A0A2K5NUA4_CERAT Loading...

Small integral membrane protein 11A

AlphaFold DB , UniProt , Accession A0A2K5NUA4, Species CERAT (Cercocebus atys, Sooty mangabey), Gene n/a, Length 58 aa.

						>A0A2K5NUA4_CERAT|A0A2K5NUA4
MNWKVLEHVPLLLYILAAKTLILCLAFAGVKIYQRKRLEAKQQKLEAERKKQSEKKDN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	68.3	Low	218 Å²	218	128.6 Å²	128.6	100%	1.074	64%	0.637	S	S	*	*				0	138	0	-74.9	74.7	143.6	0	0	109.5	W3	M1-W3 PolarHBondContact O-N 3.22Å; M1-W3 VanDerWaalsContact O-N 3.11Å
2	N	62	Low	69.7	Low	131 Å²	131	127 Å²	127	70%	0.701	63%	0.632	S	S	*	*			trans	-82.5	83.7	-172.3	-140.1	-67	0	0	0	110.4	K4 V5	N2-K4 PolarHBondContact O-N 3.31Å; N2-V5 PolarHBondContact O-N 3.12Å
3	W	63	Low	71.1	Confident	210 Å²	210	125.4 Å²	125.4	80%	0.795	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.8	-13.8	179.9	-100.6	-68.2	0	0	0	114.3	M1 V5 L6	M1-W3 PolarHBondContact O-N 3.22Å; M1-W3 VanDerWaalsContact O-N 3.11Å; W3-V5 VanDerWaalsContact C-N 3.29Å; W3-V5 PolarHBondContact O-N 3.45Å; W3-L6 WeakPolarHBondContact O-CB 3.44Å; W3-L6 PolarHBondContact O-N 3.35Å; W3-L6 VanDerWaalsContact O-N 3.12Å
4	K	63.3	Low	72.4	Confident	139 Å²	139	130 Å²	130	60%	0.604	63%	0.634	S	S	*	*	H	α-helix	trans	-67.4	-24.3	-176.9	-151.9	160	-179	167.1	0	113.9	N2 L6 H8	N2-K4 PolarHBondContact O-N 3.31Å; K4-L6 VanDerWaalsContact C-N 3.28Å; K4-L6 PolarHBondContact O-N 3.46Å; K4-H8 PolarHBondContact O-CD2 3.09Å
5	V	64.9	Low	73.7	Confident	97 Å²	97	128 Å²	128	59%	0.588	63%	0.626	S	S	*	*	H	α-helix	trans	-65.5	-35	173	164.3	0	0	0	0	111.2	N2 W3 E7 H8 V9	N2-V5 PolarHBondContact O-N 3.12Å; W3-V5 VanDerWaalsContact C-N 3.29Å; W3-V5 PolarHBondContact O-N 3.45Å; V5-E7 VanDerWaalsContact C-N 3.26Å; V5-E7 PolarHBondContact O-N 3.02Å; V5-H8 PolarHBondContact O-N 3Å; V5-V9 WeakPolarHBondContact O-CG2 3.39Å; V5-V9 PolarHBondContact O-N 3.4Å
6	L	62.3	Low	74.9	Confident	119 Å²	119	126.5 Å²	126.5	62%	0.623	62%	0.621	S	S	*	*	H	α-helix	trans	-67.6	-27.2	-175.8	-135.5	81	0	0	0	112.4	W3 K4 P10	W3-L6 WeakPolarHBondContact O-CB 3.44Å; W3-L6 PolarHBondContact O-N 3.35Å; W3-L6 VanDerWaalsContact O-N 3.12Å; K4-L6 VanDerWaalsContact C-N 3.28Å; K4-L6 PolarHBondContact O-N 3.46Å; L6-P10 WeakPolarHBondContact O-CD 3.24Å
7	E	67.2	Low	76	Confident	146 Å²	146	121.7 Å²	121.7	68%	0.682	61%	0.606	S	S	*	*	H	α-helix	trans	-71.9	-28.4	176.5	-68	-159.9	107	0	0	113.1	V5 P10	V5-E7 VanDerWaalsContact C-N 3.26Å; V5-E7 PolarHBondContact O-N 3.02Å; E7-P10 WeakPolarHBondContact O-CD 3.47Å; E7-P10 WeakPolarHBondContact O-CG 3.28Å
8	H	74.1	Confident	77.1	Confident	108 Å²	108	117.3 Å²	117.3	50%	0.5	59%	0.592	S	S	.	*	H	α-helix	trans	-85	-20.1	178.5	-68.7	-61.3	0	0	0	113.2	K4 V5 L11 L12	K4-H8 PolarHBondContact O-CD2 3.09Å; V5-H8 PolarHBondContact O-N 3Å; H8-L11 PolarHBondContact O-N 3.46Å; H8-L12 WeakPolarHBondContact O-CB 3.47Å; H8-L12 VanDerWaalsContact O-CG 3.23Å; H8-L12 WeakPolarHBondContact O-CG 3.27Å; H8-L12 PolarHBondContact O-N 2.94Å
9	V	78.5	Confident	78	Confident	63 Å²	63	118.1 Å²	118.1	38%	0.382	59%	0.591	S	S	.	*	H	α-helix	trans	-54.9	-52.3	177.4	174.2	0	0	0	0	112.9	V5 L11 L12 L13	V5-V9 WeakPolarHBondContact O-CG2 3.39Å; V5-V9 PolarHBondContact O-N 3.4Å; V9-L11 VanDerWaalsContact C-N 3.28Å; V9-L11 PolarHBondContact O-N 3.34Å; V9-L12 PolarHBondContact O-N 3.41Å; V9-L13 HydrophobicContact CG1-CD1 4.08Å; V9-L13 WeakPolarHBondContact O-CG 3.47Å; V9-L13 PolarHBondContact O-N 2.96Å
10	P	81.8	Confident	78.9	Confident	77 Å²	77	116 Å²	116	50%	0.5	59%	0.585	S	S	.	*	H	α-helix	trans	-63.1	-34.2	178.6	21.1	-30.7	0	0	0	112.6	L6 E7 L13 Y14	L6-P10 WeakPolarHBondContact O-CD 3.24Å; E7-P10 WeakPolarHBondContact O-CD 3.47Å; E7-P10 WeakPolarHBondContact O-CG 3.28Å; P10-L13 PolarHBondContact O-N 3.39Å; P10-Y14 PolarHBondContact O-N 3.2Å
11	L	84.8	Confident	79.6	Confident	107 Å²	107	115.8 Å²	115.8	56%	0.56	59%	0.585	S	S	*	*	H	α-helix	trans	-67.6	-42.6	176.9	-154.6	108.8	0	0	0	111.7	H8 V9 Y14 I15	H8-L11 PolarHBondContact O-N 3.46Å; V9-L11 VanDerWaalsContact C-N 3.28Å; V9-L11 PolarHBondContact O-N 3.34Å; L11-Y14 WeakPolarHBondContact O-CB 3.44Å; L11-Y14 PolarHBondContact O-N 2.94Å; L11-I15 HydrophobicContact CD2-CD1 4.14Å; L11-I15 WeakPolarHBondContact O-CG1 3.47Å; L11-I15 PolarHBondContact O-N 3.15Å
12	L	85.3	Confident	81.8	Confident	109 Å²	109	111 Å²	111	57%	0.571	56%	0.562	S	S	*	*	H	α-helix	trans	-63.9	-40.5	176.1	-70.9	168.6	0	0	0	111.7	H8 V9 Y14 I15 L16	H8-L12 WeakPolarHBondContact O-CB 3.47Å; H8-L12 VanDerWaalsContact O-CG 3.23Å; H8-L12 WeakPolarHBondContact O-CG 3.27Å; H8-L12 PolarHBondContact O-N 2.94Å; V9-L12 PolarHBondContact O-N 3.41Å; L12-Y14 VanDerWaalsContact C-N 3.33Å; L12-I15 PolarHBondContact O-N 2.99Å; L12-L16 WeakPolarHBondContact O-CB 3.45Å; L12-L16 PolarHBondContact O-N 3.32Å
13	L	87.5	Confident	83.3	Confident	106 Å²	106	109.7 Å²	109.7	56%	0.555	56%	0.555	S	S	*	*	H	α-helix	trans	-64.1	-38.7	174.5	-70.4	173.5	0	0	0	111.7	V9 P10 L16 A17	V9-L13 HydrophobicContact CG1-CD1 4.08Å; V9-L13 WeakPolarHBondContact O-CG 3.47Å; V9-L13 PolarHBondContact O-N 2.96Å; P10-L13 PolarHBondContact O-N 3.39Å; L13-L16 PolarHBondContact O-N 3.37Å; L13-A17 WeakPolarHBondContact O-CB 3.41Å; L13-A17 PolarHBondContact O-N 3.11Å
14	Y	89.6	Confident	84.7	Confident	190 Å²	190	103.6 Å²	103.6	75%	0.745	54%	0.543	S	S	*	.	H	α-helix	trans	-64.4	-43.2	175.5	-133.7	-84.1	0	0	0	112	P10 L11 L12 L16 A17 A18	P10-Y14 PolarHBondContact O-N 3.2Å; L11-Y14 WeakPolarHBondContact O-CB 3.44Å; L11-Y14 PolarHBondContact O-N 2.94Å; L12-Y14 VanDerWaalsContact C-N 3.33Å; Y14-L16 VanDerWaalsContact C-N 3.34Å; Y14-A17 PolarHBondContact O-N 3.12Å; Y14-A18 WeakPolarHBondContact O-CB 3.34Å; Y14-A18 PolarHBondContact O-N 2.91Å
15	I	92.1	Very high	86.2	Confident	100 Å²	100	103.1 Å²	103.1	51%	0.513	55%	0.547	S	S	.	.	H	α-helix	trans	-63.4	-42.4	175.6	-67	164.9	0	0	0	110.6	L11 L12 A18 K19	L11-I15 HydrophobicContact CD2-CD1 4.14Å; L11-I15 WeakPolarHBondContact O-CG1 3.47Å; L11-I15 PolarHBondContact O-N 3.15Å; L12-I15 PolarHBondContact O-N 2.99Å; I15-A18 PolarHBondContact O-N 3.45Å; I15-K19 PolarHBondContact O-N 2.94Å
16	L	92.1	Very high	87.5	Confident	104 Å²	104	101.1 Å²	101.1	55%	0.545	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-47	177.3	-175.8	65.1	0	0	0	111	L12 L13 Y14 A18 K19 T20	L12-L16 WeakPolarHBondContact O-CB 3.45Å; L12-L16 PolarHBondContact O-N 3.32Å; L13-L16 PolarHBondContact O-N 3.37Å; Y14-L16 VanDerWaalsContact C-N 3.34Å; L16-A18 PolarHBondContact O-N 2.92Å; L16-K19 PolarHBondContact O-N 2.89Å; L16-T20 WeakPolarHBondContact O-CG2 3.22Å; L16-T20 PolarHBondContact O-N 3.21Å; L16-T20 PolarHBondContact O-OG1 3.47Å
17	A	94.1	Very high	88.9	Confident	45 Å²	45	103 Å²	103	37%	0.372	54%	0.544	S	S	.	.	H	α-helix	trans	-61.6	-41.5	175.8	0	0	0	0	0	112	L13 Y14 K19 T20 L21	L13-A17 WeakPolarHBondContact O-CB 3.41Å; L13-A17 PolarHBondContact O-N 3.11Å; Y14-A17 PolarHBondContact O-N 3.12Å; A17-K19 VanDerWaalsContact C-N 3.34Å; A17-K19 PolarHBondContact O-N 2.9Å; A17-T20 WeakPolarHBondContact CA-OG1 3.44Å; A17-T20 PolarHBondContact O-N 3.06Å; A17-T20 PolarHBondContact O-OG1 3.47Å; A17-L21 WeakPolarHBondContact O-CB 3.49Å; A17-L21 VanDerWaalsContact O-CG 3.27Å; A17-L21 WeakPolarHBondContact O-CG 3.44Å; A17-L21 PolarHBondContact O-N 3.15Å
18	A	95.9	Very high	90.2	Very high	42 Å²	42	98 Å²	98	35%	0.347	53%	0.528	S	S	.	.	H	α-helix	trans	-61.3	-43.4	175.3	0	0	0	0	0	111.6	Y14 I15 L16 T20 L21 I22	Y14-A18 WeakPolarHBondContact O-CB 3.34Å; Y14-A18 PolarHBondContact O-N 2.91Å; I15-A18 PolarHBondContact O-N 3.45Å; L16-A18 PolarHBondContact O-N 2.92Å; A18-T20 PolarHBondContact O-N 3.15Å; A18-L21 PolarHBondContact O-N 3.3Å; A18-I22 VanDerWaalsContact O-CG1 3.28Å; A18-I22 WeakPolarHBondContact O-CG1 3.35Å; A18-I22 PolarHBondContact O-N 3.34Å
19	K	94.6	Very high	91	Very high	133 Å²	133	94.7 Å²	94.7	58%	0.578	52%	0.523	S	S	*	.	H	α-helix	trans	-64	-40.7	178.1	-172.5	176.4	175.8	71	0	112	I15 L16 A17 I22 L23	I15-K19 PolarHBondContact O-N 2.94Å; L16-K19 PolarHBondContact O-N 2.89Å; A17-K19 VanDerWaalsContact C-N 3.34Å; A17-K19 PolarHBondContact O-N 2.9Å; K19-I22 PolarHBondContact O-N 3.46Å; K19-L23 HydrophobicContact CG-CD1 4.35Å; K19-L23 VanDerWaalsContact O-CG 3.3Å; K19-L23 WeakPolarHBondContact O-CG 3.35Å; K19-L23 PolarHBondContact O-N 3.33Å
20	T	95.1	Very high	91.7	Very high	76 Å²	76	95.5 Å²	95.5	47%	0.466	53%	0.528	S	S	.	.	H	α-helix	trans	-68.8	-38.1	177.2	58.1	0	0	0	0	111.9	L16 A17 A18 L23 C24	L16-T20 WeakPolarHBondContact O-CG2 3.22Å; L16-T20 PolarHBondContact O-N 3.21Å; L16-T20 PolarHBondContact O-OG1 3.47Å; A17-T20 WeakPolarHBondContact CA-OG1 3.44Å; A17-T20 PolarHBondContact O-N 3.06Å; A17-T20 PolarHBondContact O-OG1 3.47Å; A18-T20 PolarHBondContact O-N 3.15Å; T20-L23 PolarHBondContact O-N 3.46Å; T20-C24 VanDerWaalsContact O-CB 3.31Å; T20-C24 WeakPolarHBondContact O-CB 3.49Å; T20-C24 PolarHBondContact O-N 3.35Å
21	L	94.7	Very high	91.9	Very high	112 Å²	112	97.8 Å²	97.8	59%	0.586	53%	0.53	S	S	*	.	H	α-helix	trans	-62.7	-44.8	174.1	-72.7	174.5	0	0	0	112	A17 A18 L23 C24 L25	A17-L21 WeakPolarHBondContact O-CB 3.49Å; A17-L21 VanDerWaalsContact O-CG 3.27Å; A17-L21 WeakPolarHBondContact O-CG 3.44Å; A17-L21 PolarHBondContact O-N 3.15Å; A18-L21 PolarHBondContact O-N 3.3Å; L21-L23 VanDerWaalsContact C-N 3.33Å; L21-L23 PolarHBondContact O-N 2.87Å; L21-C24 PolarHBondContact O-N 3.5Å; L21-L25 WeakPolarHBondContact O-CB 3.34Å; L21-L25 WeakPolarHBondContact O-CG 3.49Å; L21-L25 PolarHBondContact O-N 2.88Å
22	I	95.3	Very high	92	Very high	116 Å²	116	97.5 Å²	97.5	60%	0.595	53%	0.528	S	S	*	.	H	α-helix	trans	-60.4	-44.5	176.2	-68.2	165.1	0	0	0	110.6	A18 K19 L25 A26	A18-I22 VanDerWaalsContact O-CG1 3.28Å; A18-I22 WeakPolarHBondContact O-CG1 3.35Å; A18-I22 PolarHBondContact O-N 3.34Å; K19-I22 PolarHBondContact O-N 3.46Å; I22-L25 PolarHBondContact O-N 2.97Å; I22-A26 WeakPolarHBondContact O-CB 3.34Å; I22-A26 PolarHBondContact O-N 2.9Å
23	L	93.8	Very high	92.1	Very high	104 Å²	104	99.5 Å²	99.5	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-64	-40.2	176.7	-72.3	170.6	0	0	0	112.1	K19 T20 L21 A26 F27	K19-L23 HydrophobicContact CG-CD1 4.35Å; K19-L23 VanDerWaalsContact O-CG 3.3Å; K19-L23 WeakPolarHBondContact O-CG 3.35Å; K19-L23 PolarHBondContact O-N 3.33Å; T20-L23 PolarHBondContact O-N 3.46Å; L21-L23 VanDerWaalsContact C-N 3.33Å; L21-L23 PolarHBondContact O-N 2.87Å; L23-A26 PolarHBondContact O-N 3.33Å; L23-F27 WeakPolarHBondContact O-CB 3.28Å; L23-F27 PolarHBondContact O-N 3.47Å
24	C	92.4	Very high	91.9	Very high	82 Å²	82	100.8 Å²	100.8	55%	0.554	53%	0.532	S	S	*	.	H	α-helix	trans	-63.7	-45.1	177.6	-170.8	0	0	0	0	111.6	T20 L21 F27 A28	T20-C24 VanDerWaalsContact O-CB 3.31Å; T20-C24 WeakPolarHBondContact O-CB 3.49Å; T20-C24 PolarHBondContact O-N 3.35Å; L21-C24 PolarHBondContact O-N 3.5Å; C24-F27 PolarHBondContact O-N 3.02Å; C24-A28 WeakPolarHBondContact O-CB 3.37Å; C24-A28 PolarHBondContact O-N 3.49Å
25	L	93.5	Very high	91.5	Very high	129 Å²	129	99.8 Å²	99.8	68%	0.675	53%	0.527	S	S	*	.	H	α-helix	trans	-64.9	-42.5	176.4	-71.4	170.5	0	0	0	112	L21 I22 F27 A28 G29	L21-L25 WeakPolarHBondContact O-CB 3.34Å; L21-L25 WeakPolarHBondContact O-CG 3.49Å; L21-L25 PolarHBondContact O-N 2.88Å; I22-L25 PolarHBondContact O-N 2.97Å; L25-F27 VanDerWaalsContact C-N 3.35Å; L25-F27 PolarHBondContact O-N 3.13Å; L25-A28 PolarHBondContact O-N 3.42Å; L25-G29 PolarHBondContact O-N 3.28Å
26	A	93.6	Very high	91	Very high	56 Å²	56	101.8 Å²	101.8	46%	0.463	53%	0.532	S	S	.	.	H	α-helix	trans	-60.6	-45.1	175.1	0	0	0	0	0	111.3	I22 L23 G29 V30	I22-A26 WeakPolarHBondContact O-CB 3.34Å; I22-A26 PolarHBondContact O-N 2.9Å; L23-A26 PolarHBondContact O-N 3.33Å; A26-G29 PolarHBondContact O-N 2.93Å; A26-V30 WeakPolarHBondContact O-CG2 3.31Å; A26-V30 PolarHBondContact O-N 3.45Å
27	F	92.1	Very high	90.5	Very high	157 Å²	157	103.6 Å²	103.6	69%	0.689	53%	0.532	S	S	*	.	H	α-helix	trans	-65.9	-43.6	178.9	-172.1	-100.8	0	0	0	112.6	L23 C24 L25 G29 V30 K31	L23-F27 WeakPolarHBondContact O-CB 3.28Å; L23-F27 PolarHBondContact O-N 3.47Å; C24-F27 PolarHBondContact O-N 3.02Å; L25-F27 VanDerWaalsContact C-N 3.35Å; L25-F27 PolarHBondContact O-N 3.13Å; F27-G29 VanDerWaalsContact C-N 3.33Å; F27-G29 PolarHBondContact O-N 3.35Å; F27-V30 PolarHBondContact O-N 3.44Å; F27-K31 PolarHBondContact O-N 3.12Å
28	A	94	Very high	89.8	Confident	43 Å²	43	106.7 Å²	106.7	36%	0.355	54%	0.541	S	S	.	.	H	α-helix	trans	-61.4	-42.4	173.8	0	0	0	0	0	111.5	C24 L25 K31 I32	C24-A28 WeakPolarHBondContact O-CB 3.37Å; C24-A28 PolarHBondContact O-N 3.49Å; L25-A28 PolarHBondContact O-N 3.42Å; A28-K31 PolarHBondContact O-N 2.93Å; A28-I32 WeakPolarHBondContact O-CG1 3.3Å; A28-I32 PolarHBondContact O-N 3.48Å
29	G	91.3	Very high	89.1	Confident	37 Å²	37	109.4 Å²	109.4	38%	0.381	55%	0.547	S	S	.	.	H	α-helix	trans	-59.8	-46.7	175.8	0	0	0	0	0	112.7	L25 A26 F27 K31 I32 Y33	L25-G29 PolarHBondContact O-N 3.28Å; A26-G29 PolarHBondContact O-N 2.93Å; F27-G29 VanDerWaalsContact C-N 3.33Å; F27-G29 PolarHBondContact O-N 3.35Å; G29-K31 PolarHBondContact O-N 2.92Å; G29-I32 PolarHBondContact O-N 3.43Å; G29-Y33 WeakPolarHBondContact O-CB 3.34Å; G29-Y33 PolarHBondContact O-N 2.84Å
30	V	91.9	Very high	88.6	Confident	81 Å²	81	105.3 Å²	105.3	49%	0.491	54%	0.538	S	S	.	.	H	α-helix	trans	-61.8	-42.5	176.1	172.2	0	0	0	0	111.3	A26 F27 I32 Y33 Q34	A26-V30 WeakPolarHBondContact O-CG2 3.31Å; A26-V30 PolarHBondContact O-N 3.45Å; F27-V30 PolarHBondContact O-N 3.44Å; V30-I32 PolarHBondContact O-N 3.38Å; V30-Y33 PolarHBondContact O-N 3.04Å; V30-Q34 HydrophobicContact CG1-CG 4.36Å; V30-Q34 WeakPolarHBondContact O-CB 3.36Å; V30-Q34 WeakPolarHBondContact O-CG 3.41Å; V30-Q34 PolarHBondContact O-N 3.29Å
31	K	86.7	Confident	87.9	Confident	124 Å²	124	108.2 Å²	108.2	54%	0.539	54%	0.544	S	S	.	.	H	α-helix	trans	-61.9	-42.8	178.1	-171.6	-179.3	-178.6	178.3	0	111.9	F27 A28 G29 R35	F27-K31 PolarHBondContact O-N 3.12Å; A28-K31 PolarHBondContact O-N 2.93Å; G29-K31 PolarHBondContact O-N 2.92Å; K31-R35 PolarHBondContact O-N 2.94Å; K31-R35 VanDerWaalsContact O-N 3.12Å
32	I	87	Confident	87.2	Confident	101 Å²	101	108.6 Å²	108.6	52%	0.518	54%	0.543	S	S	.	.	H	α-helix	trans	-66.6	-43.1	176.1	-67.4	163.3	0	0	0	110.5	A28 G29 V30 Q34 R35 K36	A28-I32 WeakPolarHBondContact O-CG1 3.3Å; A28-I32 PolarHBondContact O-N 3.48Å; G29-I32 PolarHBondContact O-N 3.43Å; V30-I32 PolarHBondContact O-N 3.38Å; I32-Q34 PolarHBondContact O-N 2.91Å; I32-R35 PolarHBondContact O-N 3.32Å; I32-K36 HydrophobicContact CG2-CD 4.46Å; I32-K36 HydrophobicContact CG2-CG 4.47Å; I32-K36 PolarHBondContact O-N 2.89Å
33	Y	86.1	Confident	86.6	Confident	151 Å²	151	109.4 Å²	109.4	59%	0.592	54%	0.544	S	S	*	.	H	α-helix	trans	-63	-43.3	179.3	-177.3	-98.4	0	0	0	112.4	G29 V30 K36 R37	G29-Y33 WeakPolarHBondContact O-CB 3.34Å; G29-Y33 PolarHBondContact O-N 2.84Å; V30-Y33 PolarHBondContact O-N 3.04Å; Y33-K36 PolarHBondContact O-N 3.01Å; Y33-R37 HydrophobicContact CE1-CG 4.13Å; Y33-R37 PolarHBondContact O-N 3.44Å
34	Q	83.3	Confident	86	Confident	133 Å²	133	112 Å²	112	62%	0.621	55%	0.551	S	S	*	*	H	α-helix	trans	-63.7	-43.2	175.8	-73.8	-158.2	79.1	0	0	112.1	V30 I32 R37 L38	V30-Q34 HydrophobicContact CG1-CG 4.36Å; V30-Q34 WeakPolarHBondContact O-CB 3.36Å; V30-Q34 WeakPolarHBondContact O-CG 3.41Å; V30-Q34 PolarHBondContact O-N 3.29Å; I32-Q34 PolarHBondContact O-N 2.91Å; Q34-R37 PolarHBondContact O-N 3.35Å; Q34-L38 PolarHBondContact O-N 3.33Å; Q34-L38 VanDerWaalsContact O-N 3.13Å
35	R	82.4	Confident	85.4	Confident	169 Å²	169	113.1 Å²	113.1	64%	0.638	55%	0.551	S	S	*	*	H	α-helix	trans	-60	-49.5	174.3	-80.5	-166.5	174.5	-163.3	-1.4	111.9	K31 I32 R37 L38 E39	K31-R35 PolarHBondContact O-N 2.94Å; K31-R35 VanDerWaalsContact O-N 3.12Å; I32-R35 PolarHBondContact O-N 3.32Å; R35-R37 VanDerWaalsContact C-N 3.3Å; R35-R37 PolarHBondContact O-N 2.97Å; R35-L38 WeakPolarHBondContact O-CB 3.27Å; R35-L38 PolarHBondContact O-N 3.35Å; R35-E39 WeakPolarHBondContact O-CG 3.46Å; R35-E39 PolarHBondContact O-N 3.06Å
36	K	80.3	Confident	84.8	Confident	143 Å²	143	112.6 Å²	112.6	62%	0.622	55%	0.545	S	S	*	.	H	α-helix	trans	-60.5	-36.5	177.9	-76.9	-164.4	178.1	-163.1	0	112.9	I32 Y33 L38 A40	I32-K36 HydrophobicContact CG2-CD 4.46Å; I32-K36 HydrophobicContact CG2-CG 4.47Å; I32-K36 PolarHBondContact O-N 2.89Å; Y33-K36 PolarHBondContact O-N 3.01Å; K36-L38 VanDerWaalsContact C-N 3.34Å; K36-A40 WeakPolarHBondContact O-CB 3.41Å; K36-A40 PolarHBondContact O-N 3.24Å
37	R	82.5	Confident	84.2	Confident	142 Å²	142	112.3 Å²	112.3	54%	0.536	54%	0.542	S	S	.	.	H	α-helix	trans	-63.5	-38.9	173.7	-95.5	-171.5	76.7	-172.6	6.3	112.3	Y33 Q34 R35 K41	Y33-R37 HydrophobicContact CE1-CG 4.13Å; Y33-R37 PolarHBondContact O-N 3.44Å; Q34-R37 PolarHBondContact O-N 3.35Å; R35-R37 VanDerWaalsContact C-N 3.3Å; R35-R37 PolarHBondContact O-N 2.97Å; R37-K41 WeakPolarHBondContact O-CG 3.38Å; R37-K41 PolarHBondContact O-N 3.48Å; R37-K41 VanDerWaalsContact O-N 3.15Å
38	L	79.8	Confident	83.6	Confident	110 Å²	110	110.7 Å²	110.7	58%	0.576	54%	0.537	S	S	*	.	H	α-helix	trans	-69	-45.9	178.7	-170.4	68.6	0	0	0	110.9	Q34 R35 K36 A40 K41 Q42	Q34-L38 PolarHBondContact O-N 3.33Å; Q34-L38 VanDerWaalsContact O-N 3.13Å; R35-L38 WeakPolarHBondContact O-CB 3.27Å; R35-L38 PolarHBondContact O-N 3.35Å; K36-L38 VanDerWaalsContact C-N 3.34Å; L38-A40 VanDerWaalsContact C-N 3.35Å; L38-A40 PolarHBondContact O-N 3.45Å; L38-K41 WeakPolarHBondContact O-CB 3.48Å; L38-K41 PolarHBondContact O-N 3.5Å; L38-K41 VanDerWaalsContact O-N 3.15Å; L38-Q42 PolarHBondContact O-N 3.34Å
39	E	81.4	Confident	82.7	Confident	99 Å²	99	116.7 Å²	116.7	46%	0.463	55%	0.55	S	S	.	*	H	α-helix	trans	-61.7	-42.2	176.3	-68.5	174	103.3	0	0	111.5	R35 K41 Q42 Q43	R35-E39 WeakPolarHBondContact O-CG 3.46Å; R35-E39 PolarHBondContact O-N 3.06Å; E39-K41 VanDerWaalsContact C-N 3.28Å; E39-K41 PolarHBondContact O-N 2.86Å; E39-Q42 PolarHBondContact O-N 3Å; E39-Q43 WeakPolarHBondContact O-CG 3.38Å; E39-Q43 PolarHBondContact O-N 3.23Å
40	A	83.4	Confident	82	Confident	47 Å²	47	122.1 Å²	122.1	39%	0.388	56%	0.564	S	S	.	*	H	α-helix	trans	-63.6	-32.7	176	0	0	0	0	0	112.8	K36 L38 K44	K36-A40 WeakPolarHBondContact O-CB 3.41Å; K36-A40 PolarHBondContact O-N 3.24Å; L38-A40 VanDerWaalsContact C-N 3.35Å; L38-A40 PolarHBondContact O-N 3.45Å; A40-K44 WeakPolarHBondContact O-CB 3.46Å; A40-K44 VanDerWaalsContact O-CG 3.24Å; A40-K44 WeakPolarHBondContact O-CG 3.46Å; A40-K44 PolarHBondContact O-N 2.88Å; A40-K44 VanDerWaalsContact O-N 3.15Å
41	K	80.6	Confident	81.3	Confident	137 Å²	137	125.5 Å²	125.5	60%	0.596	57%	0.571	S	S	*	*	H	α-helix	trans	-69.6	-42.1	173.8	-78.1	-173.5	176.7	-167.2	0	111.8	R37 L38 E39 K44 L45	R37-K41 WeakPolarHBondContact O-CG 3.38Å; R37-K41 PolarHBondContact O-N 3.48Å; R37-K41 VanDerWaalsContact O-N 3.15Å; L38-K41 WeakPolarHBondContact O-CB 3.48Å; L38-K41 PolarHBondContact O-N 3.5Å; L38-K41 VanDerWaalsContact O-N 3.15Å; E39-K41 VanDerWaalsContact C-N 3.28Å; E39-K41 PolarHBondContact O-N 2.86Å; K41-K44 PolarHBondContact O-N 2.94Å; K41-L45 PolarHBondContact O-N 2.9Å; K41-L45 VanDerWaalsContact O-N 3.12Å
42	Q	80.7	Confident	80.6	Confident	120 Å²	120	125.1 Å²	125.1	56%	0.561	57%	0.572	S	S	*	*	H	α-helix	trans	-65.3	-45.9	177.9	-72.7	-176.2	-44.1	0	0	111.7	L38 E39 K44 L45 E46	L38-Q42 PolarHBondContact O-N 3.34Å; E39-Q42 PolarHBondContact O-N 3Å; Q42-K44 VanDerWaalsContact C-N 3.31Å; Q42-K44 PolarHBondContact O-N 2.86Å; Q42-L45 WeakPolarHBondContact O-CB 3.23Å; Q42-L45 PolarHBondContact O-N 3.27Å; Q42-L45 VanDerWaalsContact O-N 3.11Å; Q42-E46 PolarHBondContact O-N 2.88Å
43	Q	81.6	Confident	79.7	Confident	132 Å²	132	124.3 Å²	124.3	62%	0.617	58%	0.575	S	S	*	*	H	α-helix	trans	-61.5	-38.6	177	-73	-177	35.1	0	0	112.6	E39 L45 E46 A47	E39-Q43 WeakPolarHBondContact O-CG 3.38Å; E39-Q43 PolarHBondContact O-N 3.23Å; Q43-L45 VanDerWaalsContact C-N 3.34Å; Q43-E46 PolarHBondContact O-N 3.48Å; Q43-A47 VanDerWaalsContact O-CB 3.28Å; Q43-A47 WeakPolarHBondContact O-CB 3.46Å; Q43-A47 PolarHBondContact O-N 3.4Å
44	K	81.1	Confident	78.6	Confident	158 Å²	158	124.6 Å²	124.6	69%	0.687	58%	0.581	S	S	*	*	H	α-helix	trans	-61.8	-42.2	174	-78.1	179.9	179.6	-163.4	0	112	A40 K41 Q42 A47 E48	A40-K44 WeakPolarHBondContact O-CB 3.46Å; A40-K44 VanDerWaalsContact O-CG 3.24Å; A40-K44 WeakPolarHBondContact O-CG 3.46Å; A40-K44 PolarHBondContact O-N 2.88Å; A40-K44 VanDerWaalsContact O-N 3.15Å; K41-K44 PolarHBondContact O-N 2.94Å; Q42-K44 VanDerWaalsContact C-N 3.31Å; Q42-K44 PolarHBondContact O-N 2.86Å; K44-A47 PolarHBondContact O-N 3.36Å; K44-E48 WeakPolarHBondContact O-CB 3.48Å; K44-E48 PolarHBondContact O-N 3.34Å
45	L	80.1	Confident	77.6	Confident	106 Å²	106	126.9 Å²	126.9	56%	0.555	59%	0.589	S	S	*	*	H	α-helix	trans	-66.6	-44	178.3	-165	78.8	0	0	0	111.7	K41 Q42 Q43 E48 R49	K41-L45 PolarHBondContact O-N 2.9Å; K41-L45 VanDerWaalsContact O-N 3.12Å; Q42-L45 WeakPolarHBondContact O-CB 3.23Å; Q42-L45 PolarHBondContact O-N 3.27Å; Q42-L45 VanDerWaalsContact O-N 3.11Å; Q43-L45 VanDerWaalsContact C-N 3.34Å; L45-E48 PolarHBondContact O-N 2.99Å; L45-R49 VanDerWaalsContact O-CG 3.27Å; L45-R49 WeakPolarHBondContact O-CG 3.46Å; L45-R49 PolarHBondContact O-N 3.39Å
46	E	80.6	Confident	76.4	Confident	119 Å²	119	127.9 Å²	127.9	56%	0.556	60%	0.598	S	S	*	*	H	α-helix	trans	-62.5	-42.6	175	-93.5	-172.1	87.3	0	0	112.3	Q42 Q43 E48 R49 K50	Q42-E46 PolarHBondContact O-N 2.88Å; Q43-E46 PolarHBondContact O-N 3.48Å; E46-E48 VanDerWaalsContact C-N 3.32Å; E46-E48 PolarHBondContact O-N 3.25Å; E46-R49 PolarHBondContact O-N 2.89Å; E46-K50 WeakPolarHBondContact O-CG 3.36Å; E46-K50 PolarHBondContact O-N 3.2Å
47	A	81.7	Confident	75.2	Confident	49 Å²	49	128.3 Å²	128.3	41%	0.405	61%	0.608	S	S	.	*	H	α-helix	trans	-63.6	-38.4	177.3	0	0	0	0	0	112	Q43 K44 K51	Q43-A47 VanDerWaalsContact O-CB 3.28Å; Q43-A47 WeakPolarHBondContact O-CB 3.46Å; Q43-A47 PolarHBondContact O-N 3.4Å; K44-A47 PolarHBondContact O-N 3.36Å; A47-K51 WeakPolarHBondContact O-CG 3.39Å; A47-K51 PolarHBondContact O-N 3.36Å; A47-K51 VanDerWaalsContact O-N 3.09Å
48	E	78.3	Confident	73.7	Confident	124 Å²	124	131.2 Å²	131.2	58%	0.579	63%	0.634	S	S	*	*	H	α-helix	trans	-68	-41.1	175.7	-165.5	176.5	94.1	0	0	111.9	K44 L45 E46 K51 Q52	K44-E48 WeakPolarHBondContact O-CB 3.48Å; K44-E48 PolarHBondContact O-N 3.34Å; L45-E48 PolarHBondContact O-N 2.99Å; E46-E48 VanDerWaalsContact C-N 3.32Å; E46-E48 PolarHBondContact O-N 3.25Å; E48-K51 PolarHBondContact O-N 3.01Å; E48-Q52 PolarHBondContact O-N 3.37Å
49	R	77	Confident	73.4	Confident	169 Å²	169	132.3 Å²	132.3	64%	0.638	64%	0.637	S	S	*	*	H	α-helix	trans	-62.3	-43.8	174.8	-72	-70.7	-173.3	166.7	2	112.5	L45 E46 Q52 S53	L45-R49 VanDerWaalsContact O-CG 3.27Å; L45-R49 WeakPolarHBondContact O-CG 3.46Å; L45-R49 PolarHBondContact O-N 3.39Å; E46-R49 PolarHBondContact O-N 2.89Å; R49-Q52 PolarHBondContact O-N 3.48Å; R49-S53 PolarHBondContact O-N 3.43Å
50	K	76.3	Confident	73	Confident	151 Å²	151	134.1 Å²	134.1	66%	0.657	65%	0.646	S	S	*	*	H	α-helix	trans	-62.7	-45	176.1	-73.8	-171.7	179.9	-165.3	0	111.7	E46 Q52 S53 E54	E46-K50 WeakPolarHBondContact O-CG 3.36Å; E46-K50 PolarHBondContact O-N 3.2Å; K50-Q52 VanDerWaalsContact C-N 3.33Å; K50-Q52 PolarHBondContact O-N 3.22Å; K50-S53 WeakPolarHBondContact O-CB 3.15Å; K50-S53 PolarHBondContact O-N 2.98Å; K50-E54 PolarHBondContact O-N 3.04Å
51	K	76.3	Confident	72.4	Confident	151 Å²	151	138.9 Å²	138.9	66%	0.657	66%	0.66	S	S	*	*	H	α-helix	trans	-62.6	-36.4	175.9	-77	-176.9	177.1	-169	0	113.3	A47 E48 K55	A47-K51 WeakPolarHBondContact O-CG 3.39Å; A47-K51 PolarHBondContact O-N 3.36Å; A47-K51 VanDerWaalsContact O-N 3.09Å; E48-K51 PolarHBondContact O-N 3.01Å; K51-K55 PolarHBondContact O-N 3.32Å
52	Q	72.7	Confident	71.9	Confident	117 Å²	117	139 Å²	139	55%	0.547	66%	0.664	S	S	.	*	H	α-helix	trans	-69.6	-36.4	174.6	-99	-172.9	-10.6	0	0	112.7	E48 R49 K50 K56	E48-Q52 PolarHBondContact O-N 3.37Å; R49-Q52 PolarHBondContact O-N 3.48Å; K50-Q52 VanDerWaalsContact C-N 3.33Å; K50-Q52 PolarHBondContact O-N 3.22Å; Q52-K56 PolarHBondContact O-N 3.12Å
53	S	67.6	Low	71.3	Confident	83 Å²	83	140.2 Å²	140.2	58%	0.58	67%	0.67	S	S	*	*	H	α-helix	trans	-65.3	-44	176.4	-170.3	0	0	0	0	111.6	R49 K50 K55 K56 D57	R49-S53 PolarHBondContact O-N 3.43Å; K50-S53 WeakPolarHBondContact O-CB 3.15Å; K50-S53 PolarHBondContact O-N 2.98Å; S53-K55 VanDerWaalsContact C-N 3.33Å; S53-K55 PolarHBondContact O-N 3.11Å; S53-K56 PolarHBondContact O-N 3.48Å; S53-K56 VanDerWaalsContact O-N 3.12Å; S53-D57 PolarHBondContact O-N 3.47Å
54	E	63.7	Low	70.7	Confident	157 Å²	157	140.7 Å²	140.7	73%	0.734	67%	0.674	S	S	*	*	H	α-helix	trans	-66.8	-32.7	179.5	-164.3	174	89.7	0	0	112.4	K50 K56	K50-E54 PolarHBondContact O-N 3.04Å; E54-K56 VanDerWaalsContact C-N 3.29Å; E54-K56 PolarHBondContact O-N 3.33Å
55	K	60.7	Low	69.9	Low	181 Å²	181	139.5 Å²	139.5	79%	0.787	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.6	-13.7	172.8	-85.7	-172	176	-173.7	0	114.7	K51 S53	K51-K55 PolarHBondContact O-N 3.32Å; S53-K55 VanDerWaalsContact C-N 3.33Å; S53-K55 PolarHBondContact O-N 3.11Å
56	K	58.4	Low	69.1	Low	190 Å²	190	142.1 Å²	142.1	83%	0.826	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	-10.4	-177.5	-148.2	179.9	-176	-175.8	0	112.6	Q52 S53 E54	Q52-K56 PolarHBondContact O-N 3.12Å; S53-K56 PolarHBondContact O-N 3.48Å; S53-K56 VanDerWaalsContact O-N 3.12Å; E54-K56 VanDerWaalsContact C-N 3.29Å; E54-K56 PolarHBondContact O-N 3.33Å
57	D	55.8	Low	68.2	Low	153 Å²	153	144 Å²	144	82%	0.818	69%	0.693	S	S	*	*			trans	-99.8	1.3	-178.6	-160.4	-119.9	0	0	0	113	S53	S53-D57 PolarHBondContact O-N 3.47Å
58	N	49.8	Very low	66.9	Low	203 Å²	203	152.6 Å²	152.6	100%	1.086	72%	0.719	S	S	*	*			trans	-128.1	0	176.9	-166.9	75.3	0	0	0	110.5

Retrieved 58 of 58 residues in 41.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).