A0A2K5YI94_MANLE Loading...

Interferon alpha inducible protein 27 like 2

AlphaFold DB , UniProt , Accession A0A2K5YI94, Species MANLE (Mandrillus leucophaeus, Drill), Gene IFI27L2, Length 129 aa.

						>A0A2K5YI94_MANLE|A0A2K5YI94|IFI27L2
MMKQAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVAILQSVGAAGLSTSSNILLASVGSVLGAYLGKSPSSLPAEPEAEGNEATENVPQGEPPKPPLKSEKHEE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.5	Low	57.3	Low	216 Å²	216	107.9 Å²	107.9	100%	1.064	64%	0.643	S	S	*	*				0	-47.9	0	-66.8	170.9	127.4	0	112.9	K3 Q4 A5	M1-K3 VanDerWaalsContact C-N 3.31Å; M1-K3 PolarHBondContact O-N 3.16Å; M1-Q4 PolarHBondContact O-N 2.9Å; M1-Q4 VanDerWaalsContact O-N 3.13Å; M1-A5 PolarHBondContact O-N 2.99Å
2	M	56.4	Low	57.6	Low	176 Å²	176	101.8 Å²	101.8	87%	0.867	62%	0.619	S	S	*	*	H	α-helix	trans	-57	-36.2	-177.2	-54	179.6	-152.7	0	115	Q4 A5 A6	M2-Q4 VanDerWaalsContact C-N 3.31Å; M2-Q4 PolarHBondContact O-N 2.8Å; M2-A5 PolarHBondContact O-N 2.99Å; M2-A6 PolarHBondContact O-N 3.28Å; M2-A6 VanDerWaalsContact O-N 3.12Å
3	K	47.2	Very low	57.8	Low	188 Å²	188	98.9 Å²	98.9	82%	0.817	61%	0.612	S	S	*	*	H	α-helix	trans	-65	-31.5	179.3	-62.7	-176.6	178.5	-178.1	113.5	M1 A7	M1-K3 VanDerWaalsContact C-N 3.31Å; M1-K3 PolarHBondContact O-N 3.16Å; K3-A7 WeakPolarHBondContact O-CB 3.06Å; K3-A7 PolarHBondContact O-N 3.49Å; K3-A7 VanDerWaalsContact O-N 3.15Å
4	Q	53.5	Low	57.7	Low	160 Å²	160	100.5 Å²	100.5	75%	0.748	61%	0.614	S	S	*	*	H	α-helix	trans	-80.6	-36.9	180	-71.8	-160.6	-28.9	0	112.2	M1 M2 A6 A7 A8	M1-Q4 PolarHBondContact O-N 2.9Å; M1-Q4 VanDerWaalsContact O-N 3.13Å; M2-Q4 VanDerWaalsContact C-N 3.31Å; M2-Q4 PolarHBondContact O-N 2.8Å; Q4-A6 VanDerWaalsContact C-N 3.34Å; Q4-A7 PolarHBondContact O-N 2.97Å; Q4-A8 WeakPolarHBondContact O-CB 3.22Å; Q4-A8 PolarHBondContact O-N 2.93Å
5	A	55.6	Low	57.6	Low	64 Å²	64	97.5 Å²	97.5	53%	0.529	60%	0.603	S	S	.	*	H	α-helix	trans	-63.1	-41.6	173	0	0	0	0	111.5	M1 M2 A8 A9	M1-A5 PolarHBondContact O-N 2.99Å; M2-A5 PolarHBondContact O-N 2.99Å; A5-A8 PolarHBondContact O-N 3.16Å; A5-A9 WeakPolarHBondContact O-CB 3.46Å; A5-A9 PolarHBondContact O-N 2.74Å
6	A	55.1	Low	57.5	Low	56 Å²	56	98.1 Å²	98.1	46%	0.463	61%	0.607	S	S	.	*	H	α-helix	trans	-63.7	-43.4	174.7	0	0	0	0	112.1	M2 Q4 A9 V10	M2-A6 PolarHBondContact O-N 3.28Å; M2-A6 VanDerWaalsContact O-N 3.12Å; Q4-A6 VanDerWaalsContact C-N 3.34Å; A6-A9 PolarHBondContact O-N 3.27Å; A6-V10 VanDerWaalsContact O-CG2 3.28Å; A6-V10 WeakPolarHBondContact O-CG2 3.12Å; A6-V10 PolarHBondContact O-N 2.78Å
7	A	57.2	Low	57.7	Low	64 Å²	64	94.9 Å²	94.9	53%	0.529	60%	0.598	S	S	.	*	H	α-helix	trans	-65.2	-38.5	176.4	0	0	0	0	112.6	K3 Q4 G11	K3-A7 WeakPolarHBondContact O-CB 3.06Å; K3-A7 PolarHBondContact O-N 3.49Å; K3-A7 VanDerWaalsContact O-N 3.15Å; Q4-A7 PolarHBondContact O-N 2.97Å; A7-G11 PolarHBondContact O-N 3.21Å
8	A	61.6	Low	57.7	Low	68 Å²	68	92.3 Å²	92.3	56%	0.562	59%	0.586	S	S	*	*	H	α-helix	trans	-68.4	-38.7	175.4	0	0	0	0	112.1	Q4 A5 G12	Q4-A8 WeakPolarHBondContact O-CB 3.22Å; Q4-A8 PolarHBondContact O-N 2.93Å; A5-A8 PolarHBondContact O-N 3.16Å; A8-G12 PolarHBondContact O-N 3.33Å
9	A	58.9	Low	57.5	Low	65 Å²	65	92.4 Å²	92.4	54%	0.537	59%	0.585	S	S	.	*	H	α-helix	trans	-65.9	-43.1	175.5	0	0	0	0	111.8	A5 A6 A13	A5-A9 WeakPolarHBondContact O-CB 3.46Å; A5-A9 PolarHBondContact O-N 2.74Å; A6-A9 PolarHBondContact O-N 3.27Å; A9-A13 VanDerWaalsContact O-CB 3.29Å; A9-A13 WeakPolarHBondContact O-CB 3.36Å; A9-A13 PolarHBondContact O-N 2.91Å
10	V	66.2	Low	57.5	Low	90 Å²	90	91.2 Å²	91.2	55%	0.545	58%	0.578	S	S	.	*	H	α-helix	trans	-67	-45.5	175.6	173.7	0	0	0	110.8	A6 G12 A13 L14	A6-V10 VanDerWaalsContact O-CG2 3.28Å; A6-V10 WeakPolarHBondContact O-CG2 3.12Å; A6-V10 PolarHBondContact O-N 2.78Å; V10-G12 PolarHBondContact O-N 2.87Å; V10-A13 PolarHBondContact O-N 3.01Å; V10-L14 HydrophobicContact CG1-CD1 4.14Å; V10-L14 VanDerWaalsContact O-CG 3.28Å; V10-L14 WeakPolarHBondContact O-CG 3.25Å; V10-L14 PolarHBondContact O-N 3.44Å
11	G	64.4	Low	57.6	Low	40 Å²	40	91.6 Å²	91.6	41%	0.412	58%	0.579	S	S	.	*	H	α-helix	trans	-62.1	-41	176.6	0	0	0	0	112.8	A7 L14 A15	A7-G11 PolarHBondContact O-N 3.21Å; G11-L14 PolarHBondContact O-N 3.01Å; G11-A15 WeakPolarHBondContact O-CB 3.47Å; G11-A15 PolarHBondContact O-N 3.3Å
12	G	60.8	Low	57.8	Low	34 Å²	34	85.9 Å²	85.9	35%	0.351	56%	0.556	S	S	.	*	H	α-helix	trans	-65.9	-43.2	175.5	0	0	0	0	112.7	A8 V10 L14 A15 V16	A8-G12 PolarHBondContact O-N 3.33Å; V10-G12 PolarHBondContact O-N 2.87Å; G12-L14 VanDerWaalsContact C-N 3.34Å; G12-L14 PolarHBondContact O-N 2.88Å; G12-A15 PolarHBondContact O-N 3.41Å; G12-V16 VanDerWaalsContact O-CG2 3.31Å; G12-V16 WeakPolarHBondContact O-CG2 3.17Å; G12-V16 PolarHBondContact O-N 2.68Å
13	A	60.3	Low	58	Low	65 Å²	65	81.6 Å²	81.6	54%	0.537	54%	0.537	S	S	.	.	H	α-helix	trans	-63.1	-39.8	176.7	0	0	0	0	112.2	A9 V10 G17	A9-A13 VanDerWaalsContact O-CB 3.29Å; A9-A13 WeakPolarHBondContact O-CB 3.36Å; A9-A13 PolarHBondContact O-N 2.91Å; V10-A13 PolarHBondContact O-N 3.01Å; A13-G17 PolarHBondContact O-N 2.83Å
14	L	56	Low	58.4	Low	121 Å²	121	75.3 Å²	75.3	63%	0.634	52%	0.516	S	S	*	.	H	α-helix	trans	-67.7	-38.8	175.7	-67.8	175.1	0	0	112.1	V10 G11 G12 G17 A18	V10-L14 HydrophobicContact CG1-CD1 4.14Å; V10-L14 VanDerWaalsContact O-CG 3.28Å; V10-L14 WeakPolarHBondContact O-CG 3.25Å; V10-L14 PolarHBondContact O-N 3.44Å; G11-L14 PolarHBondContact O-N 3.01Å; G12-L14 VanDerWaalsContact C-N 3.34Å; G12-L14 PolarHBondContact O-N 2.88Å; L14-G17 PolarHBondContact O-N 3.21Å; L14-A18 WeakPolarHBondContact O-CB 3.5Å; L14-A18 PolarHBondContact O-N 2.97Å
15	A	56	Low	58.5	Low	55 Å²	55	72 Å²	72	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-65.2	-44.1	175.9	0	0	0	0	111.8	G11 G12 G17 A18 V19	G11-A15 WeakPolarHBondContact O-CB 3.47Å; G11-A15 PolarHBondContact O-N 3.3Å; G12-A15 PolarHBondContact O-N 3.41Å; A15-G17 VanDerWaalsContact C-N 3.3Å; A15-G17 PolarHBondContact O-N 3.39Å; A15-A18 PolarHBondContact O-N 3Å; A15-V19 VanDerWaalsContact O-CG2 3.31Å; A15-V19 WeakPolarHBondContact O-CG2 3.43Å; A15-V19 PolarHBondContact O-N 2.94Å
16	V	56.4	Low	58.4	Low	108 Å²	108	75.9 Å²	75.9	66%	0.655	53%	0.525	S	S	*	.	H	α-helix	trans	-65.7	-33.7	177.4	173.1	0	0	0	111.6	G12 P20	G12-V16 VanDerWaalsContact O-CG2 3.31Å; G12-V16 WeakPolarHBondContact O-CG2 3.17Å; G12-V16 PolarHBondContact O-N 2.68Å; V16-P20 WeakPolarHBondContact O-CD 3.4Å
17	G	60.2	Low	58.3	Low	44 Å²	44	73.7 Å²	73.7	45%	0.454	51%	0.508	S	S	.	.	H	α-helix	trans	-74.2	-29.8	174.3	0	0	0	0	114.3	A13 L14 A15 P20 V21	A13-G17 PolarHBondContact O-N 2.83Å; L14-G17 PolarHBondContact O-N 3.21Å; A15-G17 VanDerWaalsContact C-N 3.3Å; A15-G17 PolarHBondContact O-N 3.39Å; G17-P20 WeakPolarHBondContact O-CD 3.39Å; G17-V21 WeakPolarHBondContact O-CG2 3.26Å
18	A	57.9	Low	58	Low	48 Å²	48	74.6 Å²	74.6	40%	0.397	50%	0.5	S	S	.	.	H	α-helix	trans	-77	-31.2	-179.4	0	0	0	0	113.1	L14 A15 V21 V22	L14-A18 WeakPolarHBondContact O-CB 3.5Å; L14-A18 PolarHBondContact O-N 2.97Å; A15-A18 PolarHBondContact O-N 3Å; A18-V21 PolarHBondContact O-N 2.96Å; A18-V21 VanDerWaalsContact O-N 3.11Å; A18-V22 WeakPolarHBondContact O-CG2 3.43Å; A18-V22 PolarHBondContact O-N 2.88Å
19	V	54.5	Low	57.5	Low	94 Å²	94	74.6 Å²	74.6	57%	0.57	49%	0.493	S	S	*	.	H	α-helix	trans	-58.7	-48.9	-179.1	170.3	0	0	0	112.1	A15 V21 V22 L23	A15-V19 VanDerWaalsContact O-CG2 3.31Å; A15-V19 WeakPolarHBondContact O-CG2 3.43Å; A15-V19 PolarHBondContact O-N 2.94Å; V19-V21 VanDerWaalsContact C-N 3.28Å; V19-V21 PolarHBondContact O-N 3.39Å; V19-V22 PolarHBondContact O-N 2.8Å; V19-L23 WeakPolarHBondContact O-CB 3.24Å; V19-L23 PolarHBondContact O-N 3.29Å
20	P	57.3	Low	56.9	Low	68 Å²	68	75.8 Å²	75.8	44%	0.442	51%	0.512	S	S	.	.	H	α-helix	trans	-61	-33.1	173.8	-24.7	33.1	0	0	113.8	V16 G17 S24	V16-P20 WeakPolarHBondContact O-CD 3.4Å; G17-P20 WeakPolarHBondContact O-CD 3.39Å; P20-S24 WeakPolarHBondContact O-CB 3.36Å; P20-S24 PolarHBondContact O-N 2.91Å; P20-S24 PolarHBondContact O-OG 3.06Å
21	V	60.2	Low	55.9	Low	99 Å²	99	76.3 Å²	76.3	60%	0.6	53%	0.526	S	S	*	.	H	α-helix	trans	-73.7	-45.2	-178.2	177.5	0	0	0	111	G17 A18 V19 L23 S24 A25	G17-V21 WeakPolarHBondContact O-CG2 3.26Å; A18-V21 PolarHBondContact O-N 2.96Å; A18-V21 VanDerWaalsContact O-N 3.11Å; V19-V21 VanDerWaalsContact C-N 3.28Å; V19-V21 PolarHBondContact O-N 3.39Å; V21-L23 VanDerWaalsContact C-N 3.33Å; V21-S24 PolarHBondContact O-N 2.87Å; V21-A25 WeakPolarHBondContact O-CB 3.41Å; V21-A25 PolarHBondContact O-N 3.09Å
22	V	58.7	Low	55.3	Low	96 Å²	96	75.7 Å²	75.7	58%	0.582	52%	0.52	S	S	*	.	H	α-helix	trans	-65.7	-40	175.3	175.1	0	0	0	110.5	A18 V19 A25 M26	A18-V22 WeakPolarHBondContact O-CG2 3.43Å; A18-V22 PolarHBondContact O-N 2.88Å; V19-V22 PolarHBondContact O-N 2.8Å; V22-A25 PolarHBondContact O-N 3.26Å; V22-M26 WeakPolarHBondContact O-CG 3.39Å; V22-M26 PolarHBondContact O-N 3.5Å
23	L	59.1	Low	54.7	Low	87 Å²	87	77.8 Å²	77.8	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-69.5	-35.3	178.2	-171	62.5	0	0	112.2	V19 V21 M26 G27 F28	V19-L23 WeakPolarHBondContact O-CB 3.24Å; V19-L23 PolarHBondContact O-N 3.29Å; V21-L23 VanDerWaalsContact C-N 3.33Å; L23-M26 CarbonylContact O-C 3.6Å; L23-M26 PolarHBondContact O-N 2.92Å; L23-G27 PolarHBondContact O-N 3.33Å; L23-F28 CarbonylContact C-O 3.58Å; L23-F28 HydrophobicContact CD1-CB 3.94Å; L23-F28 HydrophobicContact CD2-CB 4.44Å; L23-F28 HydrophobicContact CG-CB 3.76Å; L23-F28 PolarHBondContact O-N 2.99Å
24	S	56.9	Low	54	Low	56 Å²	56	77 Å²	77	39%	0.392	52%	0.516	S	S	.	.	H	α-helix	trans	-67.8	-39.1	171.3	-63.8	0	0	0	112.1	P20 V21 M26 G27 F28	P20-S24 WeakPolarHBondContact O-CB 3.36Å; P20-S24 PolarHBondContact O-N 2.91Å; P20-S24 PolarHBondContact O-OG 3.06Å; V21-S24 PolarHBondContact O-N 2.87Å; S24-M26 VanDerWaalsContact C-N 3.27Å; S24-M26 PolarHBondContact O-N 3.29Å; S24-G27 WeakPolarHBondContact O-CA 3.38Å; S24-G27 PolarHBondContact O-N 2.91Å; S24-F28 WeakPolarHBondContact CA-O 3.36Å
25	A	56	Low	53.4	Low	90 Å²	90	76 Å²	76	74%	0.744	53%	0.525	S	S	*	.	H	α-helix	trans	-65.8	-30.6	174.4	0	0	0	0	112.5	V21 V22 G27	V21-A25 WeakPolarHBondContact O-CB 3.41Å; V21-A25 PolarHBondContact O-N 3.09Å; V22-A25 PolarHBondContact O-N 3.26Å; A25-G27 PolarHBondContact O-N 3.48Å
26	M	52.9	Low	52.9	Low	145 Å²	145	78.8 Å²	78.8	71%	0.714	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	0.7	171.5	-73.5	-77.5	-77.6	0	113.4	V22 L23 S24	V22-M26 WeakPolarHBondContact O-CG 3.39Å; V22-M26 PolarHBondContact O-N 3.5Å; L23-M26 CarbonylContact O-C 3.6Å; L23-M26 PolarHBondContact O-N 2.92Å; S24-M26 VanDerWaalsContact C-N 3.27Å; S24-M26 PolarHBondContact O-N 3.29Å
27	G	52.1	Low	52.3	Low	10 Å²	10	75.7 Å²	75.7	10%	0.103	52%	0.524	C	S	.	.	T	Hydrogen-bonded Turn	trans	95.1	10.5	171.7	0	0	0	0	115.5	L23 S24 A25 I33 A34	L23-G27 PolarHBondContact O-N 3.33Å; S24-G27 WeakPolarHBondContact O-CA 3.38Å; S24-G27 PolarHBondContact O-N 2.91Å; A25-G27 PolarHBondContact O-N 3.48Å; G27-I33 CarbonylContact O-C 3.52Å; G27-I33 VanDerWaalsContact O-CA 3.25Å; G27-I33 WeakPolarHBondContact O-CA 3.09Å; G27-A34 PolarHBondContact O-N 3.11Å
28	F	51.1	Low	51.4	Low	83 Å²	83	80.6 Å²	80.6	36%	0.364	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	87.9	171.2	-133	-80.6	0	0	108.6	L23 S24 I33 L59	L23-F28 CarbonylContact C-O 3.58Å; L23-F28 HydrophobicContact CD1-CB 3.94Å; L23-F28 HydrophobicContact CD2-CB 4.44Å; L23-F28 HydrophobicContact CG-CB 3.76Å; L23-F28 PolarHBondContact O-N 2.99Å; S24-F28 WeakPolarHBondContact CA-O 3.36Å; F28-I33 HydrophobicContact CB-CD1 4.36Å; F28-I33 HydrophobicContact CD2-CD1 3.07Å; F28-I33 HydrophobicContact CD2-CG1 3.74Å; F28-I33 HydrophobicContact CE2-CD1 3.43Å; F28-I33 VanDerWaalsContact CE2-CD1 3.43Å; F28-I33 HydrophobicContact CE2-CG1 3.64Å; F28-I33 HydrophobicContact CG-CD1 3.89Å; F28-I33 HydrophobicContact CG-CG1 4.44Å; F28-I33 HydrophobicContact CZ-CD1 4.49Å; F28-I33 HydrophobicContact CZ-CG1 4.33Å; F28-L59 HydrophobicContact CE1-CD2 3.56Å; F28-L59 HydrophobicContact CZ-CD2 3.85Å
29	T	52.2	Low	50.8	Low	68 Å²	68	81 Å²	81	42%	0.417	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	158.8	174.4	177.8	0	0	0	109.7	A31 G32	T29-A31 PolarHBondContact O-N 2.91Å; T29-G32 WeakPolarHBondContact CG2-O 3.28Å; T29-G32 PolarHBondContact N-O 3.49Å; T29-G32 VanDerWaalsContact N-O 3.16Å; T29-G32 CarbonylContact O-C 3.58Å; T29-G32 PolarHBondContact O-N 3.36Å; T29-G32 VanDerWaalsContact O-O 3.14Å
30	G	46.3	Very low	50.2	Low	90 Å²	90	78.3 Å²	78.3	93%	0.928	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.1	-7.3	-178.3	0	0	0	0	115.3
31	A	44.6	Very low	49.4	Very low	102 Å²	102	83.5 Å²	83.5	84%	0.843	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.7	-3.4	171.7	0	0	0	0	114.2	T29	T29-A31 PolarHBondContact O-N 2.91Å
32	G	52.2	Low	48.7	Very low	27 Å²	27	86.3 Å²	86.3	28%	0.278	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	126.6	176.1	-176.6	0	0	0	0	113.9	T29 A34	T29-G32 WeakPolarHBondContact CG2-O 3.28Å; T29-G32 PolarHBondContact N-O 3.49Å; T29-G32 VanDerWaalsContact N-O 3.16Å; T29-G32 CarbonylContact O-C 3.58Å; T29-G32 PolarHBondContact O-N 3.36Å; T29-G32 VanDerWaalsContact O-O 3.14Å; G32-A34 PolarHBondContact O-N 3.34Å
33	I	47.8	Very low	48	Very low	77 Å²	77	87.8 Å²	87.8	40%	0.395	56%	0.556	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-56.5	121.5	170.4	-71.6	-77.1	0	0	108.2	G27 F28 A35	G27-I33 CarbonylContact O-C 3.52Å; G27-I33 VanDerWaalsContact O-CA 3.25Å; G27-I33 WeakPolarHBondContact O-CA 3.09Å; F28-I33 HydrophobicContact CB-CD1 4.36Å; F28-I33 HydrophobicContact CD2-CD1 3.07Å; F28-I33 HydrophobicContact CD2-CG1 3.74Å; F28-I33 HydrophobicContact CE2-CD1 3.43Å; F28-I33 VanDerWaalsContact CE2-CD1 3.43Å; F28-I33 HydrophobicContact CE2-CG1 3.64Å; F28-I33 HydrophobicContact CG-CD1 3.89Å; F28-I33 HydrophobicContact CG-CG1 4.44Å; F28-I33 HydrophobicContact CZ-CD1 4.49Å; F28-I33 HydrophobicContact CZ-CG1 4.33Å; I33-A35 PolarHBondContact O-N 2.94Å
34	A	45.2	Very low	47	Very low	50 Å²	50	87 Å²	87	41%	0.413	56%	0.557	S	S	.	*			trans	-55.5	114.8	171.3	0	0	0	0	108.2	G27 G32 S36 S37	G27-A34 PolarHBondContact O-N 3.11Å; G32-A34 PolarHBondContact O-N 3.34Å; A34-S36 PolarHBondContact O-N 2.96Å; A34-S37 PolarHBondContact O-N 3.4Å
35	A	42.8	Very low	46.2	Very low	100 Å²	100	88.2 Å²	88.2	83%	0.826	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	111.7	178.3	0	0	0	0	108.3	I33	I33-A35 PolarHBondContact O-N 2.94Å
36	S	46	Very low	45.7	Very low	113 Å²	113	86.8 Å²	86.8	79%	0.79	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	105.2	30.5	-174.9	-161.9	0	0	0	117.8	A34	A34-S36 PolarHBondContact O-N 2.96Å
37	S	44	Very low	45.3	Very low	42 Å²	42	82.6 Å²	82.6	29%	0.294	55%	0.547	S	S	.	.	S	Bend	trans	-90.2	166.4	159.7	-165.3	0	0	0	111.7	A34 A39 A40	A34-S37 PolarHBondContact O-N 3.4Å; S37-A39 PolarHBondContact O-N 3.22Å; S37-A40 WeakPolarHBondContact O-CA 3.36Å; S37-A40 VanDerWaalsContact O-CB 3.22Å; S37-A40 WeakPolarHBondContact O-CB 3.47Å; S37-A40 PolarHBondContact O-N 3.25Å
38	I	42.4	Very low	45	Very low	147 Å²	147	89 Å²	89	75%	0.754	58%	0.578	S	S	*	*	H	α-helix	trans	-54.9	-20.3	-175.5	-78.2	164.8	0	0	113.8	K41	I38-K41 PolarHBondContact O-N 3.42Å
39	A	44.3	Very low	44.6	Very low	57 Å²	57	89.1 Å²	89.1	47%	0.471	59%	0.594	S	S	.	*	H	α-helix	trans	-68.2	-31.2	168.8	0	0	0	0	114	S37 K41 M42 M43	S37-A39 PolarHBondContact O-N 3.22Å; A39-K41 VanDerWaalsContact C-N 3.34Å; A39-K41 PolarHBondContact O-N 3.45Å; A39-M42 PolarHBondContact O-N 3.48Å; A39-M43 WeakPolarHBondContact O-CB 2.97Å; A39-M43 PolarHBondContact O-N 3.01Å
40	A	42	Very low	44.3	Very low	37 Å²	37	92.8 Å²	92.8	31%	0.306	61%	0.611	S	S	.	*	H	α-helix	trans	-68.2	-29.6	175.9	0	0	0	0	112.4	S37 S44	S37-A40 WeakPolarHBondContact O-CA 3.36Å; S37-A40 VanDerWaalsContact O-CB 3.22Å; S37-A40 WeakPolarHBondContact O-CB 3.47Å; S37-A40 PolarHBondContact O-N 3.25Å; A40-S44 WeakPolarHBondContact O-CA 3.29Å; A40-S44 WeakPolarHBondContact O-CB 3.31Å; A40-S44 PolarHBondContact O-N 3Å
41	K	40.9	Very low	44.3	Very low	178 Å²	178	91.6 Å²	91.6	77%	0.774	60%	0.599	S	S	*	*	H	α-helix	trans	-77.9	-21.9	175.1	-79	177.5	69.1	-157.9	113.7	I38 A39	I38-K41 PolarHBondContact O-N 3.42Å; A39-K41 VanDerWaalsContact C-N 3.34Å; A39-K41 PolarHBondContact O-N 3.45Å
42	M	45.6	Very low	44.8	Very low	157 Å²	157	90.9 Å²	90.9	77%	0.773	60%	0.601	S	S	*	*	H	α-helix	trans	-87.6	-26.9	170.2	-81.7	-94.2	98.6	0	112.4	A39	A39-M42 PolarHBondContact O-N 3.48Å
43	M	43.6	Very low	44.7	Very low	128 Å²	128	93 Å²	93	63%	0.631	62%	0.623	S	S	*	*	H	α-helix	trans	-87.5	-20	173.9	-165.7	169.6	-178.9	0	113.4	A39 A45 A46 A47	A39-M43 WeakPolarHBondContact O-CB 2.97Å; A39-M43 PolarHBondContact O-N 3.01Å; M43-A45 PolarHBondContact O-N 2.94Å; M43-A46 PolarHBondContact O-N 2.96Å; M43-A47 WeakPolarHBondContact O-CB 3.28Å; M43-A47 PolarHBondContact O-N 3.46Å
44	S	38.3	Very low	44.9	Very low	71 Å²	71	95.8 Å²	95.8	50%	0.497	64%	0.643	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.5	-17.9	173.5	-175.7	0	0	0	113.4	A40	A40-S44 WeakPolarHBondContact O-CA 3.29Å; A40-S44 WeakPolarHBondContact O-CB 3.31Å; A40-S44 PolarHBondContact O-N 3Å
45	A	41	Very low	45	Very low	81 Å²	81	97.5 Å²	97.5	67%	0.669	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.4	-26.5	170.6	0	0	0	0	112.6	M43	M43-A45 PolarHBondContact O-N 2.94Å
46	A	43.8	Very low	45.2	Very low	60 Å²	60	98.2 Å²	98.2	50%	0.496	66%	0.658	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.9	-25.6	-177.5	0	0	0	0	113.7	M43	M43-A46 PolarHBondContact O-N 2.96Å
47	A	45.3	Very low	45.4	Very low	56 Å²	56	95.8 Å²	95.8	46%	0.463	65%	0.651	S	S	.	*	S	Bend	trans	-84.1	-24	-177.6	0	0	0	0	114.6	M43 A49	M43-A47 WeakPolarHBondContact O-CB 3.28Å; M43-A47 PolarHBondContact O-N 3.46Å; A47-A49 VanDerWaalsContact C-N 3.33Å
48	I	45.1	Very low	45.7	Very low	146 Å²	146	96 Å²	96	75%	0.749	65%	0.653	S	S	*	*	S	Bend	trans	-75.2	-24.2	177.4	-62.4	-168.9	0	0	111.8
49	A	44	Very low	46.1	Very low	85 Å²	85	93.6 Å²	93.6	70%	0.702	64%	0.641	S	S	*	*	S	Bend	trans	-85	-18.6	-179.6	0	0	0	0	114.7	A47	A47-A49 VanDerWaalsContact C-N 3.33Å
50	N	45.7	Very low	46.3	Very low	145 Å²	145	95.8 Å²	95.8	78%	0.775	65%	0.648	S	S	*	*	S	Bend	trans	-121.7	18.4	-169.3	-97.4	-42.3	0	0	115.7
51	G	45.8	Very low	46.7	Very low	65 Å²	65	96.8 Å²	96.8	67%	0.67	66%	0.656	S	S	*	*			trans	50.1	86.7	156.6	0	0	0	0	117.1
52	G	54	Low	47.3	Very low	86 Å²	86	93.3 Å²	93.3	89%	0.887	65%	0.645	S	S	*	*	S	Bend	trans	48.4	97.1	144.6	0	0	0	0	118.7
53	G	50.5	Low	47.7	Very low	72 Å²	72	91.7 Å²	91.7	74%	0.742	64%	0.639	S	S	*	*			trans	160.9	134.9	162.8	0	0	0	0	111.9	S55	G53-S55 PolarHBondContact O-N 3.12Å; G53-S55 VanDerWaalsContact O-N 3.16Å
54	V	51.9	Low	48.4	Very low	135 Å²	135	92.6 Å²	92.6	82%	0.818	64%	0.641	S	S	*	*			trans	-50.1	118.6	176.5	178.8	0	0	0	109.8	A56	V54-A56 PolarHBondContact O-N 3.28Å
55	S	48.8	Very low	48.9	Very low	86 Å²	86	93.1 Å²	93.1	60%	0.601	65%	0.645	S	S	*	*			trans	-65.6	123.8	179.5	55.2	0	0	0	110.2	G53 G57 S58	G53-S55 PolarHBondContact O-N 3.12Å; G53-S55 VanDerWaalsContact O-N 3.16Å; S55-G57 PolarHBondContact O-N 3.02Å; S55-S58 PolarHBondContact O-N 2.85Å
56	A	46.8	Very low	49.5	Very low	115 Å²	115	93.3 Å²	93.3	95%	0.95	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.7	102.8	165.7	0	0	0	0	108	V54	V54-A56 PolarHBondContact O-N 3.28Å
57	G	49.4	Very low	50	Low	62 Å²	62	93.5 Å²	93.5	64%	0.639	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	135.3	-3.7	-165.7	0	0	0	0	114	S55	S55-G57 PolarHBondContact O-N 3.02Å
58	S	51.4	Low	50.2	Low	48 Å²	48	95.5 Å²	95.5	34%	0.336	66%	0.662	S	S	.	*			trans	-59.2	142.4	178.1	-169.9	0	0	0	113.2	S55 V60 A61	S55-S58 PolarHBondContact O-N 2.85Å; S58-V60 PolarHBondContact O-N 3.46Å; S58-A61 PolarHBondContact O-N 2.96Å
59	L	49.7	Very low	50.4	Low	96 Å²	96	92.3 Å²	92.3	50%	0.503	66%	0.658	S	S	.	*	H	α-helix	trans	-33.6	-30.6	177.5	-178.5	64.8	0	0	116.3	F28 I62 L63	F28-L59 HydrophobicContact CE1-CD2 3.56Å; F28-L59 HydrophobicContact CZ-CD2 3.85Å; L59-I62 PolarHBondContact O-N 3.36Å; L59-L63 WeakPolarHBondContact O-CB 3.32Å; L59-L63 PolarHBondContact O-N 3.37Å
60	V	49	Very low	50.6	Low	103 Å²	103	89 Å²	89	62%	0.624	63%	0.632	S	S	*	*	H	α-helix	trans	-63.8	-37.6	177.3	178.6	0	0	0	112.4	S58 L63 Q64	S58-V60 PolarHBondContact O-N 3.46Å; V60-L63 PolarHBondContact O-N 2.91Å; V60-Q64 PolarHBondContact O-N 2.81Å
61	A	50	Low	51	Low	58 Å²	58	89 Å²	89	48%	0.479	63%	0.631	S	S	.	*	H	α-helix	trans	-72.6	-35.3	177.4	0	0	0	0	112.1	S58 S65	S58-A61 PolarHBondContact O-N 2.96Å; A61-S65 VanDerWaalsContact O-CB 3.24Å; A61-S65 WeakPolarHBondContact O-CB 2.93Å; A61-S65 PolarHBondContact O-N 3.33Å
62	I	53.7	Low	51.3	Low	104 Å²	104	90.4 Å²	90.4	53%	0.533	63%	0.631	S	S	.	*	H	α-helix	trans	-67.9	-41.2	174.3	-56.4	-58.6	0	0	110.3	L59 S65 V66	L59-I62 PolarHBondContact O-N 3.36Å; I62-S65 PolarHBondContact O-N 3.15Å; I62-V66 HydrophobicContact CG2-CG2 4.4Å; I62-V66 WeakPolarHBondContact O-CB 3.31Å; I62-V66 VanDerWaalsContact O-CG2 3.26Å; I62-V66 WeakPolarHBondContact O-CG2 3.47Å; I62-V66 PolarHBondContact O-N 3.39Å
63	L	53.7	Low	51.1	Low	124 Å²	124	91.3 Å²	91.3	65%	0.649	62%	0.619	S	S	*	*	H	α-helix	trans	-72.1	-32.4	179.9	-158.3	63.6	0	0	112.6	L59 V60 G67	L59-L63 WeakPolarHBondContact O-CB 3.32Å; L59-L63 PolarHBondContact O-N 3.37Å; V60-L63 PolarHBondContact O-N 2.91Å; L63-G67 PolarHBondContact O-N 2.88Å
64	Q	58.8	Low	51.1	Low	147 Å²	147	90.6 Å²	90.6	69%	0.687	60%	0.603	S	S	*	*	H	α-helix	trans	-70.3	-38.4	168.2	-85.9	-161.3	-35.7	0	112.8	V60 G67 A68	V60-Q64 PolarHBondContact O-N 2.81Å; Q64-G67 PolarHBondContact O-N 2.93Å; Q64-A68 PolarHBondContact O-N 2.88Å
65	S	49.4	Very low	51.1	Low	81 Å²	81	86.7 Å²	86.7	57%	0.566	58%	0.581	S	S	*	*	H	α-helix	trans	-65.2	-42	177.1	-177	0	0	0	111.6	A61 I62 A69	A61-S65 VanDerWaalsContact O-CB 3.24Å; A61-S65 WeakPolarHBondContact O-CB 2.93Å; A61-S65 PolarHBondContact O-N 3.33Å; I62-S65 PolarHBondContact O-N 3.15Å; S65-A69 PolarHBondContact O-N 3.32Å
66	V	53	Low	51.4	Low	86 Å²	86	87.7 Å²	87.7	52%	0.521	58%	0.58	S	S	.	*	H	α-helix	trans	-70.4	-34.5	173.8	174.5	0	0	0	111.5	I62 G70	I62-V66 HydrophobicContact CG2-CG2 4.4Å; I62-V66 WeakPolarHBondContact O-CB 3.31Å; I62-V66 VanDerWaalsContact O-CG2 3.26Å; I62-V66 WeakPolarHBondContact O-CG2 3.47Å; I62-V66 PolarHBondContact O-N 3.39Å; V66-G70 WeakPolarHBondContact O-CA 3.49Å; V66-G70 PolarHBondContact O-N 3.12Å; V66-G70 VanDerWaalsContact O-N 3.09Å
67	G	53.8	Low	51.8	Low	64 Å²	64	86.8 Å²	86.8	66%	0.66	56%	0.558	S	S	*	*	H	α-helix	trans	-70.6	-31.7	-179.2	0	0	0	0	115	L63 Q64	L63-G67 PolarHBondContact O-N 2.88Å; Q64-G67 PolarHBondContact O-N 2.93Å
68	A	49.5	Very low	52.3	Low	97 Å²	97	89.4 Å²	89.4	80%	0.802	56%	0.557	S	S	*	*	H	α-helix	trans	-99.1	-27	-177.2	0	0	0	0	114.3	Q64	Q64-A68 PolarHBondContact O-N 2.88Å
69	A	49.9	Very low	52.7	Low	80 Å²	80	93.1 Å²	93.1	66%	0.661	57%	0.572	S	S	*	*	H	α-helix	trans	-112.4	-14.4	-177	0	0	0	0	114.7	S65	S65-A69 PolarHBondContact O-N 3.32Å
70	G	48.5	Very low	53.3	Low	16 Å²	16	91.5 Å²	91.5	17%	0.165	57%	0.572	C	S	.	*	S	Bend	trans	-98.2	-6.9	-160.5	0	0	0	0	118.3	V66 S74 S75	V66-G70 WeakPolarHBondContact O-CA 3.49Å; V66-G70 PolarHBondContact O-N 3.12Å; V66-G70 VanDerWaalsContact O-N 3.09Å; G70-S74 PolarHBondContact O-OG 3.45Å; G70-S75 PolarHBondContact O-OG 3.45Å
71	L	53.2	Low	53.9	Low	145 Å²	145	90 Å²	90	76%	0.759	57%	0.566	S	S	*	*	S	Bend	trans	-100.3	-21.5	-165.6	-144.5	83.5	0	0	116.4
72	S	52.4	Low	54.6	Low	94 Å²	94	91.8 Å²	91.8	66%	0.657	57%	0.571	S	S	*	*	S	Bend	trans	-109.8	-25.5	-168.5	-66.6	0	0	0	116.7	N76	S72-N76 PolarHBondContact O-ND2 3.38Å; S72-N76 VanDerWaalsContact O-ND2 3.12Å
73	T	50.5	Low	55.2	Low	105 Å²	105	88.7 Å²	88.7	64%	0.644	57%	0.565	S	S	*	*	S	Bend	trans	-124.7	-46.2	-174.7	-45.3	0	0	0	113	I77	T73-I77 PolarHBondContact O-N 3.13Å
74	S	50.7	Low	55.6	Low	57 Å²	57	86.7 Å²	86.7	40%	0.399	56%	0.561	S	S	.	*	H	α-helix	trans	-72.1	-36.8	179.5	58.8	0	0	0	113.1	G70 N76 I77 L78	G70-S74 PolarHBondContact O-OG 3.45Å; S74-N76 VanDerWaalsContact C-N 3.34Å; S74-N76 PolarHBondContact O-N 2.86Å; S74-I77 PolarHBondContact O-N 3.21Å; S74-L78 WeakPolarHBondContact O-CB 3.45Å; S74-L78 PolarHBondContact O-N 3.47Å
75	S	51	Low	55.9	Low	52 Å²	52	84.5 Å²	84.5	36%	0.364	56%	0.557	S	S	.	*	H	α-helix	trans	-63.8	-36.3	176.4	-83.2	0	0	0	112.4	G70 L79	G70-S75 PolarHBondContact O-OG 3.45Å; S75-L79 WeakPolarHBondContact O-CA 3.44Å; S75-L79 WeakPolarHBondContact O-CB 3.33Å; S75-L79 PolarHBondContact O-N 3.42Å
76	N	54.2	Low	56.3	Low	107 Å²	107	86.1 Å²	86.1	57%	0.572	56%	0.559	S	S	*	*	H	α-helix	trans	-68.9	-38.7	176.8	-78	-40.7	0	0	111.9	S72 S74 A80	S72-N76 PolarHBondContact O-ND2 3.38Å; S72-N76 VanDerWaalsContact O-ND2 3.12Å; S74-N76 VanDerWaalsContact C-N 3.34Å; S74-N76 PolarHBondContact O-N 2.86Å; N76-A80 WeakPolarHBondContact O-CA 3.3Å; N76-A80 WeakPolarHBondContact O-CB 2.96Å; N76-A80 PolarHBondContact O-N 2.91Å
77	I	57	Low	56.9	Low	96 Å²	96	84.1 Å²	84.1	49%	0.492	56%	0.556	S	S	.	*	H	α-helix	trans	-73.7	-43.9	179.8	-63.1	170.2	0	0	111.2	T73 S74 A80 S81	T73-I77 PolarHBondContact O-N 3.13Å; S74-I77 PolarHBondContact O-N 3.21Å; I77-A80 PolarHBondContact O-N 3.31Å; I77-S81 VanDerWaalsContact O-CB 3.25Å; I77-S81 WeakPolarHBondContact O-CB 3.45Å; I77-S81 PolarHBondContact O-N 2.79Å
78	L	59.4	Low	57.1	Low	118 Å²	118	84.3 Å²	84.3	62%	0.618	55%	0.551	S	S	*	*	H	α-helix	trans	-68.4	-41.7	176.9	-75.9	173.1	0	0	111.7	S74 S81 V82	S74-L78 WeakPolarHBondContact O-CB 3.45Å; S74-L78 PolarHBondContact O-N 3.47Å; L78-S81 PolarHBondContact O-N 2.81Å; L78-V82 WeakPolarHBondContact O-CB 3.47Å; L78-V82 WeakPolarHBondContact O-CG2 3.43Å; L78-V82 PolarHBondContact O-N 3.43Å
79	L	58.8	Low	57.4	Low	126 Å²	126	89.6 Å²	89.6	66%	0.66	55%	0.552	S	S	*	*	H	α-helix	trans	-68.9	-35.2	175.3	-170.5	60.7	0	0	111.7	S75 G83	S75-L79 WeakPolarHBondContact O-CA 3.44Å; S75-L79 WeakPolarHBondContact O-CB 3.33Å; S75-L79 PolarHBondContact O-N 3.42Å; L79-G83 VanDerWaalsContact O-CA 3.3Å; L79-G83 WeakPolarHBondContact O-CA 3.33Å; L79-G83 PolarHBondContact O-N 2.79Å
80	A	62.7	Low	58	Low	61 Å²	61	93.4 Å²	93.4	50%	0.504	56%	0.56	S	S	.	*	H	α-helix	trans	-67.1	-37.9	171.9	0	0	0	0	111.7	N76 I77 S84	N76-A80 WeakPolarHBondContact O-CA 3.3Å; N76-A80 WeakPolarHBondContact O-CB 2.96Å; N76-A80 PolarHBondContact O-N 2.91Å; I77-A80 PolarHBondContact O-N 3.31Å; A80-S84 WeakPolarHBondContact O-CA 3.43Å; A80-S84 WeakPolarHBondContact O-CB 3.25Å; A80-S84 PolarHBondContact O-N 2.77Å
81	S	61.6	Low	58.4	Low	71 Å²	71	94.5 Å²	94.5	50%	0.497	57%	0.572	S	S	.	*	H	α-helix	trans	-70.6	-48.1	179.8	-163.1	0	0	0	111.5	I77 L78 S84 V85	I77-S81 VanDerWaalsContact O-CB 3.25Å; I77-S81 WeakPolarHBondContact O-CB 3.45Å; I77-S81 PolarHBondContact O-N 2.79Å; L78-S81 PolarHBondContact O-N 2.81Å; S81-S84 PolarHBondContact O-N 3.35Å; S81-V85 WeakPolarHBondContact O-CG2 3.29Å; S81-V85 PolarHBondContact O-N 3.44Å
82	V	64.9	Low	58.4	Low	97 Å²	97	97.5 Å²	97.5	59%	0.588	58%	0.578	S	S	*	*	H	α-helix	trans	-67.4	-40.2	175.7	177.7	0	0	0	111.1	L78 L86	L78-V82 WeakPolarHBondContact O-CB 3.47Å; L78-V82 WeakPolarHBondContact O-CG2 3.43Å; L78-V82 PolarHBondContact O-N 3.43Å; V82-L86 VanDerWaalsContact O-CB 3.29Å; V82-L86 WeakPolarHBondContact O-CB 2.97Å; V82-L86 PolarHBondContact O-N 3Å
83	G	66.4	Low	58.3	Low	38 Å²	38	98.1 Å²	98.1	39%	0.392	58%	0.583	S	S	.	*	H	α-helix	trans	-66.7	-33.4	175.6	0	0	0	0	113.3	L79 G87	L79-G83 VanDerWaalsContact O-CA 3.3Å; L79-G83 WeakPolarHBondContact O-CA 3.33Å; L79-G83 PolarHBondContact O-N 2.79Å; G83-G87 WeakPolarHBondContact O-CA 3.33Å; G83-G87 PolarHBondContact O-N 2.99Å
84	S	62.4	Low	58.7	Low	82 Å²	82	98.6 Å²	98.6	57%	0.573	59%	0.587	S	S	*	*	H	α-helix	trans	-71.6	-45	175.7	-178.8	0	0	0	111.3	A80 S81 G87 A88	A80-S84 WeakPolarHBondContact O-CA 3.43Å; A80-S84 WeakPolarHBondContact O-CB 3.25Å; A80-S84 PolarHBondContact O-N 2.77Å; S81-S84 PolarHBondContact O-N 3.35Å; S84-G87 PolarHBondContact O-N 3.32Å; S84-A88 WeakPolarHBondContact O-CB 3.4Å; S84-A88 PolarHBondContact O-N 2.97Å
85	V	63.8	Low	58.3	Low	101 Å²	101	101 Å²	101	61%	0.612	60%	0.604	S	S	*	*	H	α-helix	trans	-63	-47.3	176.1	169	0	0	0	111	S81 A88 Y89	S81-V85 WeakPolarHBondContact O-CG2 3.29Å; S81-V85 PolarHBondContact O-N 3.44Å; V85-A88 PolarHBondContact O-N 2.79Å; V85-Y89 WeakPolarHBondContact O-CB 3.39Å; V85-Y89 PolarHBondContact O-N 2.98Å
86	L	58	Low	57.7	Low	116 Å²	116	103.9 Å²	103.9	61%	0.607	62%	0.624	S	S	*	*	H	α-helix	trans	-70.5	-37.3	-179.9	-171.3	60.9	0	0	111.9	V82 Y89 L90	V82-L86 VanDerWaalsContact O-CB 3.29Å; V82-L86 WeakPolarHBondContact O-CB 2.97Å; V82-L86 PolarHBondContact O-N 3Å; L86-Y89 PolarHBondContact O-N 2.82Å; L86-L90 WeakPolarHBondContact O-CB 3.28Å; L86-L90 PolarHBondContact O-N 3.47Å
87	G	65.8	Low	57.2	Low	43 Å²	43	107 Å²	107	44%	0.443	64%	0.64	S	S	.	*	H	α-helix	trans	-66.4	-37	175.5	0	0	0	0	112.9	G83 S84 G91	G83-G87 WeakPolarHBondContact O-CA 3.33Å; G83-G87 PolarHBondContact O-N 2.99Å; S84-G87 PolarHBondContact O-N 3.32Å; G87-G91 VanDerWaalsContact O-CA 3.28Å; G87-G91 WeakPolarHBondContact O-CA 3.16Å; G87-G91 PolarHBondContact O-N 2.81Å
88	A	58.8	Low	56.6	Low	68 Å²	68	108 Å²	108	56%	0.562	65%	0.653	S	S	*	*	H	α-helix	trans	-71.9	-32.9	173.2	0	0	0	0	112.3	S84 V85 G91	S84-A88 WeakPolarHBondContact O-CB 3.4Å; S84-A88 PolarHBondContact O-N 2.97Å; V85-A88 PolarHBondContact O-N 2.79Å; A88-G91 VanDerWaalsContact O-O 3.09Å
89	Y	55.8	Low	55.8	Low	209 Å²	209	106.1 Å²	106.1	82%	0.82	66%	0.655	S	S	*	*	H	α-helix	trans	-72.8	-33.4	177.4	-149.5	-96.5	0	0	112.3	V85 L86	V85-Y89 WeakPolarHBondContact O-CB 3.39Å; V85-Y89 PolarHBondContact O-N 2.98Å; L86-Y89 PolarHBondContact O-N 2.82Å
90	L	62.6	Low	55	Low	160 Å²	160	107.6 Å²	107.6	84%	0.838	66%	0.658	S	S	*	*	H	α-helix	trans	-93	-22.7	179.6	-152.6	66.9	0	0	113.1	L86	L86-L90 WeakPolarHBondContact O-CB 3.28Å; L86-L90 PolarHBondContact O-N 3.47Å
91	G	56.1	Low	54	Low	39 Å²	39	110 Å²	110	40%	0.402	67%	0.669	S	S	.	*	S	Bend	trans	-111.2	104.8	-179.3	0	0	0	0	111.6	G87 A88 S93	G87-G91 VanDerWaalsContact O-CA 3.28Å; G87-G91 WeakPolarHBondContact O-CA 3.16Å; G87-G91 PolarHBondContact O-N 2.81Å; A88-G91 VanDerWaalsContact O-O 3.09Å; G91-S93 PolarHBondContact O-N 2.85Å
92	K	53.6	Low	53	Low	208 Å²	208	114.8 Å²	114.8	90%	0.904	68%	0.683	S	S	*	*			trans	-57.9	88.8	174.4	-178.5	121	173	164.9	112.9
93	S	50.8	Low	51.9	Low	107 Å²	107	114.3 Å²	114.3	75%	0.748	69%	0.689	S	S	*	*			trans	46.6	163	154.9	-44.6	0	0	0	120.4	G91	G91-S93 PolarHBondContact O-N 2.85Å
94	P	59.3	Low	50.5	Low	114 Å²	114	121.7 Å²	121.7	74%	0.74	71%	0.714	S	S	*	*			cis	-139.9	179.9	6.1	39	-17.7	0	0	116.7
95	S	41.8	Very low	49	Very low	107 Å²	107	121 Å²	121	75%	0.748	72%	0.719	S	S	*	*			trans	95.3	123.5	150.7	-53.6	0	0	0	120.4
96	S	37.6	Very low	47.7	Very low	113 Å²	113	122.2 Å²	122.2	79%	0.79	72%	0.722	S	S	*	*			trans	81.9	83.4	164	-51.2	0	0	0	117.6
97	L	44.6	Very low	46.6	Very low	172 Å²	172	124.3 Å²	124.3	90%	0.901	73%	0.729	S	S	*	*			trans	-60.3	134.8	145.2	-76.9	156.1	0	0	108.7
98	P	42.9	Very low	45.2	Very low	118 Å²	118	126.4 Å²	126.4	77%	0.766	74%	0.742	S	S	*	*				-125.8	120.5	121.2	8.9	10.7	0	0	110.7
99	A	43.7	Very low	44	Very low	79 Å²	79	129 Å²	129	65%	0.653	75%	0.751	S	S	*	*			trans	-63.9	142.8	139.1	0	0	0	0	106.2
100	E	41.1	Very low	42.8	Very low	156 Å²	156	127 Å²	127	73%	0.729	75%	0.749	S	S	*	*			cis	-157.1	149.7	42.8	-70.6	164.5	74.6	0	108.6	E102	E100-E102 HydrophobicContact CB-CG 4.45Å
101	P	43.3	Very low	41.4	Very low	112 Å²	112	125.7 Å²	125.7	73%	0.727	74%	0.743	S	S	*	*			trans	-100.1	103.1	152.1	31	-19.6	0	0	108.3
102	E	39.8	Very low	40.5	Very low	172 Å²	172	130.2 Å²	130.2	80%	0.804	76%	0.763	S	S	*	*			trans	-63.7	143.6	168.5	-42.7	-163.4	104	0	109.2	E100	E100-E102 HydrophobicContact CB-CG 4.45Å
103	A	41.8	Very low	40.2	Very low	86 Å²	86	125.2 Å²	125.2	71%	0.711	75%	0.751	S	S	*	*			trans	-80.3	169.2	-173.1	0	0	0	0	112.7
104	E	37.5	Very low	39.9	Very low	194 Å²	194	129.6 Å²	129.6	91%	0.907	76%	0.76	S	S	*	*			trans	109.6	137.8	142	-50.2	-127.6	95.2	0	119.7
105	G	30.7	Very low	38.6	Very low	67 Å²	67	127.9 Å²	127.9	69%	0.691	76%	0.763	S	S	*	*			trans	74.4	99.2	146.4	0	0	0	0	117.2
106	N	35.4	Very low	38.6	Very low	126 Å²	126	132 Å²	132	67%	0.674	77%	0.77	S	S	*	*				63.9	144.6	90.1	128.1	-22	0	0	116.4
107	E	36.5	Very low	39.5	Very low	161 Å²	161	132.3 Å²	132.3	75%	0.752	77%	0.77	S	S	*	*			trans	68	103.7	157.7	-64.3	173.4	134.6	0	117.5
108	A	35.2	Very low	39.6	Very low	86 Å²	86	129.5 Å²	129.5	71%	0.711	76%	0.762	S	S	*	*				80.5	120.7	90.4	0	0	0	0	112.3
109	T	34	Very low	39.3	Very low	122 Å²	122	133.5 Å²	133.5	75%	0.748	77%	0.767	S	S	*	*			trans	30	119.8	149.5	-150.4	0	0	0	116.4
110	E	31.3	Very low	40	Very low	168 Å²	168	134.9 Å²	134.9	79%	0.785	77%	0.77	S	S	*	*				174.5	138.4	76.6	-176.1	174.9	111.4	0	109.4
111	N	32.3	Very low	40.2	Very low	133 Å²	133	132.4 Å²	132.4	71%	0.711	77%	0.767	S	S	*	*			trans	-16.7	139.1	155	-68.7	-84.5	0	0	120.1
112	V	37.4	Very low	40.2	Very low	134 Å²	134	134.2 Å²	134.2	81%	0.812	77%	0.77	S	S	*	*			trans	92.6	147.4	132.7	171.6	0	0	0	117.1
113	P	46.5	Very low	39.9	Very low	103 Å²	103	134.4 Å²	134.4	67%	0.669	77%	0.768	S	S	*	*				-125.6	-179	-103.1	24.7	3.4	0	0	113.6
114	Q	44.8	Very low	40.2	Very low	198 Å²	198	133.9 Å²	133.9	93%	0.925	76%	0.759	S	S	*	*			trans	41.3	111.7	147.7	-73.5	-92.5	-53.4	0	118.9
115	G	31.5	Very low	40.6	Very low	78 Å²	78	132.8 Å²	132.8	80%	0.804	75%	0.754	S	S	*	*			trans	-176.6	76.8	163.1	0	0	0	0	115
116	E	42.8	Very low	41.2	Very low	193 Å²	193	136.7 Å²	136.7	90%	0.902	75%	0.752	S	S	*	*			trans	-104.8	126.7	150.1	-84.5	-175.6	76.1	0	107.3
117	P	56.4	Low	41.7	Very low	120 Å²	120	138.9 Å²	138.9	78%	0.779	76%	0.758	S	S	*	*				-152.3	-175.9	91.9	36.3	-13.9	0	0	112.1
118	P	46.7	Very low	42.4	Very low	113 Å²	113	138.6 Å²	138.6	73%	0.734	76%	0.756	S	S	*	*			cis	-148.7	154.1	27.9	40.7	-17.5	0	0	121.1
119	K	37.2	Very low	42.6	Very low	202 Å²	202	146.6 Å²	146.6	88%	0.878	78%	0.779	S	S	*	*			trans	80	145.3	132.5	-84.1	-176.5	177	170.9	124.3
120	P	57.5	Low	43	Very low	109 Å²	109	147.8 Å²	147.8	71%	0.708	78%	0.78	S	S	*	*			trans	-98.4	-172.6	-167.7	45.9	-37.4	0	0	111.7
121	P	46.3	Very low	43.6	Very low	104 Å²	104	146.7 Å²	146.7	68%	0.675	78%	0.78	S	S	*	*				-156.7	-178.9	84.5	32.9	-8.3	0	0	116.8
122	L	41.9	Very low	44.3	Very low	150 Å²	150	147.5 Å²	147.5	79%	0.785	78%	0.784	S	S	*	*			trans	76.1	135.4	153.8	-72.7	149.7	0	0	117
123	K	34.9	Very low	44.7	Very low	175 Å²	175	148.3 Å²	148.3	76%	0.761	78%	0.782	S	S	*	*			cis	-173.2	159.8	8	-158.4	-174	179.2	176.9	107.9
124	S	48.3	Very low	44.6	Very low	75 Å²	75	151.1 Å²	151.1	52%	0.524	79%	0.789	S	S	.	*			trans	75.8	127.2	143.9	-79	0	0	0	121.1
125	E	45.3	Very low	44.5	Very low	172 Å²	172	148 Å²	148	80%	0.804	78%	0.78	S	S	*	*			trans	73.8	133.4	138	-83.1	161.8	72.4	0	117.6
126	K	43.6	Very low	45.5	Very low	149 Å²	149	153 Å²	153	65%	0.648	78%	0.779	S	S	*	*			cis	-153	134	16.1	-163	179.2	-171.2	-154.1	108.3	E128	K126-E128 WeakPolarHBondContact CD-OE2 3.4Å; K126-E128 WeakPolarHBondContact CE-OE2 3.15Å; K126-E128 IonicContact NZ-OE1 2.96Å; K126-E128 PolarHBondContact NZ-OE1 2.63Å; K126-E128 IonicContact NZ-OE2 2.63Å; K126-E128 PolarHBondContact NZ-OE2 2.96Å
127	H	44.8	Very low	45.7	Very low	172 Å²	172	149.9 Å²	149.9	80%	0.796	77%	0.769	S	S	*	*			trans	-83.1	133.1	161.6	-144.8	116.5	0	0	106.5
128	E	51.4	Low	44.8	Very low	155 Å²	155	152.4 Å²	152.4	72%	0.724	77%	0.768	S	S	*	*			trans	-153	90.5	159.6	-107.8	168	159.2	0	107.7	K126	K126-E128 WeakPolarHBondContact CD-OE2 3.4Å; K126-E128 WeakPolarHBondContact CE-OE2 3.15Å; K126-E128 IonicContact NZ-OE1 2.96Å; K126-E128 PolarHBondContact NZ-OE1 2.63Å; K126-E128 IonicContact NZ-OE2 2.63Å; K126-E128 PolarHBondContact NZ-OE2 2.96Å
129	E	39.8	Very low	44.6	Very low	253 Å²	253	156 Å²	156	100%	1.182	77%	0.771	S	S	*	*				-129.5	0	128.9	-167.5	179.7	110	0	106.7

Retrieved 129 of 129 residues in 48.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).