S	S	.	.	H	α-helix	trans	-63	-41.7	177.1	-69.7	166.3	0	0	0	110.4	E31 M32 E33 Q38 A39	E31-I35 VanDerWaalsContact O-CG1 3.28Å; E31-I35 WeakPolarHBondContact O-CG1 3.43Å; E31-I35 PolarHBondContact O-N 3.08Å; M32-I35 PolarHBondContact O-N 3.33Å; E33-I35 PolarHBondContact O-N 3.28Å; I35-Q38 PolarHBondContact O-N 3.48Å; I35-A39 VanDerWaalsContact O-CB 3.3Å; I35-A39 WeakPolarHBondContact O-CB 3.46Å; I35-A39 PolarHBondContact O-N 3.06Å
36	S	91.8	Very high	90.5	Very high	57 Å²	57	102.3 Å²	102.3	40%	0.399	51%	0.513	S	S	.	.	H	α-helix	trans	-63.8	-43.7	-179.3	-60.2	0	0	0	0	111.9	M32 E33 K34 T40	M32-S36 WeakPolarHBondContact O-CB 3.43Å; M32-S36 PolarHBondContact O-N 2.64Å; M32-S36 PolarHBondContact O-OG 2.92Å; E33-S36 WeakPolarHBondContact O-CB 3.35Å; E33-S36 PolarHBondContact O-N 3.46Å; E33-S36 VanDerWaalsContact O-N 3.1Å; K34-S36 VanDerWaalsContact C-N 3.32Å; K34-S36 PolarHBondContact O-N 2.77Å; S36-T40 WeakPolarHBondContact O-CB 3.37Å; S36-T40 PolarHBondContact O-N 3.25Å; S36-T40 PolarHBondContact O-OG1 3Å
37	V	94.2	Very high	89.6	Confident	69 Å²	69	101.1 Å²	101.1	42%	0.418	51%	0.513	S	S	.	.	H	α-helix	trans	-62.2	-50.1	174.9	171.7	0	0	0	0	110.1	E33 K34 A39 T40 W41	E33-V37 WeakPolarHBondContact O-CG2 3.5Å; E33-V37 PolarHBondContact O-N 2.94Å; K34-V37 PolarHBondContact O-N 3.37Å; V37-A39 PolarHBondContact O-N 3.11Å; V37-T40 PolarHBondContact O-N 3.41Å; V37-W41 PolarHBondContact O-N 2.75Å
38	Q	90.1	Very high	88.5	Confident	106 Å²	106	97.8 Å²	97.8	50%	0.495	50%	0.503	S	S	.	.	H	α-helix	trans	-59.8	-46.4	179.6	-74.1	-178.1	-12.1	0	0	112.5	K34 I35 T40 W41 M42	K34-Q38 WeakPolarHBondContact O-CB 3.39Å; K34-Q38 WeakPolarHBondContact O-CG 3.4Å; K34-Q38 PolarHBondContact O-N 3.27Å; I35-Q38 PolarHBondContact O-N 3.48Å; Q38-T40 VanDerWaalsContact C-N 3.29Å; Q38-T40 PolarHBondContact O-N 3.37Å; Q38-W41 PolarHBondContact O-N 2.79Å; Q38-M42 WeakPolarHBondContact O-CB 3.33Å; Q38-M42 VanDerWaalsContact O-CG 3.23Å; Q38-M42 WeakPolarHBondContact O-CG 3.29Å; Q38-M42 PolarHBondContact O-N 2.83Å
39	A	88.9	Confident	87.2	Confident	54 Å²	54	98.6 Å²	98.6	45%	0.446	51%	0.506	S	S	.	.	H	α-helix	trans	-61.1	-39.3	178.3	0	0	0	0	0	111.9	I35 V37 M42 A43	I35-A39 VanDerWaalsContact O-CB 3.3Å; I35-A39 WeakPolarHBondContact O-CB 3.46Å; I35-A39 PolarHBondContact O-N 3.06Å; V37-A39 PolarHBondContact O-N 3.11Å; A39-M42 PolarHBondContact O-N 3.38Å; A39-A43 WeakPolarHBondContact O-CB 3.4Å; A39-A43 PolarHBondContact O-N 3.49Å
40	T	90.8	Very high	85.8	Confident	96 Å²	96	102.4 Å²	102.4	59%	0.589	51%	0.513	S	S	*	.	H	α-helix	trans	-65	-47	177.1	-57.2	0	0	0	0	111.4	S36 V37 Q38 A43 Y44	S36-T40 WeakPolarHBondContact O-CB 3.37Å; S36-T40 PolarHBondContact O-N 3.25Å; S36-T40 PolarHBondContact O-OG1 3Å; V37-T40 PolarHBondContact O-N 3.41Å; Q38-T40 VanDerWaalsContact C-N 3.29Å; Q38-T40 PolarHBondContact O-N 3.37Å; T40-A43 PolarHBondContact O-N 3.23Å; T40-Y44 WeakPolarHBondContact O-CB 3.14Å; T40-Y44 PolarHBondContact O-N 2.89Å
41	W	88.3	Confident	84.3	Confident	159 Å²	159	101.8 Å²	101.8	60%	0.602	52%	0.518	S	S	*	.	H	α-helix	trans	-61.8	-44.7	175.8	-78.7	108.7	0	0	0	112	V37 Q38 A43 Y44 D45	V37-W41 PolarHBondContact O-N 2.75Å; Q38-W41 PolarHBondContact O-N 2.79Å; W41-A43 VanDerWaalsContact C-N 3.33Å; W41-A43 PolarHBondContact O-N 2.71Å; W41-Y44 PolarHBondContact O-N 2.84Å; W41-D45 WeakPolarHBondContact O-CB 3.31Å; W41-D45 PolarHBondContact O-N 3.45Å
42	M	86.8	Confident	82.9	Confident	122 Å²	122	100.9 Å²	100.9	60%	0.601	52%	0.515	S	S	*	.	H	α-helix	trans	-61.9	-40.8	177.1	-71.4	176.4	71.1	0	0	112	Q38 A39 M46	Q38-M42 WeakPolarHBondContact O-CB 3.33Å; Q38-M42 VanDerWaalsContact O-CG 3.23Å; Q38-M42 WeakPolarHBondContact O-CG 3.29Å; Q38-M42 PolarHBondContact O-N 2.83Å; A39-M42 PolarHBondContact O-N 3.38Å; M42-M46 WeakPolarHBondContact O-CB 3.36Å; M42-M46 PolarHBondContact O-N 2.82Å
43	A	81.3	Confident	81.6	Confident	54 Å²	54	98.7 Å²	98.7	45%	0.446	51%	0.51	S	S	.	.	H	α-helix	trans	-65.6	-44.7	175.8	0	0	0	0	0	111.3	A39 T40 W41 M46 V47	A39-A43 WeakPolarHBondContact O-CB 3.4Å; A39-A43 PolarHBondContact O-N 3.49Å; T40-A43 PolarHBondContact O-N 3.23Å; W41-A43 VanDerWaalsContact C-N 3.33Å; W41-A43 PolarHBondContact O-N 2.71Å; A43-M46 PolarHBondContact O-N 3.17Å; A43-V47 WeakPolarHBondContact O-CB 2.91Å; A43-V47 VanDerWaalsContact O-CG2 3.26Å; A43-V47 WeakPolarHBondContact O-CG2 3.47Å; A43-V47 PolarHBondContact O-N 3.26Å
44	Y	80.5	Confident	80.8	Confident	144 Å²	144	96.3 Å²	96.3	57%	0.565	51%	0.505	S	S	*	.	H	α-helix	trans	-60.9	-52.5	177	-179.7	-98.6	0	0	0	111.8	T40 W41 M46 V47 V48	T40-Y44 WeakPolarHBondContact O-CB 3.14Å; T40-Y44 PolarHBondContact O-N 2.89Å; W41-Y44 PolarHBondContact O-N 2.84Å; Y44-M46 VanDerWaalsContact C-N 3.32Å; Y44-M46 PolarHBondContact O-N 3.26Å; Y44-V47 PolarHBondContact O-N 3.38Å; Y44-V47 VanDerWaalsContact O-N 3.17Å; Y44-V48 HydrophobicContact CD1-CG2 4.05Å; Y44-V48 HydrophobicContact CD2-CG2 4.32Å; Y44-V48 HydrophobicContact CE1-CG2 3.64Å; Y44-V48 HydrophobicContact CE2-CG2 3.93Å; Y44-V48 HydrophobicContact CG-CG2 4.38Å; Y44-V48 WeakPolarHBondContact O-CG2 3.49Å; Y44-V48 PolarHBondContact O-N 3.42Å
45	D	83.3	Confident	79.9	Confident	81 Å²	81	95.1 Å²	95.1	43%	0.433	50%	0.503	S	S	.	.	H	α-helix	trans	-58.8	-44.4	178.2	-79.9	-1.2	0	0	0	111.1	W41 V47 V48 M49	W41-D45 WeakPolarHBondContact O-CB 3.31Å; W41-D45 PolarHBondContact O-N 3.45Å; D45-V47 VanDerWaalsContact C-N 3.32Å; D45-V47 PolarHBondContact O-N 2.93Å; D45-V48 PolarHBondContact O-N 3.06Å; D45-M49 WeakPolarHBondContact O-CB 3.46Å; D45-M49 WeakPolarHBondContact O-CG 3.28Å; D45-M49 PolarHBondContact O-N 3.22Å
46	M	76.4	Confident	79.2	Confident	85 Å²	85	93.2 Å²	93.2	42%	0.419	50%	0.503	S	S	.	.	H	α-helix	trans	-64.6	-36.8	179.2	-168.5	-178.5	-55.6	0	0	112.1	M42 A43 Y44 R50	M42-M46 WeakPolarHBondContact O-CB 3.36Å; M42-M46 PolarHBondContact O-N 2.82Å; A43-M46 PolarHBondContact O-N 3.17Å; Y44-M46 VanDerWaalsContact C-N 3.32Å; Y44-M46 PolarHBondContact O-N 3.26Å; M46-R50 VanDerWaalsContact CG-CZ 3.49Å; M46-R50 VanDerWaalsContact CG-NH1 3.32Å; M46-R50 WeakPolarHBondContact O-CB 3.33Å; M46-R50 WeakPolarHBondContact O-CG 3.48Å; M46-R50 PolarHBondContact O-N 3.08Å; M46-R50 VanDerWaalsContact O-N 3.08Å; M46-R50 VanDerWaalsContact SD-CZ 3.55Å; M46-R50 PolarHBondContact SD-NH1 2.99Å
47	V	75.9	Confident	78.8	Confident	83 Å²	83	96 Å²	96	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-67.9	-54.6	172.8	171.5	0	0	0	0	109.7	A43 Y44 D45 M49 R50 T51	A43-V47 WeakPolarHBondContact O-CB 2.91Å; A43-V47 VanDerWaalsContact O-CG2 3.26Å; A43-V47 WeakPolarHBondContact O-CG2 3.47Å; A43-V47 PolarHBondContact O-N 3.26Å; Y44-V47 PolarHBondContact O-N 3.38Å; Y44-V47 VanDerWaalsContact O-N 3.17Å; D45-V47 VanDerWaalsContact C-N 3.32Å; D45-V47 PolarHBondContact O-N 2.93Å; V47-M49 VanDerWaalsContact C-N 3.3Å; V47-M49 PolarHBondContact O-N 3.05Å; V47-R50 CarbonylContact O-C 3.58Å; V47-R50 PolarHBondContact O-N 3.3Å; V47-T51 HydrophobicContact CG1-CG2 3.7Å; V47-T51 WeakPolarHBondContact O-CB 3.35Å; V47-T51 WeakPolarHBondContact O-CG2 3.41Å; V47-T51 PolarHBondContact O-N 3.38Å; V47-T51 PolarHBondContact O-OG1 3.44Å
48	V	74.9	Confident	78.2	Confident	59 Å²	59	95.8 Å²	95.8	36%	0.358	51%	0.511	S	S	.	.	H	α-helix	trans	-53.3	-47.6	179.9	170.1	0	0	0	0	111.7	Y44 D45 R50 N52	Y44-V48 HydrophobicContact CD1-CG2 4.05Å; Y44-V48 HydrophobicContact CD2-CG2 4.32Å; Y44-V48 HydrophobicContact CE1-CG2 3.64Å; Y44-V48 HydrophobicContact CE2-CG2 3.93Å; Y44-V48 HydrophobicContact CG-CG2 4.38Å; Y44-V48 WeakPolarHBondContact O-CG2 3.49Å; Y44-V48 PolarHBondContact O-N 3.42Å; D45-V48 PolarHBondContact O-N 3.06Å; V48-R50 PolarHBondContact O-N 2.77Å; V48-N52 PolarHBondContact O-N 3.32Å
49	M	67.4	Low	77.7	Confident	134 Å²	134	96.4 Å²	96.4	66%	0.66	52%	0.516	S	S	*	.	H	α-helix	trans	-69.1	-31.7	-179.7	-64.8	-66.7	166.7	0	0	112.8	D45 V47	D45-M49 WeakPolarHBondContact O-CB 3.46Å; D45-M49 WeakPolarHBondContact O-CG 3.28Å; D45-M49 PolarHBondContact O-N 3.22Å; V47-M49 VanDerWaalsContact C-N 3.3Å; V47-M49 PolarHBondContact O-N 3.05Å
50	R	65.9	Low	77.6	Confident	180 Å²	180	102.3 Å²	102.3	68%	0.679	53%	0.526	S	S	*	.	H	α-helix	trans	-92.7	-28.3	-179.9	-72	-174.5	179	147.3	6.5	115.1	M46 V47 V48 N52 P53	M46-R50 VanDerWaalsContact CG-CZ 3.49Å; M46-R50 VanDerWaalsContact CG-NH1 3.32Å; M46-R50 WeakPolarHBondContact O-CB 3.33Å; M46-R50 WeakPolarHBondContact O-CG 3.48Å; M46-R50 PolarHBondContact O-N 3.08Å; M46-R50 VanDerWaalsContact O-N 3.08Å; M46-R50 VanDerWaalsContact SD-CZ 3.55Å; M46-R50 PolarHBondContact SD-NH1 2.99Å; V47-R50 CarbonylContact O-C 3.58Å; V47-R50 PolarHBondContact O-N 3.3Å; V48-R50 PolarHBondContact O-N 2.77Å; R50-N52 VanDerWaalsContact C-N 3.3Å; R50-P53 VanDerWaalsContact C-CD 3.48Å; R50-P53 WeakPolarHBondContact O-CD 3.35Å
51	T	64.9	Low	77.7	Confident	103 Å²	103	105.9 Å²	105.9	63%	0.632	53%	0.529	S	S	*	.	H	α-helix	trans	-80.9	-16.8	176.5	56.8	0	0	0	0	111.6	V47	V47-T51 HydrophobicContact CG1-CG2 3.7Å; V47-T51 WeakPolarHBondContact O-CB 3.35Å; V47-T51 WeakPolarHBondContact O-CG2 3.41Å; V47-T51 PolarHBondContact O-N 3.38Å; V47-T51 PolarHBondContact O-OG1 3.44Å
52	N	66.4	Low	77.9	Confident	65 Å²	65	104.2 Å²	104.2	35%	0.348	53%	0.532	S	S	.	.			trans	-140	49.4	174.6	-138	-18.6	0	0	0	116.4	V48 R50 T54 L55 A56	V48-N52 PolarHBondContact O-N 3.32Å; R50-N52 VanDerWaalsContact C-N 3.3Å; N52-T54 PolarHBondContact O-N 2.88Å; N52-T54 PolarHBondContact OD1-OG1 2.9Å; N52-L55 HydrophobicContact CB-CB 3.81Å; N52-L55 HydrophobicContact CB-CD2 4.32Å; N52-L55 VanDerWaalsContact ND2-CB 3.29Å; N52-L55 WeakPolarHBondContact ND2-CB 3.37Å; N52-L55 WeakPolarHBondContact ND2-CD2 3.1Å; N52-L55 PolarHBondContact O-N 3.48Å; N52-L55 WeakPolarHBondContact OD1-CA 3.41Å; N52-L55 WeakPolarHBondContact OD1-CB 3.09Å; N52-L55 PolarHBondContact OD1-N 3.02Å; N52-A56 PolarHBondContact O-N 3.42Å
53	P	66.7	Low	78.1	Confident	76 Å²	76	104.5 Å²	104.5	49%	0.494	53%	0.531	S	S	.	.	H	α-helix	trans	-60.6	-32.7	174.2	26.5	-34.7	0	0	0	111	R50 E57	R50-P53 VanDerWaalsContact C-CD 3.48Å; R50-P53 WeakPolarHBondContact O-CD 3.35Å; P53-E57 PolarHBondContact O-N 3.43Å
54	T	76.4	Confident	78.8	Confident	84 Å²	84	106 Å²	106	52%	0.515	53%	0.532	S	S	.	.	H	α-helix	trans	-72.2	-25.1	175.8	48.9	0	0	0	0	113.1	N52 S58	N52-T54 PolarHBondContact O-N 2.88Å; N52-T54 PolarHBondContact OD1-OG1 2.9Å; T54-S58 WeakPolarHBondContact O-CA 3.26Å; T54-S58 WeakPolarHBondContact O-CB 3.47Å; T54-S58 PolarHBondContact O-N 2.96Å; T54-S58 PolarHBondContact O-OG 2.74Å
55	L	75.6	Confident	79.6	Confident	80 Å²	80	101.9 Å²	101.9	42%	0.419	53%	0.527	S	S	.	.	H	α-helix	trans	-69.5	-42.7	173.7	172.6	69.4	0	0	0	111.5	N52 E57 S58 M59	N52-L55 HydrophobicContact CB-CB 3.81Å; N52-L55 HydrophobicContact CB-CD2 4.32Å; N52-L55 VanDerWaalsContact ND2-CB 3.29Å; N52-L55 WeakPolarHBondContact ND2-CB 3.37Å; N52-L55 WeakPolarHBondContact ND2-CD2 3.1Å; N52-L55 PolarHBondContact O-N 3.48Å; N52-L55 WeakPolarHBondContact OD1-CA 3.41Å; N52-L55 WeakPolarHBondContact OD1-CB 3.09Å; N52-L55 PolarHBondContact OD1-N 3.02Å; L55-E57 VanDerWaalsContact C-N 3.28Å; L55-E57 PolarHBondContact O-N 2.91Å; L55-S58 PolarHBondContact O-N 2.99Å; L55-M59 HydrophobicContact CD1-CG 3.78Å; L55-M59 HydrophobicContact CD1-SD 4.02Å; L55-M59 HydrophobicContact CG-CG 4.18Å; L55-M59 HydrophobicContact CG-SD 4.08Å; L55-M59 WeakPolarHBondContact O-CB 3.2Å; L55-M59 VanDerWaalsContact O-CG 3.28Å; L55-M59 WeakPolarHBondContact O-CG 3.16Å; L55-M59 PolarHBondContact O-N 3.1Å
56	A	76.9	Confident	80	Confident	66 Å²	66	104.9 Å²	104.9	55%	0.545	54%	0.537	S	S	.	.	H	α-helix	trans	-59.3	-43.9	175.5	0	0	0	0	0	110.8	N52 R60	N52-A56 PolarHBondContact O-N 3.42Å; A56-R60 WeakPolarHBondContact O-CB 3.41Å; A56-R60 PolarHBondContact O-N 2.95Å; A56-R60 VanDerWaalsContact O-N 3.11Å
57	E	82.4	Confident	80.9	Confident	116 Å²	116	103.7 Å²	103.7	54%	0.542	53%	0.534	S	S	.	.	H	α-helix	trans	-66.3	-42.2	174.8	-171	-179.5	174	0	0	112.7	P53 L55 R60 R61	P53-E57 PolarHBondContact O-N 3.43Å; L55-E57 VanDerWaalsContact C-N 3.28Å; L55-E57 PolarHBondContact O-N 2.91Å; E57-R60 PolarHBondContact O-N 3.48Å; E57-R61 WeakPolarHBondContact O-CG 3.22Å; E57-R61 PolarHBondContact O-N 3.46Å
58	S	81.9	Confident	81.9	Confident	64 Å²	64	104.3 Å²	104.3	45%	0.448	54%	0.535	S	S	.	.	H	α-helix	trans	-68.1	-38.7	179.8	-61.1	0	0	0	0	112.1	T54 L55 R61 L62	T54-S58 WeakPolarHBondContact O-CA 3.26Å; T54-S58 WeakPolarHBondContact O-CB 3.47Å; T54-S58 PolarHBondContact O-N 2.96Å; T54-S58 PolarHBondContact O-OG 2.74Å; L55-S58 PolarHBondContact O-N 2.99Å; S58-R61 PolarHBondContact O-N 3.47Å; S58-L62 VanDerWaalsContact O-CB 3.31Å; S58-L62 WeakPolarHBondContact O-CB 3.4Å; S58-L62 PolarHBondContact O-N 2.84Å
59	M	79.6	Confident	82.9	Confident	120 Å²	120	105.4 Å²	105.4	59%	0.591	54%	0.544	S	S	*	.	H	α-helix	trans	-65.1	-42.8	174.5	-73.8	-171.1	76.9	0	0	111	L55 L62 E63	L55-M59 HydrophobicContact CD1-CG 3.78Å; L55-M59 HydrophobicContact CD1-SD 4.02Å; L55-M59 HydrophobicContact CG-CG 4.18Å; L55-M59 HydrophobicContact CG-SD 4.08Å; L55-M59 WeakPolarHBondContact O-CB 3.2Å; L55-M59 VanDerWaalsContact O-CG 3.28Å; L55-M59 WeakPolarHBondContact O-CG 3.16Å; L55-M59 PolarHBondContact O-N 3.1Å; M59-L62 PolarHBondContact O-N 3.35Å; M59-E63 WeakPolarHBondContact O-CB 3.33Å; M59-E63 PolarHBondContact O-N 3.35Å
60	R	87.5	Confident	84.1	Confident	177 Å²	177	106 Å²	106	67%	0.668	54%	0.543	S	S	*	.	H	α-helix	trans	-61.2	-47.9	174.5	-171.2	-177.6	-66	177.7	-1.2	111.6	A56 E57 L62 E63 D64	A56-R60 WeakPolarHBondContact O-CB 3.41Å; A56-R60 PolarHBondContact O-N 2.95Å; A56-R60 VanDerWaalsContact O-N 3.11Å; E57-R60 PolarHBondContact O-N 3.48Å; R60-L62 VanDerWaalsContact C-N 3.27Å; R60-L62 PolarHBondContact O-N 3Å; R60-E63 PolarHBondContact O-N 3.15Å; R60-D64 PolarHBondContact O-N 3.39Å
61	R	92.4	Very high	85.6	Confident	172 Å²	172	102.1 Å²	102.1	65%	0.649	53%	0.532	S	S	*	.	H	α-helix	trans	-60.5	-36.2	176.5	-73.5	175.9	65.7	-171.9	-0.6	112.7	E57 S58 A65	E57-R61 WeakPolarHBondContact O-CG 3.22Å; E57-R61 PolarHBondContact O-N 3.46Å; S58-R61 PolarHBondContact O-N 3.47Å; R61-A65 WeakPolarHBondContact O-CB 3.43Å; R61-A65 PolarHBondContact O-N 3.47Å; R61-A65 VanDerWaalsContact O-N 3.08Å
62	L	92.3	Very high	87.1	Confident	124 Å²	124	101.6 Å²	101.6	65%	0.649	52%	0.523	S	S	*	.	H	α-helix	trans	-68.6	-43.4	176.3	178.8	62.9	0	0	0	111.5	S58 M59 R60 A65 F66	S58-L62 VanDerWaalsContact O-CB 3.31Å; S58-L62 WeakPolarHBondContact O-CB 3.4Å; S58-L62 PolarHBondContact O-N 2.84Å; M59-L62 PolarHBondContact O-N 3.35Å; R60-L62 VanDerWaalsContact C-N 3.27Å; R60-L62 PolarHBondContact O-N 3Å; L62-A65 PolarHBondContact O-N 3.27Å; L62-F66 WeakPolarHBondContact O-CB 3.43Å; L62-F66 PolarHBondContact O-N 3.5Å
63	E	92.4	Very high	88.3	Confident	128 Å²	128	105 Å²	105	60%	0.598	54%	0.538	S	S	*	.	H	α-helix	trans	-60.8	-49	175.9	-175.5	175	-162.2	0	0	111.2	M59 R60 A65 F66 V67	M59-E63 WeakPolarHBondContact O-CB 3.33Å; M59-E63 PolarHBondContact O-N 3.35Å; R60-E63 PolarHBondContact O-N 3.15Å; E63-A65 VanDerWaalsContact C-N 3.32Å; E63-A65 PolarHBondContact O-N 2.94Å; E63-F66 WeakPolarHBondContact O-CB 3.36Å; E63-F66 PolarHBondContact O-N 3.39Å; E63-F66 VanDerWaalsContact O-N 3.13Å; E63-V67 WeakPolarHBondContact O-CG2 3.09Å; E63-V67 PolarHBondContact O-N 2.99Å
64	D	95.8	Very high	89.7	Confident	86 Å²	86	106.2 Å²	106.2	46%	0.46	54%	0.537	S	S	.	.	H	α-helix	trans	-58.4	-44.1	176.6	-68.1	-22.8	0	0	0	111.6	R60 F66 V67 N68	R60-D64 PolarHBondContact O-N 3.39Å; D64-F66 VanDerWaalsContact C-N 3.34Å; D64-F66 PolarHBondContact O-N 3.21Å; D64-V67 PolarHBondContact O-N 2.97Å; D64-N68 WeakPolarHBondContact O-CB 3.47Å; D64-N68 VanDerWaalsContact O-CG 3.3Å; D64-N68 PolarHBondContact O-N 3.08Å; D64-N68 PolarHBondContact O-ND2 3.47Å
65	A	95.9	Very high	90.6	Very high	56 Å²	56	107 Å²	107	46%	0.463	53%	0.534	S	S	.	.	H	α-helix	trans	-64.9	-37.8	177.4	0	0	0	0	0	112.4	R61 L62 E63 C69	R61-A65 WeakPolarHBondContact O-CB 3.43Å; R61-A65 PolarHBondContact O-N 3.47Å; R61-A65 VanDerWaalsContact O-N 3.08Å; L62-A65 PolarHBondContact O-N 3.27Å; E63-A65 VanDerWaalsContact C-N 3.32Å; E63-A65 PolarHBondContact O-N 2.94Å; A65-C69 VanDerWaalsContact O-CB 3.3Å; A65-C69 WeakPolarHBondContact O-CB 3.3Å; A65-C69 PolarHBondContact O-N 2.87Å
66	F	92.1	Very high	91.5	Very high	145 Å²	145	107.6 Å²	107.6	64%	0.636	54%	0.537	S	S	*	.	H	α-helix	trans	-67.6	-44.2	177.3	-176.2	-97.6	0	0	0	111.8	L62 E63 D64 C69 K70	L62-F66 WeakPolarHBondContact O-CB 3.43Å; L62-F66 PolarHBondContact O-N 3.5Å; E63-F66 WeakPolarHBondContact O-CB 3.36Å; E63-F66 PolarHBondContact O-N 3.39Å; E63-F66 VanDerWaalsContact O-N 3.13Å; D64-F66 VanDerWaalsContact C-N 3.34Å; D64-F66 PolarHBondContact O-N 3.21Å; F66-C69 PolarHBondContact O-N 2.96Å; F66-K70 WeakPolarHBondContact O-CB 3.23Å; F66-K70 PolarHBondContact O-N 3.39Å
67	V	95.4	Very high	92.4	Very high	60 Å²	60	111.4 Å²	111.4	36%	0.364	54%	0.537	S	S	.	.	H	α-helix	trans	-61.6	-49.1	176	172.6	0	0	0	0	110.5	E63 D64 C69 K70 E71	E63-V67 WeakPolarHBondContact O-CG2 3.09Å; E63-V67 PolarHBondContact O-N 2.99Å; D64-V67 PolarHBondContact O-N 2.97Å; V67-C69 VanDerWaalsContact C-N 3.33Å; V67-C69 PolarHBondContact O-N 3.26Å; V67-K70 WeakPolarHBondContact O-CB 3.42Å; V67-K70 PolarHBondContact O-N 3.37Å; V67-K70 VanDerWaalsContact O-N 3.17Å; V67-E71 HydrophobicContact CG1-CG 4.47Å; V67-E71 WeakPolarHBondContact O-CG 3.33Å; V67-E71 PolarHBondContact O-N 3.37Å
68	N	97	Very high	93	Very high	96 Å²	96	110.7 Å²	110.7	51%	0.513	53%	0.534	S	S	.	.	H	α-helix	trans	-57.6	-45.4	176.6	-76	-17.7	0	0	0	112	D64 K70 E71 E72	D64-N68 WeakPolarHBondContact O-CB 3.47Å; D64-N68 VanDerWaalsContact O-CG 3.3Å; D64-N68 PolarHBondContact O-N 3.08Å; D64-N68 PolarHBondContact O-ND2 3.47Å; N68-K70 VanDerWaalsContact C-N 3.34Å; N68-K70 PolarHBondContact O-N 2.98Å; N68-E71 PolarHBondContact O-N 3Å; N68-E72 WeakPolarHBondContact O-CG 3.47Å; N68-E72 PolarHBondContact O-N 3Å
69	C	96.4	Very high	93.6	Very high	81 Å²	81	113.2 Å²	113.2	55%	0.547	54%	0.539	S	S	.	.	H	α-helix	trans	-59.8	-45.1	177.5	-179.2	0	0	0	0	111.7	A65 F66 V67 E71 E72 M73	A65-C69 VanDerWaalsContact O-CB 3.3Å; A65-C69 WeakPolarHBondContact O-CB 3.3Å; A65-C69 PolarHBondContact O-N 2.87Å; F66-C69 PolarHBondContact O-N 2.96Å; V67-C69 VanDerWaalsContact C-N 3.33Å; V67-C69 PolarHBondContact O-N 3.26Å; C69-E71 VanDerWaalsContact C-N 3.34Å; C69-E71 PolarHBondContact O-N 3.09Å; C69-E72 PolarHBondContact O-N 3.39Å; C69-M73 VanDerWaalsContact O-CB 3.31Å; C69-M73 WeakPolarHBondContact O-CB 3.48Å; C69-M73 PolarHBondContact O-N 2.95Å
70	K	92.7	Very high	94.3	Very high	147 Å²	147	111.6 Å²	111.6	64%	0.639	53%	0.532	S	S	*	.	H	α-helix	trans	-60.8	-44.2	177.6	-178.4	-172.8	173.1	-171.4	0	111.5	F66 V67 N68 M73 E74	F66-K70 WeakPolarHBondContact O-CB 3.23Å; F66-K70 PolarHBondContact O-N 3.39Å; V67-K70 WeakPolarHBondContact O-CB 3.42Å; V67-K70 PolarHBondContact O-N 3.37Å; V67-K70 VanDerWaalsContact O-N 3.17Å; N68-K70 VanDerWaalsContact C-N 3.34Å; N68-K70 PolarHBondContact O-N 2.98Å; K70-M73 PolarHBondContact O-N 3.47Å; K70-E74 WeakPolarHBondContact O-CB 3.41Å; K70-E74 PolarHBondContact O-N 3.48Å
71	E	96.3	Very high	94.5	Very high	99 Å²	99	106 Å²	106	46%	0.463	52%	0.515	S	S	.	.	H	α-helix	trans	-65	-44.2	178.7	-72.3	-179.6	-179.1	0	0	112.1	V67 N68 C69 M73 E74 K75	V67-E71 HydrophobicContact CG1-CG 4.47Å; V67-E71 WeakPolarHBondContact O-CG 3.33Å; V67-E71 PolarHBondContact O-N 3.37Å; N68-E71 PolarHBondContact O-N 3Å; C69-E71 VanDerWaalsContact C-N 3.34Å; C69-E71 PolarHBondContact O-N 3.09Å; E71-M73 VanDerWaalsContact C-N 3.33Å; E71-M73 PolarHBondContact O-N 3.38Å; E71-E74 PolarHBondContact O-N 3.42Å; E71-K75 WeakPolarHBondContact O-CG 3.34Å; E71-K75 PolarHBondContact O-N 3.43Å
72	E	96.4	Very high	94.5	Very high	91 Å²	91	103 Å²	103	43%	0.425	51%	0.508	S	S	.	.	H	α-helix	trans	-64.4	-39.1	175.3	-69.5	-57.6	122.1	0	0	111.6	N68 C69 E74 K75 N76	N68-E72 WeakPolarHBondContact O-CG 3.47Å; N68-E72 PolarHBondContact O-N 3Å; C69-E72 PolarHBondContact O-N 3.39Å; E72-E74 VanDerWaalsContact C-N 3.33Å; E72-E74 PolarHBondContact O-N 3.04Å; E72-K75 PolarHBondContact O-N 3.32Å; E72-K75 IonicContact OE1-NZ 2.71Å; E72-K75 PolarHBondContact OE1-NZ 2.99Å; E72-N76 WeakPolarHBondContact O-CB 3.5Å; E72-N76 PolarHBondContact O-N 3.25Å; E72-N76 PolarHBondContact O-ND2 3.48Å
73	M	93.1	Very high	94.4	Very high	138 Å²	138	102.9 Å²	102.9	68%	0.68	51%	0.505	S	S	*	.	H	α-helix	trans	-64.3	-39.6	175.9	-153.5	-178.8	93.1	0	0	111.7	C69 K70 E71 W77	C69-M73 VanDerWaalsContact O-CB 3.31Å; C69-M73 WeakPolarHBondContact O-CB 3.48Å; C69-M73 PolarHBondContact O-N 2.95Å; K70-M73 PolarHBondContact O-N 3.47Å; E71-M73 VanDerWaalsContact C-N 3.33Å; E71-M73 PolarHBondContact O-N 3.38Å; M73-W77 WeakPolarHBondContact O-CB 3.4Å; M73-W77 PolarHBondContact O-N 3.41Å
74	E	94.4	Very high	94.2	Very high	100 Å²	100	101 Å²	101	47%	0.467	50%	0.502	S	S	.	.	H	α-helix	trans	-64.7	-45.5	174	-176.2	61.4	-142.6	0	0	111.4	K70 E71 E72 N76 W77 Q78	K70-E74 WeakPolarHBondContact O-CB 3.41Å; K70-E74 PolarHBondContact O-N 3.48Å; E71-E74 PolarHBondContact O-N 3.42Å; E72-E74 VanDerWaalsContact C-N 3.33Å; E72-E74 PolarHBondContact O-N 3.04Å; E74-N76 PolarHBondContact O-N 2.92Å; E74-W77 WeakPolarHBondContact O-CB 3.28Å; E74-W77 PolarHBondContact O-N 3.03Å; E74-Q78 WeakPolarHBondContact O-CG 3.42Å; E74-Q78 PolarHBondContact O-N 3.02Å; E74-Q78 PolarHBondContact OE1-NE2 3.44Å
75	K	96.4	Very high	93.3	Very high	102 Å²	102	105.4 Å²	105.4	44%	0.443	52%	0.517	S	S	.	.	H	α-helix	trans	-58.1	-50.9	175.7	-71.5	173.1	-166.7	166.1	0	111.5	E71 E72 W77 Q78 E79	E71-K75 WeakPolarHBondContact O-CG 3.34Å; E71-K75 PolarHBondContact O-N 3.43Å; E72-K75 PolarHBondContact O-N 3.32Å; E72-K75 IonicContact OE1-NZ 2.71Å; E72-K75 PolarHBondContact OE1-NZ 2.99Å; K75-W77 PolarHBondContact O-N 3.47Å; K75-Q78 PolarHBondContact O-N 2.92Å; K75-Q78 VanDerWaalsContact O-N 3.12Å; K75-E79 WeakPolarHBondContact O-CG 3.4Å; K75-E79 PolarHBondContact O-N 2.97Å
76	N	95.3	Very high	92.1	Very high	91 Å²	91	109.1 Å²	109.1	49%	0.487	53%	0.525	S	S	.	.	H	α-helix	trans	-57.8	-38.8	177.9	-69.7	-23.4	0	0	0	111.7	E72 E74 L80	E72-N76 WeakPolarHBondContact O-CB 3.5Å; E72-N76 PolarHBondContact O-N 3.25Å; E72-N76 PolarHBondContact O-ND2 3.48Å; E74-N76 PolarHBondContact O-N 2.92Å; N76-L80 WeakPolarHBondContact O-CB 3.48Å; N76-L80 PolarHBondContact O-N 2.92Å
77	W	94.8	Very high	90.3	Very high	146 Å²	146	112 Å²	112	55%	0.553	53%	0.531	S	S	*	.	H	α-helix	trans	-65.7	-44.9	176.4	-177.7	-111.7	0	0	0	112.3	M73 E74 K75 E79 L80 L81	M73-W77 WeakPolarHBondContact O-CB 3.4Å; M73-W77 PolarHBondContact O-N 3.41Å; E74-W77 WeakPolarHBondContact O-CB 3.28Å; E74-W77 PolarHBondContact O-N 3.03Å; K75-W77 PolarHBondContact O-N 3.47Å; W77-E79 VanDerWaalsContact C-N 3.35Å; W77-E79 PolarHBondContact O-N 3.06Å; W77-L80 HydrophobicContact CE3-CD2 4.31Å; W77-L80 HydrophobicContact CZ3-CD2 4.05Å; W77-L80 PolarHBondContact O-N 3.18Å; W77-L81 HydrophobicContact CZ2-CD2 4.31Å; W77-L81 WeakPolarHBondContact O-CG 3.45Å; W77-L81 PolarHBondContact O-N 3.06Å
78	Q	94.5	Very high	88.5	Confident	102 Å²	102	118.6 Å²	118.6	48%	0.477	58%	0.575	S	S	.	*	H	α-helix	trans	-63.3	-39.6	176.4	-66.2	-61.4	-28.2	0	0	112.2	E74 K75 L81 H82	E74-Q78 WeakPolarHBondContact O-CG 3.42Å; E74-Q78 PolarHBondContact O-N 3.02Å; E74-Q78 PolarHBondContact OE1-NE2 3.44Å; K75-Q78 PolarHBondContact O-N 2.92Å; K75-Q78 VanDerWaalsContact O-N 3.12Å; Q78-L81 PolarHBondContact O-N 3.35Å; Q78-H82 WeakPolarHBondContact O-CB 3.43Å; Q78-H82 PolarHBondContact O-N 3.44Å
79	E	94.9	Very high	88	Confident	116 Å²	116	119.7 Å²	119.7	54%	0.542	58%	0.578	S	S	.	*	H	α-helix	trans	-61.2	-47.9	175.1	-73.9	178.1	-177.7	0	0	111.6	K75 W77 L81 H82 E83	K75-E79 WeakPolarHBondContact O-CG 3.4Å; K75-E79 PolarHBondContact O-N 2.97Å; W77-E79 VanDerWaalsContact C-N 3.35Å; W77-E79 PolarHBondContact O-N 3.06Å; E79-L81 VanDerWaalsContact C-N 3.31Å; E79-L81 PolarHBondContact O-N 3.01Å; E79-H82 WeakPolarHBondContact O-CA 3.47Å; E79-H82 WeakPolarHBondContact O-CB 3.41Å; E79-H82 PolarHBondContact O-N 3.24Å; E79-E83 WeakPolarHBondContact O-CG 3.4Å; E79-E83 PolarHBondContact O-N 2.99Å
80	L	94.2	Very high	87.6	Confident	86 Å²	86	121.7 Å²	121.7	45%	0.45	58%	0.58	S	S	.	*	H	α-helix	trans	-60	-40.9	177.3	-170	114.5	0	0	0	112.3	N76 W77 H82 E83 T84	N76-L80 WeakPolarHBondContact O-CB 3.48Å; N76-L80 PolarHBondContact O-N 2.92Å; W77-L80 HydrophobicContact CE3-CD2 4.31Å; W77-L80 HydrophobicContact CZ3-CD2 4.05Å; W77-L80 PolarHBondContact O-N 3.18Å; L80-H82 VanDerWaalsContact C-N 3.29Å; L80-H82 PolarHBondContact O-N 3.41Å; L80-E83 PolarHBondContact O-N 3.35Å; L80-T84 WeakPolarHBondContact O-CB 3.43Å; L80-T84 WeakPolarHBondContact O-CG2 3.42Å; L80-T84 PolarHBondContact O-N 3.45Å; L80-T84 PolarHBondContact O-OG1 3.04Å
81	L	92.4	Very high	87.3	Confident	60 Å²	60	120.3 Å²	120.3	31%	0.314	58%	0.577	S	S	.	*	H	α-helix	trans	-64	-35	174.8	-72.3	176.1	0	0	0	112.4	W77 Q78 E79 T84 K85	W77-L81 HydrophobicContact CZ2-CD2 4.31Å; W77-L81 WeakPolarHBondContact O-CG 3.45Å; W77-L81 PolarHBondContact O-N 3.06Å; Q78-L81 PolarHBondContact O-N 3.35Å; E79-L81 VanDerWaalsContact C-N 3.31Å; E79-L81 PolarHBondContact O-N 3.01Å; L81-T84 WeakPolarHBondContact CA-OG1 3.42Å; L81-T84 PolarHBondContact O-OG1 3.07Å; L81-T84 VanDerWaalsContact O-OG1 3.11Å; L81-K85 WeakPolarHBondContact O-CB 3.49Å; L81-K85 WeakPolarHBondContact O-CG 3.37Å; L81-K85 PolarHBondContact O-N 3.26Å
82	H	91.8	Very high	86.8	Confident	108 Å²	108	121.6 Å²	121.6	50%	0.5	58%	0.583	S	S	.	*	H	α-helix	trans	-72.6	-44.9	177.5	-172.8	-93.8	0	0	0	111.6	Q78 E79 L80 T84 K85 Q86	Q78-H82 WeakPolarHBondContact O-CB 3.43Å; Q78-H82 PolarHBondContact O-N 3.44Å; E79-H82 WeakPolarHBondContact O-CA 3.47Å; E79-H82 WeakPolarHBondContact O-CB 3.41Å; E79-H82 PolarHBondContact O-N 3.24Å; L80-H82 VanDerWaalsContact C-N 3.29Å; L80-H82 PolarHBondContact O-N 3.41Å; H82-T84 PolarHBondContact O-N 3.03Å; H82-K85 PolarHBondContact O-N 3.26Å; H82-Q86 PolarHBondContact CE1-NE2 3.3Å; H82-Q86 PolarHBondContact NE2-NE2 3.31Å; H82-Q86 WeakPolarHBondContact O-CG 3.39Å; H82-Q86 PolarHBondContact O-N 3.38Å
83	E	91	Very high	86.2	Confident	123 Å²	123	123.5 Å²	123.5	58%	0.575	59%	0.593	S	S	*	*	H	α-helix	trans	-60.3	-43	176	-71.1	-175.5	170.1	0	0	112.6	E79 L80 K85 Q86 R87	E79-E83 WeakPolarHBondContact O-CG 3.4Å; E79-E83 PolarHBondContact O-N 2.99Å; L80-E83 PolarHBondContact O-N 3.35Å; E83-K85 VanDerWaalsContact C-N 3.32Å; E83-K85 PolarHBondContact O-N 3.49Å; E83-Q86 PolarHBondContact O-N 2.93Å; E83-R87 PolarHBondContact O-N 3.05Å
84	T	86.8	Confident	85.7	Confident	88 Å²	88	122.5 Å²	122.5	54%	0.54	59%	0.587	S	S	.	*	H	α-helix	trans	-68.3	-29.5	177.9	48.7	0	0	0	0	112.9	L80 L81 H82	L80-T84 WeakPolarHBondContact O-CB 3.43Å; L80-T84 WeakPolarHBondContact O-CG2 3.42Å; L80-T84 PolarHBondContact O-N 3.45Å; L80-T84 PolarHBondContact O-OG1 3.04Å; L81-T84 WeakPolarHBondContact CA-OG1 3.42Å; L81-T84 PolarHBondContact O-OG1 3.07Å; L81-T84 VanDerWaalsContact O-OG1 3.11Å; H82-T84 PolarHBondContact O-N 3.03Å
85	K	78.5	Confident	85.1	Confident	178 Å²	178	124.1 Å²	124.1	77%	0.774	60%	0.596	S	S	*	*	H	α-helix	trans	-74.8	-24.7	171.2	-80.9	179.2	179.6	176.7	0	113.9	L81 H82 E83	L81-K85 WeakPolarHBondContact O-CB 3.49Å; L81-K85 WeakPolarHBondContact O-CG 3.37Å; L81-K85 PolarHBondContact O-N 3.26Å; H82-K85 PolarHBondContact O-N 3.26Å; E83-K85 VanDerWaalsContact C-N 3.32Å; E83-K85 PolarHBondContact O-N 3.49Å
86	Q	70.6	Confident	84.2	Confident	134 Å²	134	125.8 Å²	125.8	63%	0.626	61%	0.608	S	S	*	*	H	α-helix	trans	-91.3	-13.2	-178.3	-72.4	-165.5	-18.5	0	0	114.2	H82 E83 P88	H82-Q86 PolarHBondContact CE1-NE2 3.3Å; H82-Q86 PolarHBondContact NE2-NE2 3.31Å; H82-Q86 WeakPolarHBondContact O-CG 3.39Å; H82-Q86 PolarHBondContact O-N 3.38Å; E83-Q86 PolarHBondContact O-N 2.93Å; Q86-P88 WeakPolarHBondContact O-CD 3.3Å
87	R	54.2	Low	83.3	Confident	206 Å²	206	128.8 Å²	128.8	78%	0.777	62%	0.618	S	S	*	*			trans	-76.3	121.6	168.3	-90.4	-177.1	-161.6	-146.8	5.4	110.1	E83	E83-R87 PolarHBondContact O-N 3.05Å
88	P	55.9	Low	82.3	Confident	198 Å²	198	127.2 Å²	127.2	100%	1.286	62%	0.624	S	S	*	*			trans	-67.2	0	173.3	28.7	-33.2	0	0	0	112.6	Q86	Q86-P88 WeakPolarHBondContact O-CD 3.3Å

Retrieved 88 of 88 residues in 24.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).