A0A2K5N9G4_CERAT Loading...

Vesicle associated membrane protein 3

AlphaFold DB , UniProt , Accession A0A2K5N9G4, Species CERAT (Cercocebus atys, Sooty mangabey), Gene VAMP3, Length 100 aa.

						>A0A2K5N9G4_CERAT|A0A2K5N9G4|VAMP3
MSTGPTAAPGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	46.8	Very low	245 Å²	245	119.5 Å²	119.5	100%	1.207	82%	0.824	S	S	*	*				0	117.9	0	-164.3	111.3	152.2	0	0	108
2	S	45.2	Very low	47	Very low	103 Å²	103	117 Å²	117	72%	0.72	80%	0.795	S	S	*	*			trans	64.6	107.5	159.4	-138.1	0	0	0	0	120.9
3	T	46.2	Very low	47.4	Very low	137 Å²	137	124.2 Å²	124.2	84%	0.84	80%	0.795	S	S	*	*				165.1	139.1	97.4	41.1	0	0	0	0	110.6
4	G	43.9	Very low	47.6	Very low	66 Å²	66	131.9 Å²	131.9	68%	0.68	80%	0.8	S	S	*	*			trans	-83.8	-170.4	-163.5	0	0	0	0	0	117.6
5	P	50.6	Low	47.6	Very low	136 Å²	136	131.8 Å²	131.8	88%	0.883	79%	0.793	S	S	*	*			trans	-88.3	141.7	-163.5	34.7	-32	0	0	0	112.7
6	T	49.5	Very low	47.5	Very low	143 Å²	143	131.9 Å²	131.9	88%	0.877	78%	0.782	S	S	*	*			trans	-105.8	116.5	172.3	-18.1	0	0	0	0	110.2
7	A	41.4	Very low	47.6	Very low	95 Å²	95	134.1 Å²	134.1	79%	0.785	78%	0.783	S	S	*	*			trans	-58	161.4	163.8	0	0	0	0	0	110.8
8	A	47.5	Very low	47.8	Very low	91 Å²	91	132.9 Å²	132.9	75%	0.752	78%	0.778	S	S	*	*			cis	-166.3	166.2	10.1	0	0	0	0	0	108.5
9	P	46.4	Very low	47.5	Very low	108 Å²	108	133.2 Å²	133.2	70%	0.701	77%	0.771	S	S	*	*			trans	-87.1	136.2	-172.1	34.4	-32.9	0	0	0	113.7
10	G	49.6	Very low	47.7	Very low	84 Å²	84	133.7 Å²	133.7	87%	0.866	77%	0.77	S	S	*	*			trans	-103.1	32.7	-173.8	0	0	0	0	0	116.5
11	S	50.4	Low	47.8	Very low	107 Å²	107	135.6 Å²	135.6	75%	0.748	77%	0.772	S	S	*	*			trans	-124.9	41.1	-178.2	53.2	0	0	0	0	113.5
12	N	48.4	Very low	48.2	Very low	89 Å²	89	128.4 Å²	128.4	48%	0.476	74%	0.742	S	S	.	*			trans	-114.4	23	170	-86.8	-55.2	0	0	0	112.6	R14	N12-R14 VanDerWaalsContact C-N 3.29Å; N12-R14 PolarHBondContact O-N 3.31Å
13	R	53	Low	48.5	Very low	211 Å²	211	130.2 Å²	130.2	80%	0.796	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	-2.9	-172.8	-156.4	154	-164.5	100.7	3.5	115.2
14	R	49.5	Very low	48.7	Very low	231 Å²	231	131.2 Å²	131.2	87%	0.872	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.7	-8.4	176.6	-65.8	-169.2	179.4	-163.8	0.5	114.7	N12	N12-R14 VanDerWaalsContact C-N 3.29Å; N12-R14 PolarHBondContact O-N 3.31Å
15	L	47.3	Very low	49.1	Very low	131 Å²	131	132 Å²	132	69%	0.686	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.4	-10	172.7	-67.5	173	0	0	0	112.9
16	Q	47	Very low	49.1	Very low	134 Å²	134	128.8 Å²	128.8	63%	0.626	71%	0.708	S	S	*	*	S	Bend	trans	-87	-8.7	176.3	-90.3	177.4	18.2	0	0	114.8
17	Q	48.1	Very low	49.1	Very low	169 Å²	169	127.4 Å²	127.4	79%	0.79	70%	0.695	S	S	*	*	S	Bend	trans	-92.3	0.5	176.4	-79.9	-173.5	-48.6	0	0	114.4
18	T	52.4	Low	49.7	Very low	113 Å²	113	128.1 Å²	128.1	69%	0.693	68%	0.684	S	S	*	*	S	Bend	trans	-114.3	1.4	176.3	-44	0	0	0	0	113.2
19	Q	42.3	Very low	50	Low	138 Å²	138	130 Å²	130	65%	0.645	68%	0.68	S	S	*	*	S	Bend	trans	-94.2	-5.1	173.1	-77.8	-95.7	58.1	0	0	113.2	Q21	Q19-Q21 PolarHBondContact O-N 3.3Å
20	N	49.9	Very low	50.3	Low	142 Å²	142	132.7 Å²	132.7	76%	0.759	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	30.3	176.5	-82.4	18.4	0	0	0	113.2
21	Q	49.8	Very low	50.1	Low	175 Å²	175	132.8 Å²	132.8	82%	0.818	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128.3	15.5	172.5	-118.4	-172.3	99.3	0	0	113.6	Q19	Q19-Q21 PolarHBondContact O-N 3.3Å
22	V	53.8	Low	50.1	Low	93 Å²	93	132.5 Å²	132.5	56%	0.564	65%	0.649	S	S	*	*	S	Bend	trans	-134.7	-10.7	-178.6	-146.7	0	0	0	0	115.7
23	D	51.1	Low	50.2	Low	142 Å²	142	132.1 Å²	132.1	76%	0.759	65%	0.65	S	S	*	*	S	Bend	trans	-98	-4.7	174.8	-94.1	-42.4	0	0	0	115.1
24	E	51.3	Low	50	Low	157 Å²	157	127.5 Å²	127.5	73%	0.734	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	-2.2	-178.4	-158.7	169.1	-171.6	0	0	114	I28	E24-I28 VanDerWaalsContact O-CD1 3.3Å; E24-I28 WeakPolarHBondContact O-CD1 3.47Å; E24-I28 WeakPolarHBondContact O-CG1 3.3Å
25	V	51.8	Low	50	Low	83 Å²	83	123.2 Å²	123.2	50%	0.503	63%	0.629	S	S	.	*	T	Hydrogen-bonded Turn	trans	-100.7	-10.3	174.8	-95.8	0	0	0	0	113.4	M29	V25-M29 PolarHBondContact O-N 3.46Å
26	V	50.6	Low	49.9	Very low	68 Å²	68	121.2 Å²	121.2	41%	0.412	62%	0.622	S	S	.	*	H	α-helix	trans	-83.2	-33.6	179.2	-178.2	0	0	0	0	111.4	R30	V26-R30 PolarHBondContact O-N 3.3Å
27	D	50	Low	49.9	Very low	114 Å²	114	120.1 Å²	120.1	61%	0.61	62%	0.62	S	S	*	*	H	α-helix	trans	-76.3	-31.5	177.1	-120.6	15.3	0	0	0	112.3	M29 R30 V31	D27-M29 VanDerWaalsContact C-N 3.35Å; D27-M29 PolarHBondContact O-N 3.38Å; D27-R30 PolarHBondContact O-N 3.49Å; D27-V31 WeakPolarHBondContact O-CG2 3.32Å; D27-V31 PolarHBondContact O-N 3.46Å
28	I	54.3	Low	49.9	Very low	110 Å²	110	119.4 Å²	119.4	56%	0.564	62%	0.616	S	S	*	*	H	α-helix	trans	-66.7	-37.5	174.1	-61.7	174.8	0	0	0	110.7	E24 N32	E24-I28 VanDerWaalsContact O-CD1 3.3Å; E24-I28 WeakPolarHBondContact O-CD1 3.47Å; E24-I28 WeakPolarHBondContact O-CG1 3.3Å; I28-N32 WeakPolarHBondContact O-CB 3.47Å; I28-N32 PolarHBondContact O-N 3.13Å; I28-N32 VanDerWaalsContact O-N 3.13Å
29	M	52.4	Low	49.6	Very low	132 Å²	132	123.4 Å²	123.4	65%	0.65	62%	0.619	S	S	*	*	H	α-helix	trans	-74.3	-29.1	179	-113.4	-168	-80.2	0	0	113.9	V25 D27 N32 V33	V25-M29 PolarHBondContact O-N 3.46Å; D27-M29 VanDerWaalsContact C-N 3.35Å; D27-M29 PolarHBondContact O-N 3.38Å; M29-N32 PolarHBondContact O-N 3.4Å; M29-V33 WeakPolarHBondContact O-CG2 3.4Å; M29-V33 PolarHBondContact O-N 3.4Å; M29-V33 VanDerWaalsContact O-N 3.17Å
30	R	52.5	Low	49.9	Very low	164 Å²	164	122.5 Å²	122.5	62%	0.619	62%	0.618	S	S	*	*	H	α-helix	trans	-66.5	-45.3	174.1	-82.3	-170.2	172.1	97.9	2.8	111.9	V26 D27 N32 V33	V26-R30 PolarHBondContact O-N 3.3Å; D27-R30 PolarHBondContact O-N 3.49Å; R30-N32 VanDerWaalsContact C-N 3.27Å; R30-N32 PolarHBondContact O-N 3.46Å; R30-V33 PolarHBondContact O-N 3.28Å
31	V	46.6	Very low	49.5	Very low	86 Å²	86	123.7 Å²	123.7	52%	0.521	62%	0.619	S	S	.	*	H	α-helix	trans	-71.8	-24.4	178.4	-173	0	0	0	0	111.9	D27 K35	D27-V31 WeakPolarHBondContact O-CG2 3.32Å; D27-V31 PolarHBondContact O-N 3.46Å; V31-K35 PolarHBondContact O-N 3.17Å
32	N	49.3	Very low	49.3	Very low	101 Å²	101	123.5 Å²	123.5	54%	0.54	62%	0.616	S	S	.	*	H	α-helix	trans	-80.3	-24.5	177.7	-144.3	39.8	0	0	0	113.4	I28 M29 R30 V36	I28-N32 WeakPolarHBondContact O-CB 3.47Å; I28-N32 PolarHBondContact O-N 3.13Å; I28-N32 VanDerWaalsContact O-N 3.13Å; M29-N32 PolarHBondContact O-N 3.4Å; R30-N32 VanDerWaalsContact C-N 3.27Å; R30-N32 PolarHBondContact O-N 3.46Å; N32-V36 WeakPolarHBondContact O-CB 3.41Å; N32-V36 PolarHBondContact O-N 3.13Å
33	V	51.2	Low	48.7	Very low	80 Å²	80	124.5 Å²	124.5	49%	0.485	62%	0.618	S	S	.	*	H	α-helix	trans	-70.8	-40.4	172.4	168.8	0	0	0	0	111	M29 R30 K35 V36 L37	M29-V33 WeakPolarHBondContact O-CG2 3.4Å; M29-V33 PolarHBondContact O-N 3.4Å; M29-V33 VanDerWaalsContact O-N 3.17Å; R30-V33 PolarHBondContact O-N 3.28Å; V33-K35 VanDerWaalsContact C-N 3.33Å; V33-K35 PolarHBondContact O-N 3.46Å; V33-V36 PolarHBondContact O-N 3.4Å; V33-L37 HydrophobicContact CG1-CD1 4.05Å; V33-L37 PolarHBondContact O-N 3.37Å; V33-L37 VanDerWaalsContact O-N 3.13Å
34	D	48.4	Very low	48.6	Very low	115 Å²	115	121.6 Å²	121.6	62%	0.615	61%	0.608	S	S	*	*	H	α-helix	trans	-67.4	-35.2	175.5	-68.4	-33.9	0	0	0	111.7	E38	D34-E38 PolarHBondContact O-N 3Å
35	K	50.5	Low	48.3	Very low	140 Å²	140	119.5 Å²	119.5	61%	0.609	60%	0.598	S	S	*	*	H	α-helix	trans	-76	-23.9	175.9	-95.1	179.2	177.1	173.3	0	115.1	V31 V33	V31-K35 PolarHBondContact O-N 3.17Å; V33-K35 VanDerWaalsContact C-N 3.33Å; V33-K35 PolarHBondContact O-N 3.46Å
36	V	45.1	Very low	48.1	Very low	90 Å²	90	121.4 Å²	121.4	55%	0.545	61%	0.605	S	S	.	*	H	α-helix	trans	-85.5	-26.3	176.5	85.3	0	0	0	0	111.7	N32 V33 R39 D40	N32-V36 WeakPolarHBondContact O-CB 3.41Å; N32-V36 PolarHBondContact O-N 3.13Å; V33-V36 PolarHBondContact O-N 3.4Å; V36-R39 PolarHBondContact O-N 3.4Å; V36-D40 PolarHBondContact O-N 3.42Å
37	L	47	Very low	48	Very low	111 Å²	111	123.5 Å²	123.5	58%	0.581	61%	0.614	S	S	*	*	H	α-helix	trans	-71.9	-32.9	172.8	-89	157.4	0	0	0	113.2	V33	V33-L37 HydrophobicContact CG1-CD1 4.05Å; V33-L37 PolarHBondContact O-N 3.37Å; V33-L37 VanDerWaalsContact O-N 3.13Å
38	E	47.4	Very low	48	Very low	154 Å²	154	123.5 Å²	123.5	72%	0.72	61%	0.614	S	S	*	*	H	α-helix	trans	-77.7	-19.7	171.9	-80.7	-171.7	156.7	0	0	113.7	D34	D34-E38 PolarHBondContact O-N 3Å
39	R	46.4	Very low	47.9	Very low	197 Å²	197	125.4 Å²	125.4	74%	0.743	61%	0.614	S	S	*	*	H	α-helix	trans	-83.3	-13.7	176.5	-101.4	-155.4	168.2	175	-1.5	114.4	V36 L43	V36-R39 PolarHBondContact O-N 3.4Å; R39-L43 WeakPolarHBondContact O-CD1 3.44Å
40	D	47.9	Very low	48	Very low	118 Å²	118	121.4 Å²	121.4	63%	0.631	60%	0.602	S	S	*	*	H	α-helix	trans	-82.2	-30.8	177.8	-131.4	-10	0	0	0	112.1	V36	V36-D40 PolarHBondContact O-N 3.42Å
41	Q	42.5	Very low	48	Very low	168 Å²	168	118.3 Å²	118.3	79%	0.785	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	-14.9	179.9	-70.1	-164.8	-23	0	0	114.8
42	K	45.3	Very low	48.5	Very low	170 Å²	170	117.4 Å²	117.4	74%	0.739	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	-1.9	175.2	-90.1	-173.1	175.9	177.5	0	114.8
43	L	42.2	Very low	48.7	Very low	115 Å²	115	118.8 Å²	118.8	60%	0.602	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	-32.7	173.4	-84.2	159	0	0	0	112.1	R39 E45 L46 D47	R39-L43 WeakPolarHBondContact O-CD1 3.44Å; L43-E45 PolarHBondContact O-N 3.21Å; L43-L46 PolarHBondContact O-N 3.43Å; L43-D47 PolarHBondContact O-N 2.93Å
44	S	47.2	Very low	48.7	Very low	80 Å²	80	121.4 Å²	121.4	56%	0.559	61%	0.613	S	S	*	*	H	α-helix	trans	-66.2	-35.9	178.9	-169.8	0	0	0	0	113.4	D48	S44-D48 PolarHBondContact O-N 3.47Å
45	E	46.8	Very low	49.1	Very low	113 Å²	113	118.8 Å²	118.8	53%	0.528	61%	0.607	S	S	.	*	H	α-helix	trans	-82.6	-17.9	-178	-150	-165	154.5	0	0	113.1	L43 R49	L43-E45 PolarHBondContact O-N 3.21Å; E45-R49 VanDerWaalsContact O-CG 3.28Å; E45-R49 WeakPolarHBondContact O-CG 3.19Å; E45-R49 IonicContact OE1-CZ 3.5Å; E45-R49 IonicContact OE1-NE 3.5Å; E45-R49 PolarHBondContact OE1-NE 2.88Å; E45-R49 IonicContact OE1-NH2 2.74Å; E45-R49 PolarHBondContact OE1-NH2 2.9Å
46	L	46.5	Very low	49.6	Very low	124 Å²	124	114.1 Å²	114.1	65%	0.649	60%	0.599	S	S	*	*	H	α-helix	trans	-86.4	-31.2	176.5	-141	80.9	0	0	0	111.8	L43 A50	L43-L46 PolarHBondContact O-N 3.43Å; L46-A50 WeakPolarHBondContact O-CB 3.32Å; L46-A50 PolarHBondContact O-N 3.45Å
47	D	48.3	Very low	50.1	Low	111 Å²	111	112.6 Å²	112.6	59%	0.594	60%	0.596	S	S	*	*	H	α-helix	trans	-68.2	-47.7	176.2	-152.8	41.1	0	0	0	110.9	L43 R49 A50 D51	L43-D47 PolarHBondContact O-N 2.93Å; D47-R49 VanDerWaalsContact C-N 3.31Å; D47-R49 PolarHBondContact O-N 3.32Å; D47-A50 PolarHBondContact O-N 2.91Å; D47-A50 VanDerWaalsContact O-N 3.14Å; D47-D51 PolarHBondContact O-N 3.48Å
48	D	51.3	Low	50.4	Low	114 Å²	114	110.3 Å²	110.3	61%	0.61	59%	0.589	S	S	*	*	H	α-helix	trans	-61.8	-36.2	175.1	-83	-40.5	0	0	0	112.9	S44 A52	S44-D48 PolarHBondContact O-N 3.47Å; D48-A52 VanDerWaalsContact O-CB 3.31Å; D48-A52 WeakPolarHBondContact O-CB 3.29Å; D48-A52 PolarHBondContact O-N 3.17Å
49	R	51.7	Low	50.7	Low	150 Å²	150	109.4 Å²	109.4	57%	0.566	59%	0.585	S	S	*	*	H	α-helix	trans	-75.8	-33	175.9	-72.9	-178	-170.1	-143	8.5	112.1	E45 D47 L53	E45-R49 VanDerWaalsContact O-CG 3.28Å; E45-R49 WeakPolarHBondContact O-CG 3.19Å; E45-R49 IonicContact OE1-CZ 3.5Å; E45-R49 IonicContact OE1-NE 3.5Å; E45-R49 PolarHBondContact OE1-NE 2.88Å; E45-R49 IonicContact OE1-NH2 2.74Å; E45-R49 PolarHBondContact OE1-NH2 2.9Å; D47-R49 VanDerWaalsContact C-N 3.31Å; D47-R49 PolarHBondContact O-N 3.32Å; R49-L53 VanDerWaalsContact O-CB 3.27Å; R49-L53 WeakPolarHBondContact O-CB 3.31Å; R49-L53 WeakPolarHBondContact O-CD1 3.39Å; R49-L53 WeakPolarHBondContact O-CG 3.28Å; R49-L53 PolarHBondContact O-N 3.14Å
50	A	54.7	Low	51.2	Low	49 Å²	49	107.7 Å²	107.7	41%	0.405	58%	0.583	S	S	.	*	H	α-helix	trans	-69.2	-43.1	176.5	0	0	0	0	0	111.6	L46 D47 L53 Q54	L46-A50 WeakPolarHBondContact O-CB 3.32Å; L46-A50 PolarHBondContact O-N 3.45Å; D47-A50 PolarHBondContact O-N 2.91Å; D47-A50 VanDerWaalsContact O-N 3.14Å; A50-L53 PolarHBondContact O-N 3.34Å; A50-Q54 WeakPolarHBondContact O-CB 3.16Å; A50-Q54 PolarHBondContact O-N 2.95Å
51	D	52.2	Low	51.4	Low	99 Å²	99	108.8 Å²	108.8	53%	0.529	58%	0.584	S	S	.	*	H	α-helix	trans	-65.3	-40.9	175	-99.3	-31.9	0	0	0	112	D47 L53 Q54 A55	D47-D51 PolarHBondContact O-N 3.48Å; D51-L53 PolarHBondContact O-N 2.81Å; D51-Q54 PolarHBondContact O-N 2.78Å; D51-A55 WeakPolarHBondContact O-CB 3.35Å; D51-A55 PolarHBondContact O-N 3.45Å
52	A	55.8	Low	52	Low	66 Å²	66	103.3 Å²	103.3	55%	0.545	56%	0.563	S	S	.	*	H	α-helix	trans	-64.7	-38.5	174.6	0	0	0	0	0	112.6	D48 G56	D48-A52 VanDerWaalsContact O-CB 3.31Å; D48-A52 WeakPolarHBondContact O-CB 3.29Å; D48-A52 PolarHBondContact O-N 3.17Å; A52-G56 PolarHBondContact O-N 2.74Å
53	L	53.7	Low	52.5	Low	131 Å²	131	97.9 Å²	97.9	69%	0.686	55%	0.546	S	S	*	.	H	α-helix	trans	-70	-37.7	174.5	-89.2	155.6	0	0	0	112.1	R49 A50 D51 G56 A57	R49-L53 VanDerWaalsContact O-CB 3.27Å; R49-L53 WeakPolarHBondContact O-CB 3.31Å; R49-L53 WeakPolarHBondContact O-CD1 3.39Å; R49-L53 WeakPolarHBondContact O-CG 3.28Å; R49-L53 PolarHBondContact O-N 3.14Å; A50-L53 PolarHBondContact O-N 3.34Å; D51-L53 PolarHBondContact O-N 2.81Å; L53-G56 PolarHBondContact O-N 3.49Å; L53-A57 WeakPolarHBondContact O-CB 3.27Å; L53-A57 PolarHBondContact O-N 3.31Å
54	Q	52.9	Low	53.3	Low	134 Å²	134	94.7 Å²	94.7	63%	0.626	54%	0.536	S	S	*	.	H	α-helix	trans	-69.1	-41.8	177.4	-176.7	167.4	0.3	0	0	111.7	A50 D51 A57 S58	A50-Q54 WeakPolarHBondContact O-CB 3.16Å; A50-Q54 PolarHBondContact O-N 2.95Å; D51-Q54 PolarHBondContact O-N 2.78Å; Q54-A57 PolarHBondContact O-N 3.18Å; Q54-S58 VanDerWaalsContact O-CB 3.29Å; Q54-S58 WeakPolarHBondContact O-CB 3.4Å; Q54-S58 PolarHBondContact O-N 2.8Å
55	A	56.8	Low	53.9	Low	60 Å²	60	93.7 Å²	93.7	50%	0.496	53%	0.533	S	S	.	.	H	α-helix	trans	-64.2	-41.8	173.5	0	0	0	0	0	111.8	D51 Q59	D51-A55 WeakPolarHBondContact O-CB 3.35Å; D51-A55 PolarHBondContact O-N 3.45Å; A55-Q59 WeakPolarHBondContact O-CB 3.46Å; A55-Q59 WeakPolarHBondContact O-CG 3.27Å; A55-Q59 PolarHBondContact O-N 2.93Å; A55-Q59 VanDerWaalsContact O-N 3.11Å
56	G	59	Low	54.5	Low	42 Å²	42	95 Å²	95	43%	0.433	54%	0.537	S	S	.	.	H	α-helix	trans	-66.1	-41.2	174.9	0	0	0	0	0	113.5	A52 L53 Q59 F60	A52-G56 PolarHBondContact O-N 2.74Å; L53-G56 PolarHBondContact O-N 3.49Å; G56-Q59 PolarHBondContact O-N 3.46Å; G56-F60 WeakPolarHBondContact O-CB 3.45Å; G56-F60 PolarHBondContact O-N 3.11Å
57	A	56.1	Low	55.1	Low	58 Å²	58	93.8 Å²	93.8	48%	0.479	53%	0.53	S	S	.	.	H	α-helix	trans	-68.5	-40.7	177.5	0	0	0	0	0	112.2	L53 Q54 F60 E61	L53-A57 WeakPolarHBondContact O-CB 3.27Å; L53-A57 PolarHBondContact O-N 3.31Å; Q54-A57 PolarHBondContact O-N 3.18Å; A57-F60 CarbonylContact O-C 3.6Å; A57-F60 PolarHBondContact O-N 3.5Å; A57-E61 WeakPolarHBondContact O-CB 3.33Å; A57-E61 PolarHBondContact O-N 2.76Å
58	S	53.6	Low	55.8	Low	64 Å²	64	96.6 Å²	96.6	45%	0.448	54%	0.537	S	S	.	.	H	α-helix	trans	-64.1	-38.7	174.7	178.3	0	0	0	0	112.2	Q54 T62	Q54-S58 VanDerWaalsContact O-CB 3.29Å; Q54-S58 WeakPolarHBondContact O-CB 3.4Å; Q54-S58 PolarHBondContact O-N 2.8Å; S58-T62 VanDerWaalsContact O-CB 3.27Å; S58-T62 WeakPolarHBondContact O-CB 3.2Å; S58-T62 PolarHBondContact O-N 3.38Å; S58-T62 PolarHBondContact O-OG1 3.38Å
59	Q	53.3	Low	56.6	Low	135 Å²	135	99.5 Å²	99.5	63%	0.631	54%	0.54	S	S	*	.	H	α-helix	trans	-67.2	-35.6	171.9	-77.1	-97.6	67.7	0	0	112.5	A55 G56 S63	A55-Q59 WeakPolarHBondContact O-CB 3.46Å; A55-Q59 WeakPolarHBondContact O-CG 3.27Å; A55-Q59 PolarHBondContact O-N 2.93Å; A55-Q59 VanDerWaalsContact O-N 3.11Å; G56-Q59 PolarHBondContact O-N 3.46Å; Q59-S63 VanDerWaalsContact O-CB 3.25Å; Q59-S63 WeakPolarHBondContact O-CB 3.25Å; Q59-S63 PolarHBondContact O-N 2.81Å; Q59-S63 PolarHBondContact O-OG 3.3Å
60	F	58.2	Low	57.3	Low	160 Å²	160	99.4 Å²	99.4	70%	0.702	54%	0.543	S	S	*	.	H	α-helix	trans	-72.1	-41.2	175.8	-160.8	-95.8	0	0	0	112.2	G56 A57 S63 A64	G56-F60 WeakPolarHBondContact O-CB 3.45Å; G56-F60 PolarHBondContact O-N 3.11Å; A57-F60 CarbonylContact O-C 3.6Å; A57-F60 PolarHBondContact O-N 3.5Å; F60-S63 PolarHBondContact O-N 3.02Å; F60-A64 VanDerWaalsContact O-CB 3.25Å; F60-A64 WeakPolarHBondContact O-CB 3.42Å; F60-A64 PolarHBondContact O-N 2.93Å
61	E	52.4	Low	58.2	Low	141 Å²	141	104.5 Å²	104.5	66%	0.659	55%	0.553	S	S	*	*	H	α-helix	trans	-61.3	-47.7	174	-175	-176.5	168.7	0	0	110.6	A57 S63 A64 A65	A57-E61 WeakPolarHBondContact O-CB 3.33Å; A57-E61 PolarHBondContact O-N 2.76Å; E61-S63 VanDerWaalsContact C-N 3.3Å; E61-S63 PolarHBondContact O-N 3.42Å; E61-A64 PolarHBondContact O-N 2.85Å; E61-A65 WeakPolarHBondContact O-CB 3.31Å; E61-A65 PolarHBondContact O-N 2.98Å
62	T	53.9	Low	59.3	Low	54 Å²	54	108.1 Å²	108.1	33%	0.331	56%	0.56	S	S	.	*	H	α-helix	trans	-63	-38.5	178	-58.3	0	0	0	0	111.3	S58 K66	S58-T62 VanDerWaalsContact O-CB 3.27Å; S58-T62 WeakPolarHBondContact O-CB 3.2Å; S58-T62 PolarHBondContact O-N 3.38Å; S58-T62 PolarHBondContact O-OG1 3.38Å; T62-K66 HydrophobicContact CG2-CD 4.02Å; T62-K66 VanDerWaalsContact CG2-CE 3.43Å; T62-K66 VanDerWaalsContact CG2-NZ 3.35Å; T62-K66 VanDerWaalsContact O-CB 3.31Å; T62-K66 WeakPolarHBondContact O-CB 3.25Å; T62-K66 WeakPolarHBondContact O-CD 3.43Å; T62-K66 WeakPolarHBondContact O-CG 3.39Å; T62-K66 PolarHBondContact O-N 2.75Å
63	S	55.4	Low	60.3	Low	56 Å²	56	112.5 Å²	112.5	39%	0.392	56%	0.562	S	S	.	*	H	α-helix	trans	-71.4	-44.4	177.8	-62.5	0	0	0	0	112	Q59 F60 E61 K66 L67	Q59-S63 VanDerWaalsContact O-CB 3.25Å; Q59-S63 WeakPolarHBondContact O-CB 3.25Å; Q59-S63 PolarHBondContact O-N 2.81Å; Q59-S63 PolarHBondContact O-OG 3.3Å; F60-S63 PolarHBondContact O-N 3.02Å; E61-S63 VanDerWaalsContact C-N 3.3Å; E61-S63 PolarHBondContact O-N 3.42Å; S63-K66 PolarHBondContact O-N 2.93Å; S63-L67 WeakPolarHBondContact O-CB 3.45Å; S63-L67 VanDerWaalsContact O-CD1 3.24Å; S63-L67 WeakPolarHBondContact O-CD1 3.49Å; S63-L67 WeakPolarHBondContact O-CG 3.3Å; S63-L67 PolarHBondContact O-N 3.44Å
64	A	59.2	Low	61.6	Low	47 Å²	47	112.4 Å²	112.4	39%	0.388	56%	0.556	S	S	.	*	H	α-helix	trans	-64.4	-39.6	176.6	0	0	0	0	0	112.2	F60 E61 L67 K68	F60-A64 VanDerWaalsContact O-CB 3.25Å; F60-A64 WeakPolarHBondContact O-CB 3.42Å; F60-A64 PolarHBondContact O-N 2.93Å; E61-A64 PolarHBondContact O-N 2.85Å; A64-L67 PolarHBondContact O-N 3.34Å; A64-K68 WeakPolarHBondContact O-CB 3.14Å; A64-K68 PolarHBondContact O-N 3.04Å
65	A	60.4	Low	63	Low	59 Å²	59	110.8 Å²	110.8	49%	0.488	55%	0.552	S	S	.	*	H	α-helix	trans	-66.7	-42.1	175.3	0	0	0	0	0	112	E61 K68 R69	E61-A65 WeakPolarHBondContact O-CB 3.31Å; E61-A65 PolarHBondContact O-N 2.98Å; A65-K68 PolarHBondContact O-N 3.4Å; A65-R69 PolarHBondContact O-N 3Å; A65-R69 VanDerWaalsContact O-N 3.11Å
66	K	59	Low	64.4	Low	142 Å²	142	111.5 Å²	111.5	62%	0.617	55%	0.552	S	S	*	*	H	α-helix	trans	-63.8	-40.4	174.8	-76.1	170.1	-177	169.1	0	111.7	T62 S63 K70	T62-K66 HydrophobicContact CG2-CD 4.02Å; T62-K66 VanDerWaalsContact CG2-CE 3.43Å; T62-K66 VanDerWaalsContact CG2-NZ 3.35Å; T62-K66 VanDerWaalsContact O-CB 3.31Å; T62-K66 WeakPolarHBondContact O-CB 3.25Å; T62-K66 WeakPolarHBondContact O-CD 3.43Å; T62-K66 WeakPolarHBondContact O-CG 3.39Å; T62-K66 PolarHBondContact O-N 2.75Å; S63-K66 PolarHBondContact O-N 2.93Å; K66-K70 WeakPolarHBondContact O-CB 3.24Å; K66-K70 PolarHBondContact O-N 3.34Å; K66-K70 VanDerWaalsContact O-N 3.12Å
67	L	59.7	Low	65.8	Low	98 Å²	98	116.6 Å²	116.6	51%	0.513	56%	0.562	S	S	.	*	H	α-helix	trans	-64	-48.6	176	-71.8	157.9	0	0	0	111	S63 A64 R69 K70 Y71	S63-L67 WeakPolarHBondContact O-CB 3.45Å; S63-L67 VanDerWaalsContact O-CD1 3.24Å; S63-L67 WeakPolarHBondContact O-CD1 3.49Å; S63-L67 WeakPolarHBondContact O-CG 3.3Å; S63-L67 PolarHBondContact O-N 3.44Å; A64-L67 PolarHBondContact O-N 3.34Å; L67-R69 VanDerWaalsContact C-N 3.33Å; L67-R69 PolarHBondContact O-N 3.38Å; L67-K70 PolarHBondContact O-N 3.06Å; L67-Y71 VanDerWaalsContact O-CD2 3.3Å; L67-Y71 WeakPolarHBondContact O-CD2 3.35Å; L67-Y71 PolarHBondContact O-N 2.99Å; L67-Y71 VanDerWaalsContact O-N 3.13Å
68	K	62.9	Low	67.4	Low	169 Å²	169	120 Å²	120	74%	0.735	57%	0.57	S	S	*	*	H	α-helix	trans	-58	-43.6	179.4	-167.7	177.6	-177.3	-178	0	112.1	A64 A65 W72	A64-K68 WeakPolarHBondContact O-CB 3.14Å; A64-K68 PolarHBondContact O-N 3.04Å; A65-K68 PolarHBondContact O-N 3.4Å; K68-W72 WeakPolarHBondContact O-CB 3.15Å; K68-W72 PolarHBondContact O-N 3.13Å
69	R	67.4	Low	69.2	Low	175 Å²	175	125.4 Å²	125.4	66%	0.66	58%	0.581	S	S	*	*	H	α-helix	trans	-67.5	-39.2	179	-162.8	167.7	-178.6	159	0	112.1	A65 L67 Y71 W72 W73	A65-R69 PolarHBondContact O-N 3Å; A65-R69 VanDerWaalsContact O-N 3.11Å; L67-R69 VanDerWaalsContact C-N 3.33Å; L67-R69 PolarHBondContact O-N 3.38Å; R69-Y71 PolarHBondContact O-N 3.11Å; R69-W72 PolarHBondContact O-N 3.19Å; R69-W73 PolarHBondContact O-N 2.9Å
70	K	66.6	Low	71.1	Confident	148 Å²	148	121.4 Å²	121.4	64%	0.643	57%	0.571	S	S	*	*	H	α-helix	trans	-62.2	-43.6	178.1	-164.8	176.6	-174.7	-177.8	0	112	K66 L67 K74	K66-K70 WeakPolarHBondContact O-CB 3.24Å; K66-K70 PolarHBondContact O-N 3.34Å; K66-K70 VanDerWaalsContact O-N 3.12Å; L67-K70 PolarHBondContact O-N 3.06Å; K70-K74 WeakPolarHBondContact O-CG 3.46Å; K70-K74 PolarHBondContact O-N 3.5Å
71	Y	73.5	Confident	72.9	Confident	157 Å²	157	118.1 Å²	118.1	62%	0.616	56%	0.56	S	S	*	*	H	α-helix	trans	-72.8	-36.4	177.6	-77.4	-81.9	0	0	0	112.8	L67 R69 W73 K74 N75	L67-Y71 VanDerWaalsContact O-CD2 3.3Å; L67-Y71 WeakPolarHBondContact O-CD2 3.35Å; L67-Y71 PolarHBondContact O-N 2.99Å; L67-Y71 VanDerWaalsContact O-N 3.13Å; R69-Y71 PolarHBondContact O-N 3.11Å; Y71-W73 VanDerWaalsContact C-N 3.34Å; Y71-W73 PolarHBondContact O-N 2.98Å; Y71-K74 PolarHBondContact O-N 3.44Å; Y71-N75 PolarHBondContact O-N 3.4Å
72	W	75.9	Confident	74.9	Confident	175 Å²	175	113.4 Å²	113.4	66%	0.663	55%	0.548	S	S	*	.	H	α-helix	trans	-60.8	-43.4	176.1	-168.5	78.9	0	0	0	112.1	K68 R69 N75 C76	K68-W72 WeakPolarHBondContact O-CB 3.15Å; K68-W72 PolarHBondContact O-N 3.13Å; R69-W72 PolarHBondContact O-N 3.19Å; W72-N75 PolarHBondContact O-N 3.48Å; W72-C76 WeakPolarHBondContact O-CB 3.32Å; W72-C76 PolarHBondContact O-N 3.12Å
73	W	75.8	Confident	76.9	Confident	158 Å²	158	115.6 Å²	115.6	60%	0.598	56%	0.557	S	S	*	*	H	α-helix	trans	-67.6	-40	176.8	-79.6	56.1	0	0	0	112.6	R69 Y71 N75 C76 K77	R69-W73 PolarHBondContact O-N 2.9Å; Y71-W73 VanDerWaalsContact C-N 3.34Å; Y71-W73 PolarHBondContact O-N 2.98Å; W73-N75 VanDerWaalsContact C-N 3.35Å; W73-C76 PolarHBondContact O-N 3.42Å; W73-K77 WeakPolarHBondContact O-CB 3.37Å; W73-K77 PolarHBondContact O-N 3.11Å
74	K	82.3	Confident	78.9	Confident	128 Å²	128	116.9 Å²	116.9	56%	0.557	56%	0.563	S	S	*	*	H	α-helix	trans	-61.6	-44	174.8	-73.2	-179.7	80.5	-176.1	0	111.2	K70 Y71 K77 M78	K70-K74 WeakPolarHBondContact O-CG 3.46Å; K70-K74 PolarHBondContact O-N 3.5Å; Y71-K74 PolarHBondContact O-N 3.44Å; K74-K77 PolarHBondContact O-N 3Å; K74-M78 VanDerWaalsContact O-CG 3.32Å; K74-M78 WeakPolarHBondContact O-CG 3.39Å; K74-M78 PolarHBondContact O-N 3.47Å
75	N	82.4	Confident	80.7	Confident	101 Å²	101	119 Å²	119	54%	0.54	57%	0.57	S	S	.	*	H	α-helix	trans	-64	-48.9	178.7	-133.3	28.1	0	0	0	110.6	Y71 W72 W73 K77 M78 W79	Y71-N75 PolarHBondContact O-N 3.4Å; W72-N75 PolarHBondContact O-N 3.48Å; W73-N75 VanDerWaalsContact C-N 3.35Å; N75-K77 VanDerWaalsContact C-N 3.31Å; N75-K77 PolarHBondContact O-N 2.94Å; N75-M78 PolarHBondContact O-N 3.48Å; N75-M78 VanDerWaalsContact O-N 3.11Å; N75-W79 PolarHBondContact O-N 3.31Å
76	C	85.3	Confident	82.5	Confident	74 Å²	74	121.2 Å²	121.2	50%	0.5	57%	0.574	S	S	.	*	H	α-helix	trans	-56.1	-43.8	177.4	-169.9	0	0	0	0	112.4	W72 W73 M78 W79 A80	W72-C76 WeakPolarHBondContact O-CB 3.32Å; W72-C76 PolarHBondContact O-N 3.12Å; W73-C76 PolarHBondContact O-N 3.42Å; C76-M78 PolarHBondContact O-N 2.96Å; C76-W79 PolarHBondContact O-N 3.46Å; C76-A80 WeakPolarHBondContact O-CB 3.34Å; C76-A80 PolarHBondContact O-N 3.03Å
77	K	87.7	Confident	84.3	Confident	149 Å²	149	117.8 Å²	117.8	65%	0.648	57%	0.565	S	S	*	*	H	α-helix	trans	-63.6	-39.8	176.7	-175.4	167.6	173	164.9	0	112.8	W73 K74 N75 A80 I81	W73-K77 WeakPolarHBondContact O-CB 3.37Å; W73-K77 PolarHBondContact O-N 3.11Å; K74-K77 PolarHBondContact O-N 3Å; N75-K77 VanDerWaalsContact C-N 3.31Å; N75-K77 PolarHBondContact O-N 2.94Å; K77-A80 PolarHBondContact O-N 3.31Å; K77-I81 HydrophobicContact CG-CD1 4.17Å; K77-I81 WeakPolarHBondContact O-CG1 3.31Å; K77-I81 PolarHBondContact O-N 3.4Å; K77-I81 VanDerWaalsContact O-N 3.16Å
78	M	89.5	Confident	86.1	Confident	129 Å²	129	117.4 Å²	117.4	64%	0.635	56%	0.562	S	S	*	*	H	α-helix	trans	-65.9	-44	176.8	-71.2	-63.8	-65.9	0	0	112	K74 N75 C76 A80 I81 G82	K74-M78 VanDerWaalsContact O-CG 3.32Å; K74-M78 WeakPolarHBondContact O-CG 3.39Å; K74-M78 PolarHBondContact O-N 3.47Å; N75-M78 PolarHBondContact O-N 3.48Å; N75-M78 VanDerWaalsContact O-N 3.11Å; C76-M78 PolarHBondContact O-N 2.96Å; M78-A80 PolarHBondContact O-N 3.18Å; M78-I81 PolarHBondContact O-N 2.93Å; M78-G82 PolarHBondContact O-N 3.49Å
79	W	92.4	Very high	87.8	Confident	178 Å²	178	115.5 Å²	115.5	67%	0.674	55%	0.554	S	S	*	*	H	α-helix	trans	-61.3	-43	175.4	-79.2	99.6	0	0	0	111.9	N75 C76 I81 G82 I83	N75-W79 PolarHBondContact O-N 3.31Å; C76-W79 PolarHBondContact O-N 3.46Å; W79-I81 PolarHBondContact O-N 3.49Å; W79-G82 PolarHBondContact O-N 3.23Å; W79-I83 VanDerWaalsContact O-CG1 3.31Å; W79-I83 WeakPolarHBondContact O-CG1 3.33Å; W79-I83 PolarHBondContact O-N 3.27Å
80	A	93.9	Very high	89.3	Confident	52 Å²	52	111 Å²	111	43%	0.43	54%	0.543	S	S	.	.	H	α-helix	trans	-61.9	-40.4	177.9	0	0	0	0	0	113.2	C76 K77 M78 T84	C76-A80 WeakPolarHBondContact O-CB 3.34Å; C76-A80 PolarHBondContact O-N 3.03Å; K77-A80 PolarHBondContact O-N 3.31Å; M78-A80 PolarHBondContact O-N 3.18Å; A80-T84 WeakPolarHBondContact O-CB 3.48Å; A80-T84 PolarHBondContact O-N 3.43Å; A80-T84 VanDerWaalsContact O-N 3.09Å; A80-T84 PolarHBondContact O-OG1 3.02Å
81	I	95.1	Very high	90.7	Very high	91 Å²	91	108.4 Å²	108.4	47%	0.467	54%	0.535	S	S	.	.	H	α-helix	trans	-66.6	-45	175.9	-65.5	164.3	0	0	0	110.1	K77 M78 W79 I83 T84 V85	K77-I81 HydrophobicContact CG-CD1 4.17Å; K77-I81 WeakPolarHBondContact O-CG1 3.31Å; K77-I81 PolarHBondContact O-N 3.4Å; K77-I81 VanDerWaalsContact O-N 3.16Å; M78-I81 PolarHBondContact O-N 2.93Å; W79-I81 PolarHBondContact O-N 3.49Å; I81-I83 PolarHBondContact O-N 3.09Å; I81-T84 PolarHBondContact O-N 3.03Å; I81-V85 WeakPolarHBondContact O-CG2 3.33Å; I81-V85 PolarHBondContact O-N 3.1Å
82	G	95.4	Very high	91.8	Very high	41 Å²	41	105.9 Å²	105.9	42%	0.423	53%	0.53	S	S	.	.	H	α-helix	trans	-59.2	-45	178.3	0	0	0	0	0	113	M78 W79 V85 L86	M78-G82 PolarHBondContact O-N 3.49Å; W79-G82 PolarHBondContact O-N 3.23Å; G82-V85 PolarHBondContact O-N 3.42Å; G82-L86 WeakPolarHBondContact O-CB 3.33Å; G82-L86 PolarHBondContact O-N 2.82Å
83	I	96.1	Very high	92.9	Very high	101 Å²	101	101.3 Å²	101.3	52%	0.518	52%	0.518	S	S	.	.	H	α-helix	trans	-63.2	-44.6	177.1	-66.6	165.5	0	0	0	110.7	W79 I81 V85 L86 V87	W79-I83 VanDerWaalsContact O-CG1 3.31Å; W79-I83 WeakPolarHBondContact O-CG1 3.33Å; W79-I83 PolarHBondContact O-N 3.27Å; I81-I83 PolarHBondContact O-N 3.09Å; I83-V85 PolarHBondContact O-N 3.45Å; I83-L86 PolarHBondContact O-N 2.96Å; I83-V87 HydrophobicContact CG2-CG2 4.3Å; I83-V87 WeakPolarHBondContact O-CG2 3.34Å; I83-V87 PolarHBondContact O-N 3.38Å
84	T	96.8	Very high	93.9	Very high	83 Å²	83	98.4 Å²	98.4	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-57.9	-47.3	178.7	-59.3	0	0	0	0	111.6	A80 I81 L86 V87 I88	A80-T84 WeakPolarHBondContact O-CB 3.48Å; A80-T84 PolarHBondContact O-N 3.43Å; A80-T84 VanDerWaalsContact O-N 3.09Å; A80-T84 PolarHBondContact O-OG1 3.02Å; I81-T84 PolarHBondContact O-N 3.03Å; T84-L86 VanDerWaalsContact C-N 3.35Å; T84-L86 PolarHBondContact O-N 3.04Å; T84-V87 PolarHBondContact O-N 3.16Å; T84-I88 HydrophobicContact CG2-CD1 3.99Å; T84-I88 WeakPolarHBondContact O-CG1 3.42Å; T84-I88 PolarHBondContact O-N 3.27Å; T84-I88 VanDerWaalsContact O-N 3.1Å
85	V	97.3	Very high	94.6	Very high	90 Å²	90	96.3 Å²	96.3	55%	0.545	51%	0.511	S	S	.	.	H	α-helix	trans	-63.4	-42.2	178.6	173.8	0	0	0	0	111.1	I81 G82 I83 V87 I88 F89	I81-V85 WeakPolarHBondContact O-CG2 3.33Å; I81-V85 PolarHBondContact O-N 3.1Å; G82-V85 PolarHBondContact O-N 3.42Å; I83-V85 PolarHBondContact O-N 3.45Å; V85-V87 PolarHBondContact O-N 3.49Å; V85-I88 PolarHBondContact O-N 3Å; V85-F89 WeakPolarHBondContact O-CB 3.32Å; V85-F89 PolarHBondContact O-N 3.26Å
86	L	97.4	Very high	95.3	Very high	106 Å²	106	100.1 Å²	100.1	56%	0.555	52%	0.518	S	S	*	.	H	α-helix	trans	-63.4	-41.8	179.3	-173.4	144.6	0	0	0	111.9	G82 I83 T84 F89 I90	G82-L86 WeakPolarHBondContact O-CB 3.33Å; G82-L86 PolarHBondContact O-N 2.82Å; I83-L86 PolarHBondContact O-N 2.96Å; T84-L86 VanDerWaalsContact C-N 3.35Å; T84-L86 PolarHBondContact O-N 3.04Å; L86-F89 PolarHBondContact O-N 3.44Å; L86-I90 HydrophobicContact CD2-CD1 3.57Å; L86-I90 HydrophobicContact CD2-CG1 4.43Å; L86-I90 HydrophobicContact CG-CD1 4.45Å; L86-I90 WeakPolarHBondContact O-CG1 3.32Å; L86-I90 PolarHBondContact O-N 2.97Å
87	V	97.8	Very high	95.9	Very high	71 Å²	71	100.6 Å²	100.6	43%	0.43	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-46.1	175.9	170.9	0	0	0	0	111.2	I83 T84 V85 F89 I90 I91	I83-V87 HydrophobicContact CG2-CG2 4.3Å; I83-V87 WeakPolarHBondContact O-CG2 3.34Å; I83-V87 PolarHBondContact O-N 3.38Å; T84-V87 PolarHBondContact O-N 3.16Å; V85-V87 PolarHBondContact O-N 3.49Å; V87-F89 VanDerWaalsContact C-N 3.31Å; V87-F89 PolarHBondContact O-N 3.23Å; V87-I90 PolarHBondContact O-N 3.47Å; V87-I91 HydrophobicContact CG1-CD1 3.9Å; V87-I91 VanDerWaalsContact O-CG1 3.32Å; V87-I91 WeakPolarHBondContact O-CG1 3.32Å; V87-I91 PolarHBondContact O-N 3.42Å
88	I	97.7	Very high	96.4	Very high	89 Å²	89	99 Å²	99	46%	0.456	52%	0.521	S	S	.	.	H	α-helix	trans	-60	-44	177.5	-67.3	165.7	0	0	0	110.6	T84 V85 I90 I91 I92	T84-I88 HydrophobicContact CG2-CD1 3.99Å; T84-I88 WeakPolarHBondContact O-CG1 3.42Å; T84-I88 PolarHBondContact O-N 3.27Å; T84-I88 VanDerWaalsContact O-N 3.1Å; V85-I88 PolarHBondContact O-N 3Å; I88-I90 PolarHBondContact O-N 3.29Å; I88-I91 PolarHBondContact O-N 2.95Å; I88-I92 HydrophobicContact CG2-CD1 3.94Å; I88-I92 WeakPolarHBondContact O-CG1 3.39Å; I88-I92 PolarHBondContact O-N 3.38Å
89	F	97.9	Very high	96.5	Very high	129 Å²	129	97.5 Å²	97.5	57%	0.566	52%	0.523	S	S	*	.	H	α-helix	trans	-61.5	-43.2	178.9	-169.7	-103.1	0	0	0	112.2	V85 L86 V87 I91 I92 I93	V85-F89 WeakPolarHBondContact O-CB 3.32Å; V85-F89 PolarHBondContact O-N 3.26Å; L86-F89 PolarHBondContact O-N 3.44Å; V87-F89 VanDerWaalsContact C-N 3.31Å; V87-F89 PolarHBondContact O-N 3.23Å; F89-I91 PolarHBondContact O-N 3.35Å; F89-I92 PolarHBondContact O-N 3.42Å; F89-I93 HydrophobicContact CD1-CD1 3.75Å; F89-I93 HydrophobicContact CE1-CD1 3.36Å; F89-I93 HydrophobicContact CE1-CG1 4.31Å; F89-I93 HydrophobicContact CZ-CD1 3.98Å; F89-I93 WeakPolarHBondContact O-CG1 3.36Å; F89-I93 PolarHBondContact O-N 2.98Å; F89-I93 VanDerWaalsContact O-N 3.09Å
90	I	97.7	Very high	96.2	Very high	82 Å²	82	95.3 Å²	95.3	42%	0.421	54%	0.535	S	S	.	.	H	α-helix	trans	-61.3	-44.2	175	-70.8	174.5	0	0	0	111	L86 V87 I88 I92 I93 I94	L86-I90 HydrophobicContact CD2-CD1 3.57Å; L86-I90 HydrophobicContact CD2-CG1 4.43Å; L86-I90 HydrophobicContact CG-CD1 4.45Å; L86-I90 WeakPolarHBondContact O-CG1 3.32Å; L86-I90 PolarHBondContact O-N 2.97Å; V87-I90 PolarHBondContact O-N 3.47Å; I88-I90 PolarHBondContact O-N 3.29Å; I90-I92 VanDerWaalsContact C-N 3.33Å; I90-I92 PolarHBondContact O-N 3.01Å; I90-I93 PolarHBondContact O-N 3.37Å; I90-I94 HydrophobicContact CG2-CD1 3.7Å; I90-I94 HydrophobicContact CG2-CG1 4.34Å; I90-I94 WeakPolarHBondContact O-CG1 3.43Å; I90-I94 PolarHBondContact O-N 3.02Å
91	I	97.4	Very high	96.4	Very high	93 Å²	93	97.5 Å²	97.5	48%	0.477	54%	0.541	S	S	.	.	H	α-helix	trans	-59.7	-44.7	178.4	-68.2	165.8	0	0	0	110.7	V87 I88 F89 I93 I94 V95	V87-I91 HydrophobicContact CG1-CD1 3.9Å; V87-I91 VanDerWaalsContact O-CG1 3.32Å; V87-I91 WeakPolarHBondContact O-CG1 3.32Å; V87-I91 PolarHBondContact O-N 3.42Å; I88-I91 PolarHBondContact O-N 2.95Å; F89-I91 PolarHBondContact O-N 3.35Å; I91-I93 VanDerWaalsContact C-N 3.35Å; I91-I93 PolarHBondContact O-N 3.46Å; I91-I94 PolarHBondContact O-N 2.96Å; I91-V95 HydrophobicContact CG2-CG2 4.37Å; I91-V95 WeakPolarHBondContact O-CG2 3.35Å; I91-V95 PolarHBondContact O-N 3.38Å
92	I	97.1	Very high	96.4	Very high	103 Å²	103	97.8 Å²	97.8	53%	0.528	54%	0.544	S	S	.	.	H	α-helix	trans	-60.1	-45.4	178.2	-67.9	166.9	0	0	0	110.9	I88 F89 I90 V95 W96	I88-I92 HydrophobicContact CG2-CD1 3.94Å; I88-I92 WeakPolarHBondContact O-CG1 3.39Å; I88-I92 PolarHBondContact O-N 3.38Å; F89-I92 PolarHBondContact O-N 3.42Å; I90-I92 VanDerWaalsContact C-N 3.33Å; I90-I92 PolarHBondContact O-N 3.01Å; I92-V95 PolarHBondContact O-N 2.94Å; I92-W96 WeakPolarHBondContact O-CB 3.3Å; I92-W96 PolarHBondContact O-N 3.29Å
93	I	97.4	Very high	96.5	Very high	79 Å²	79	101 Å²	101	41%	0.405	55%	0.551	S	S	.	*	H	α-helix	trans	-60.7	-46.9	177.8	-71.4	175.8	0	0	0	110.8	F89 I90 I91 V95 W96 V97	F89-I93 HydrophobicContact CD1-CD1 3.75Å; F89-I93 HydrophobicContact CE1-CD1 3.36Å; F89-I93 HydrophobicContact CE1-CG1 4.31Å; F89-I93 HydrophobicContact CZ-CD1 3.98Å; F89-I93 WeakPolarHBondContact O-CG1 3.36Å; F89-I93 PolarHBondContact O-N 2.98Å; F89-I93 VanDerWaalsContact O-N 3.09Å; I90-I93 PolarHBondContact O-N 3.37Å; I91-I93 VanDerWaalsContact C-N 3.35Å; I91-I93 PolarHBondContact O-N 3.46Å; I93-V95 PolarHBondContact O-N 3.44Å; I93-W96 PolarHBondContact O-N 2.95Å; I93-V97 HydrophobicContact CG2-CG2 4.34Å; I93-V97 WeakPolarHBondContact O-CG2 3.44Å; I93-V97 PolarHBondContact O-N 3.4Å
94	I	97.4	Very high	96.5	Very high	98 Å²	98	101 Å²	101	50%	0.503	55%	0.553	S	S	.	*	H	α-helix	trans	-60.5	-47.2	-179.9	-68.5	169.4	0	0	0	110.6	I90 I91 W96 V97 V98	I90-I94 HydrophobicContact CG2-CD1 3.7Å; I90-I94 HydrophobicContact CG2-CG1 4.34Å; I90-I94 WeakPolarHBondContact O-CG1 3.43Å; I90-I94 PolarHBondContact O-N 3.02Å; I91-I94 PolarHBondContact O-N 2.96Å; I94-W96 VanDerWaalsContact C-N 3.32Å; I94-W96 PolarHBondContact O-N 3.47Å; I94-V97 PolarHBondContact O-N 2.96Å; I94-V98 HydrophobicContact CG2-CG2 4.37Å; I94-V98 WeakPolarHBondContact O-CB 3.49Å; I94-V98 VanDerWaalsContact O-CG2 3.3Å; I94-V98 WeakPolarHBondContact O-CG2 3.28Å; I94-V98 PolarHBondContact O-N 3.29Å
95	V	97.5	Very high	96.5	Very high	84 Å²	84	102.1 Å²	102.1	51%	0.509	56%	0.556	S	S	.	*	H	α-helix	trans	-61.7	-42.2	179	171.8	0	0	0	0	111.2	I91 I92 I93 V98 S99	I91-V95 HydrophobicContact CG2-CG2 4.37Å; I91-V95 WeakPolarHBondContact O-CG2 3.35Å; I91-V95 PolarHBondContact O-N 3.38Å; I92-V95 PolarHBondContact O-N 2.94Å; I93-V95 PolarHBondContact O-N 3.44Å; V95-V98 PolarHBondContact O-N 3.09Å; V95-S99 VanDerWaalsContact O-CB 3.28Å; V95-S99 WeakPolarHBondContact O-CB 3.33Å; V95-S99 PolarHBondContact O-N 3.45Å; V95-S99 PolarHBondContact O-OG 2.74Å
96	W	97.6	Very high	96.4	Very high	181 Å²	181	102.9 Å²	102.9	69%	0.686	56%	0.557	S	S	*	*	H	α-helix	trans	-64.1	-45.2	178.8	-177.5	76.8	0	0	0	112.1	I92 I93 I94 S99 S100	I92-W96 WeakPolarHBondContact O-CB 3.3Å; I92-W96 PolarHBondContact O-N 3.29Å; I93-W96 PolarHBondContact O-N 2.95Å; I94-W96 VanDerWaalsContact C-N 3.32Å; I94-W96 PolarHBondContact O-N 3.47Å; W96-S99 PolarHBondContact O-N 3.33Å; W96-S100 WeakPolarHBondContact O-CB 3.38Å; W96-S100 PolarHBondContact O-N 3.06Å
97	V	97.3	Very high	96.4	Very high	84 Å²	84	102.7 Å²	102.7	51%	0.509	56%	0.557	S	S	.	*	H	α-helix	trans	-65.4	-39	177.6	171.2	0	0	0	0	112	I93 I94 S99	I93-V97 HydrophobicContact CG2-CG2 4.34Å; I93-V97 WeakPolarHBondContact O-CG2 3.44Å; I93-V97 PolarHBondContact O-N 3.4Å; I94-V97 PolarHBondContact O-N 2.96Å; V97-S99 VanDerWaalsContact C-N 3.35Å
98	V	97	Very high	96.3	Very high	115 Å²	115	105.2 Å²	105.2	70%	0.697	57%	0.567	S	S	*	*	H	α-helix	trans	-73.1	-29	179.4	170.2	0	0	0	0	112.3	I94 V95	I94-V98 HydrophobicContact CG2-CG2 4.37Å; I94-V98 WeakPolarHBondContact O-CB 3.49Å; I94-V98 VanDerWaalsContact O-CG2 3.3Å; I94-V98 WeakPolarHBondContact O-CG2 3.28Å; I94-V98 PolarHBondContact O-N 3.29Å; V95-V98 PolarHBondContact O-N 3.09Å
99	S	91.7	Very high	96.1	Very high	97 Å²	97	106.5 Å²	106.5	68%	0.678	58%	0.576	S	S	*	*	H	α-helix	trans	-90.9	-9.2	-179.2	-49.9	0	0	0	0	113.7	V95 W96 V97	V95-S99 VanDerWaalsContact O-CB 3.28Å; V95-S99 WeakPolarHBondContact O-CB 3.33Å; V95-S99 PolarHBondContact O-N 3.45Å; V95-S99 PolarHBondContact O-OG 2.74Å; W96-S99 PolarHBondContact O-N 3.33Å; V97-S99 VanDerWaalsContact C-N 3.35Å
100	S	87.8	Confident	96	Very high	133 Å²	133	104.5 Å²	104.5	93%	0.93	58%	0.577	S	S	*	*			trans	-94.2	0	175.9	-175.9	0	0	0	0	111.7	W96	W96-S100 WeakPolarHBondContact O-CB 3.38Å; W96-S100 PolarHBondContact O-N 3.06Å

Retrieved 100 of 100 residues in 465.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).