A0A2K6BSB7_MACNE Loading...

BET1-like protein

Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex.

AlphaFold DB , UniProt , Accession A0A2K6BSB7, Species MACNE (Macaca nemestrina, Pig-tailed macaque), Gene BET1L, Length 111 aa.

						>A0A2K6BSB7_MACNE|A0A2K6BSB7|BET1L
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTGLLTGSVKRFSAMARSGRDNRKLLCGMAVGLIVAFFILSYFLSRART
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	59.7	Low	241 Å²	241	130.5 Å²	130.5	100%	1.187	72%	0.719	S	S	*	*				0	58.8	0	-68.2	-164.6	174.1	0	0	110.9
2	A	55.9	Low	61.4	Low	72 Å²	72	123.1 Å²	123.1	60%	0.595	69%	0.688	S	S	*	*			trans	-160.4	60.3	-179.6	0	0	0	0	0	112.9
3	D	50.7	Low	63	Low	149 Å²	149	118.1 Å²	118.1	80%	0.797	66%	0.662	S	S	*	*			trans	-108.8	9.2	170.1	-65.9	-50.6	0	0	0	112.8
4	W	59.1	Low	64.6	Low	202 Å²	202	119.4 Å²	119.4	77%	0.765	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-78.2	-19.5	-179	60.2	-93.6	0	0	0	113.3	R6 A7	W4-R6 VanDerWaalsContact C-N 3.35Å; W4-R6 PolarHBondContact O-N 3.36Å; W4-A7 WeakPolarHBondContact O-CB 3.43Å; W4-A7 PolarHBondContact O-N 3.5Å
5	A	55	Low	66	Low	85 Å²	85	118.1 Å²	118.1	70%	0.702	65%	0.647	S	S	*	*	G	3₁₀ helix	trans	-78.7	-15.5	-179	0	0	0	0	0	113.9	A7	A5-A7 VanDerWaalsContact C-N 3.33Å
6	R	50.6	Low	67.3	Low	235 Å²	235	117.4 Å²	117.4	89%	0.887	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-86.4	-6.3	173	-155.4	174	-155	99.4	5	112.8	W4	W4-R6 VanDerWaalsContact C-N 3.35Å; W4-R6 PolarHBondContact O-N 3.36Å
7	A	54.6	Low	68.5	Low	73 Å²	73	117.1 Å²	117.1	60%	0.603	64%	0.638	S	S	*	*	S	Bend	trans	-92.3	0.4	-165.4	0	0	0	0	0	115.5	W4 A5	W4-A7 WeakPolarHBondContact O-CB 3.43Å; W4-A7 PolarHBondContact O-N 3.5Å; A5-A7 VanDerWaalsContact C-N 3.33Å
8	Q	61	Low	69.7	Low	161 Å²	161	115.3 Å²	115.3	75%	0.752	63%	0.628	S	S	*	*			trans	-131.4	70.9	172.8	-78.3	171	20.2	0	0	109.7	V13	Q8-V13 HydrophobicContact CB-CG2 4.24Å; Q8-V13 HydrophobicContact CG-CG2 4.32Å
9	S	69.4	Low	70.9	Confident	71 Å²	71	116.8 Å²	116.8	50%	0.497	62%	0.623	S	S	.	*			trans	-60.1	129	162.2	175.6	0	0	0	0	107.9	G11 A12 V13	S9-G11 PolarHBondContact O-N 3.42Å; S9-G11 VanDerWaalsContact O-N 3.08Å; S9-A12 WeakPolarHBondContact O-CA 3.49Å; S9-A12 WeakPolarHBondContact O-CB 3.34Å; S9-A12 PolarHBondContact O-N 3.24Å; S9-V13 PolarHBondContact O-N 2.9Å
10	P	72.3	Confident	71.9	Confident	101 Å²	101	116.1 Å²	116.1	66%	0.656	62%	0.616	S	S	*	*	H	α-helix	trans	-48.5	-38.7	177.8	-27.8	33.2	0	0	0	112.8	A12 V13 E14	P10-A12 PolarHBondContact O-N 3.23Å; P10-V13 PolarHBondContact O-N 2.85Å; P10-E14 PolarHBondContact O-N 3.08Å
11	G	78.2	Confident	72.9	Confident	45 Å²	45	115.2 Å²	115.2	46%	0.464	61%	0.611	S	S	.	*	H	α-helix	trans	-66.8	-30.1	176.6	0	0	0	0	0	114.8	S9 E15	S9-G11 PolarHBondContact O-N 3.42Å; S9-G11 VanDerWaalsContact O-N 3.08Å; G11-E15 WeakPolarHBondContact O-CB 3.4Å; G11-E15 PolarHBondContact O-N 3.34Å
12	A	80.3	Confident	75	Confident	42 Å²	42	109.4 Å²	109.4	35%	0.347	58%	0.58	S	S	.	*	H	α-helix	trans	-73	-34.6	174.6	0	0	0	0	0	111.5	S9 P10 I16	S9-A12 WeakPolarHBondContact O-CA 3.49Å; S9-A12 WeakPolarHBondContact O-CB 3.34Å; S9-A12 PolarHBondContact O-N 3.24Å; P10-A12 PolarHBondContact O-N 3.23Å; A12-I16 WeakPolarHBondContact O-CD1 3.38Å; A12-I16 WeakPolarHBondContact O-CG1 3.33Å; A12-I16 PolarHBondContact O-N 3.45Å; A12-I16 VanDerWaalsContact O-N 3.13Å
13	V	83	Confident	76.8	Confident	58 Å²	58	114.8 Å²	114.8	35%	0.352	59%	0.585	S	S	.	*	H	α-helix	trans	-70.5	-41.9	174.5	-172	0	0	0	0	110.4	Q8 S9 P10 E15 I16 L17	Q8-V13 HydrophobicContact CB-CG2 4.24Å; Q8-V13 HydrophobicContact CG-CG2 4.32Å; S9-V13 PolarHBondContact O-N 2.9Å; P10-V13 PolarHBondContact O-N 2.85Å; V13-E15 PolarHBondContact O-N 2.97Å; V13-I16 PolarHBondContact O-N 2.95Å; V13-L17 HydrophobicContact CG1-CD1 4.21Å; V13-L17 WeakPolarHBondContact O-CG 3.35Å; V13-L17 PolarHBondContact O-N 3.49Å
14	E	85.4	Confident	78.8	Confident	136 Å²	136	112.6 Å²	112.6	64%	0.636	57%	0.571	S	S	*	*	H	α-helix	trans	-56	-49.6	172.6	-148.5	99	-175.3	0	0	110.8	P10 I16 L17 D18	P10-E14 PolarHBondContact O-N 3.08Å; E14-I16 VanDerWaalsContact C-N 3.31Å; E14-I16 PolarHBondContact O-N 3.25Å; E14-L17 PolarHBondContact O-N 3Å; E14-D18 VanDerWaalsContact O-CB 3.25Å; E14-D18 WeakPolarHBondContact O-CB 3.18Å; E14-D18 PolarHBondContact O-N 2.85Å
15	E	85.6	Confident	80.4	Confident	101 Å²	101	105.4 Å²	105.4	47%	0.472	56%	0.555	S	S	.	*	H	α-helix	trans	-63.2	-35.4	179.9	-168.7	-173.3	158.1	0	0	112.7	G11 V13 R19	G11-E15 WeakPolarHBondContact O-CB 3.4Å; G11-E15 PolarHBondContact O-N 3.34Å; V13-E15 PolarHBondContact O-N 2.97Å; E15-R19 WeakPolarHBondContact O-CB 3.45Å; E15-R19 WeakPolarHBondContact O-CG 3.47Å; E15-R19 PolarHBondContact O-N 2.76Å; E15-R19 IonicContact OE1-CZ 3.09Å; E15-R19 IonicContact OE1-NH1 2.73Å; E15-R19 PolarHBondContact OE1-NH1 2.87Å; E15-R19 IonicContact OE1-NH2 2.76Å; E15-R19 PolarHBondContact OE1-NH2 3.28Å
16	I	86.6	Confident	82.3	Confident	107 Å²	107	107 Å²	107	55%	0.549	55%	0.551	S	S	.	*	H	α-helix	trans	-67.9	-47.2	175.6	-69.9	164.6	0	0	0	110.5	A12 V13 E14 D18 R19 E20	A12-I16 WeakPolarHBondContact O-CD1 3.38Å; A12-I16 WeakPolarHBondContact O-CG1 3.33Å; A12-I16 PolarHBondContact O-N 3.45Å; A12-I16 VanDerWaalsContact O-N 3.13Å; V13-I16 PolarHBondContact O-N 2.95Å; E14-I16 VanDerWaalsContact C-N 3.31Å; E14-I16 PolarHBondContact O-N 3.25Å; I16-D18 VanDerWaalsContact C-N 3.3Å; I16-D18 PolarHBondContact O-N 3.28Å; I16-R19 PolarHBondContact O-N 3.35Å; I16-E20 PolarHBondContact O-N 3.13Å
17	L	87.9	Confident	84.4	Confident	112 Å²	112	98.1 Å²	98.1	59%	0.586	53%	0.525	S	S	*	.	H	α-helix	trans	-61.3	-40.7	176.7	-73.2	168.3	0	0	0	111.4	V13 E14 E20 N21	V13-L17 HydrophobicContact CG1-CD1 4.21Å; V13-L17 WeakPolarHBondContact O-CG 3.35Å; V13-L17 PolarHBondContact O-N 3.49Å; E14-L17 PolarHBondContact O-N 3Å; L17-E20 WeakPolarHBondContact O-CB 3.42Å; L17-E20 PolarHBondContact O-N 3.02Å; L17-N21 WeakPolarHBondContact O-CB 3.43Å; L17-N21 PolarHBondContact O-N 2.85Å
18	D	90.1	Very high	86.3	Confident	85 Å²	85	99.9 Å²	99.9	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-71.8	-31.3	-178.1	-144.9	41.8	0	0	0	112	E14 I16 K22	E14-D18 VanDerWaalsContact O-CB 3.25Å; E14-D18 WeakPolarHBondContact O-CB 3.18Å; E14-D18 PolarHBondContact O-N 2.85Å; I16-D18 VanDerWaalsContact C-N 3.3Å; I16-D18 PolarHBondContact O-N 3.28Å; D18-K22 VanDerWaalsContact O-CG 3.32Å; D18-K22 WeakPolarHBondContact O-CG 3.25Å; D18-K22 PolarHBondContact O-N 2.75Å; D18-K22 VanDerWaalsContact O-N 3.13Å; D18-K22 IonicContact OD2-NZ 2.89Å; D18-K22 PolarHBondContact OD2-NZ 2.73Å
19	R	91.5	Very high	87.9	Confident	143 Å²	143	94.6 Å²	94.6	54%	0.54	51%	0.508	S	S	.	.	H	α-helix	trans	-68.8	-43.1	168.4	-84.8	-168.1	-179.6	102.9	8.8	112.5	E15 I16 K22 R23	E15-R19 WeakPolarHBondContact O-CB 3.45Å; E15-R19 WeakPolarHBondContact O-CG 3.47Å; E15-R19 PolarHBondContact O-N 2.76Å; E15-R19 IonicContact OE1-CZ 3.09Å; E15-R19 IonicContact OE1-NH1 2.73Å; E15-R19 PolarHBondContact OE1-NH1 2.87Å; E15-R19 IonicContact OE1-NH2 2.76Å; E15-R19 PolarHBondContact OE1-NH2 3.28Å; I16-R19 PolarHBondContact O-N 3.35Å; R19-K22 PolarHBondContact O-N 3.17Å; R19-R23 PolarHBondContact O-N 3.46Å
20	E	90.9	Very high	89.1	Confident	102 Å²	102	94.6 Å²	94.6	48%	0.477	51%	0.508	S	S	.	.	H	α-helix	trans	-59.6	-47.1	175.5	-108.3	-87.7	141	0	0	110.7	I16 L17 K22 R23 M24	I16-E20 PolarHBondContact O-N 3.13Å; L17-E20 WeakPolarHBondContact O-CB 3.42Å; L17-E20 PolarHBondContact O-N 3.02Å; E20-K22 PolarHBondContact O-N 3.47Å; E20-R23 WeakPolarHBondContact O-CB 3.46Å; E20-R23 PolarHBondContact O-N 3.02Å; E20-M24 HydrophobicContact CB-CE 4.29Å; E20-M24 WeakPolarHBondContact O-CG 3.32Å; E20-M24 PolarHBondContact O-N 3.13Å; E20-M24 WeakPolarHBondContact OE2-CE 3.45Å
21	N	93.3	Very high	90.3	Very high	98 Å²	98	95.8 Å²	95.8	52%	0.524	50%	0.503	S	S	.	.	H	α-helix	trans	-63.7	-42.2	179.8	-155.3	-11.1	0	0	0	112	L17 R23 M24 A25	L17-N21 WeakPolarHBondContact O-CB 3.43Å; L17-N21 PolarHBondContact O-N 2.85Å; N21-R23 PolarHBondContact O-N 3.47Å; N21-M24 PolarHBondContact O-N 2.95Å; N21-A25 WeakPolarHBondContact O-CB 3.42Å; N21-A25 PolarHBondContact O-N 2.88Å
22	K	93.1	Very high	91.2	Very high	119 Å²	119	97.6 Å²	97.6	52%	0.517	51%	0.505	S	S	.	.	H	α-helix	trans	-60.6	-43.5	172.3	-74.8	-179.5	-172	75.8	0	112.4	D18 R19 E20 M24 A25 D26	D18-K22 VanDerWaalsContact O-CG 3.32Å; D18-K22 WeakPolarHBondContact O-CG 3.25Å; D18-K22 PolarHBondContact O-N 2.75Å; D18-K22 VanDerWaalsContact O-N 3.13Å; D18-K22 IonicContact OD2-NZ 2.89Å; D18-K22 PolarHBondContact OD2-NZ 2.73Å; R19-K22 PolarHBondContact O-N 3.17Å; E20-K22 PolarHBondContact O-N 3.47Å; K22-M24 VanDerWaalsContact C-N 3.35Å; K22-M24 PolarHBondContact O-N 3.48Å; K22-A25 PolarHBondContact O-N 3.46Å; K22-D26 PolarHBondContact O-N 2.89Å
23	R	93.9	Very high	91.9	Very high	186 Å²	186	100.1 Å²	100.1	70%	0.702	52%	0.516	S	S	*	.	H	α-helix	trans	-62.6	-40.6	175.4	-79.2	-177.7	175.4	-178.7	-0.3	112.6	R19 E20 N21 S27	R19-R23 PolarHBondContact O-N 3.46Å; E20-R23 WeakPolarHBondContact O-CB 3.46Å; E20-R23 PolarHBondContact O-N 3.02Å; N21-R23 PolarHBondContact O-N 3.47Å; R23-S27 WeakPolarHBondContact O-CB 3.33Å; R23-S27 PolarHBondContact O-N 3.27Å
24	M	92.9	Very high	92.5	Very high	102 Å²	102	106.3 Å²	106.3	50%	0.502	53%	0.533	S	S	.	.	H	α-helix	trans	-65.1	-42.2	176.1	-74.9	-171.2	-84.2	0	0	111.4	E20 N21 K22 S27 L28	E20-M24 HydrophobicContact CB-CE 4.29Å; E20-M24 WeakPolarHBondContact O-CG 3.32Å; E20-M24 PolarHBondContact O-N 3.13Å; E20-M24 WeakPolarHBondContact OE2-CE 3.45Å; N21-M24 PolarHBondContact O-N 2.95Å; K22-M24 VanDerWaalsContact C-N 3.35Å; K22-M24 PolarHBondContact O-N 3.48Å; M24-S27 PolarHBondContact O-N 3.09Å; M24-L28 WeakPolarHBondContact O-CB 3.41Å; M24-L28 PolarHBondContact O-N 2.92Å
25	A	93.6	Very high	93	Very high	52 Å²	52	105.5 Å²	105.5	43%	0.43	53%	0.533	S	S	.	.	H	α-helix	trans	-62.6	-45.1	175.8	0	0	0	0	0	112.1	N21 K22 S27 L28 A29	N21-A25 WeakPolarHBondContact O-CB 3.42Å; N21-A25 PolarHBondContact O-N 2.88Å; K22-A25 PolarHBondContact O-N 3.46Å; A25-S27 PolarHBondContact O-N 3.43Å; A25-L28 PolarHBondContact O-N 2.84Å; A25-A29 WeakPolarHBondContact O-CB 3.35Å; A25-A29 PolarHBondContact O-N 3.23Å
26	D	95.1	Very high	93.6	Very high	117 Å²	117	107.7 Å²	107.7	63%	0.626	54%	0.54	S	S	*	.	H	α-helix	trans	-63.3	-42.2	176.2	-76.9	-18.6	0	0	0	111.7	K22 L28 A29 S30	K22-D26 PolarHBondContact O-N 2.89Å; D26-L28 VanDerWaalsContact C-N 3.33Å; D26-L28 PolarHBondContact O-N 3.29Å; D26-A29 PolarHBondContact O-N 2.71Å; D26-S30 WeakPolarHBondContact O-CB 3.47Å; D26-S30 PolarHBondContact O-N 3.43Å
27	S	93.6	Very high	94	Very high	50 Å²	50	105.4 Å²	105.4	35%	0.35	53%	0.534	S	S	.	.	H	α-helix	trans	-60.4	-43.8	174.5	-174.3	0	0	0	0	111.1	R23 M24 A25 S30 K31	R23-S27 WeakPolarHBondContact O-CB 3.33Å; R23-S27 PolarHBondContact O-N 3.27Å; M24-S27 PolarHBondContact O-N 3.09Å; A25-S27 PolarHBondContact O-N 3.43Å; S27-S30 PolarHBondContact O-N 3.49Å; S27-S30 PolarHBondContact O-OG 3Å; S27-K31 WeakPolarHBondContact O-CG 3.36Å; S27-K31 PolarHBondContact O-N 3.39Å; S27-K31 VanDerWaalsContact O-N 3.09Å
28	L	94.9	Very high	94.4	Very high	109 Å²	109	104.1 Å²	104.1	57%	0.571	53%	0.528	S	S	*	.	H	α-helix	trans	-65.6	-45.6	177.1	-174	62.5	0	0	0	111.9	M24 A25 D26 S30 K31 V32	M24-L28 WeakPolarHBondContact O-CB 3.41Å; M24-L28 PolarHBondContact O-N 2.92Å; A25-L28 PolarHBondContact O-N 2.84Å; D26-L28 VanDerWaalsContact C-N 3.33Å; D26-L28 PolarHBondContact O-N 3.29Å; L28-S30 VanDerWaalsContact C-N 3.28Å; L28-S30 PolarHBondContact O-N 2.88Å; L28-K31 PolarHBondContact O-N 3.36Å; L28-K31 VanDerWaalsContact O-N 3.13Å; L28-V32 HydrophobicContact CD1-CG2 4.46Å; L28-V32 HydrophobicContact CG-CG2 4.46Å; L28-V32 WeakPolarHBondContact O-CG2 3.41Å; L28-V32 PolarHBondContact O-N 2.91Å
29	A	94.8	Very high	94.6	Very high	51 Å²	51	103 Å²	103	42%	0.421	53%	0.53	S	S	.	.	H	α-helix	trans	-59.2	-40.7	177.1	0	0	0	0	0	111.6	A25 D26 V32 T33	A25-A29 WeakPolarHBondContact O-CB 3.35Å; A25-A29 PolarHBondContact O-N 3.23Å; D26-A29 PolarHBondContact O-N 2.71Å; A29-V32 PolarHBondContact O-N 3.37Å; A29-T33 WeakPolarHBondContact O-CB 3.45Å; A29-T33 PolarHBondContact O-N 2.91Å; A29-T33 PolarHBondContact O-OG1 3.24Å
30	S	95.2	Very high	94.8	Very high	71 Å²	71	100.2 Å²	100.2	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-62.7	-42.7	175.4	80.1	0	0	0	0	112.2	D26 S27 L28 T33 R34	D26-S30 WeakPolarHBondContact O-CB 3.47Å; D26-S30 PolarHBondContact O-N 3.43Å; S27-S30 PolarHBondContact O-N 3.49Å; S27-S30 PolarHBondContact O-OG 3Å; L28-S30 VanDerWaalsContact C-N 3.28Å; L28-S30 PolarHBondContact O-N 2.88Å; S30-T33 PolarHBondContact O-N 3.13Å; S30-R34 WeakPolarHBondContact O-CB 3.45Å; S30-R34 PolarHBondContact O-N 3.43Å
31	K	96.6	Very high	95.1	Very high	125 Å²	125	98.8 Å²	98.8	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-66.1	-43	177.6	-71.2	171.5	-176.6	178.5	0	111.7	S27 L28 R34 L35	S27-K31 WeakPolarHBondContact O-CG 3.36Å; S27-K31 PolarHBondContact O-N 3.39Å; S27-K31 VanDerWaalsContact O-N 3.09Å; L28-K31 PolarHBondContact O-N 3.36Å; L28-K31 VanDerWaalsContact O-N 3.13Å; K31-R34 PolarHBondContact O-N 2.92Å; K31-L35 WeakPolarHBondContact O-CG 3.38Å; K31-L35 PolarHBondContact O-N 2.82Å
32	V	96.6	Very high	95.1	Very high	83 Å²	83	99.2 Å²	99.2	50%	0.503	52%	0.522	S	S	.	.	H	α-helix	trans	-63.5	-43	177	171.3	0	0	0	0	110.7	L28 A29 R34 L35 K36	L28-V32 HydrophobicContact CD1-CG2 4.46Å; L28-V32 HydrophobicContact CG-CG2 4.46Å; L28-V32 WeakPolarHBondContact O-CG2 3.41Å; L28-V32 PolarHBondContact O-N 2.91Å; A29-V32 PolarHBondContact O-N 3.37Å; V32-R34 VanDerWaalsContact C-N 3.27Å; V32-R34 PolarHBondContact O-N 3.29Å; V32-L35 PolarHBondContact O-N 3.39Å; V32-K36 WeakPolarHBondContact O-CB 3.5Å; V32-K36 PolarHBondContact O-N 3.35Å
33	T	95.6	Very high	95.2	Very high	96 Å²	96	98.6 Å²	98.6	59%	0.589	52%	0.524	S	S	*	.	H	α-helix	trans	-60.8	-40.4	176	-59.4	0	0	0	0	111.1	A29 S30 K36 S37	A29-T33 WeakPolarHBondContact O-CB 3.45Å; A29-T33 PolarHBondContact O-N 2.91Å; A29-T33 PolarHBondContact O-OG1 3.24Å; S30-T33 PolarHBondContact O-N 3.13Å; T33-K36 PolarHBondContact O-N 3.3Å; T33-S37 PolarHBondContact O-N 2.99Å
34	R	95.8	Very high	95.3	Very high	187 Å²	187	97.1 Å²	97.1	71%	0.706	52%	0.519	S	S	*	.	H	α-helix	trans	-67.1	-42.5	177.6	-154.7	170	-170.2	-106.8	0.7	112.3	S30 K31 V32 K36 S37 L38	S30-R34 WeakPolarHBondContact O-CB 3.45Å; S30-R34 PolarHBondContact O-N 3.43Å; K31-R34 PolarHBondContact O-N 2.92Å; V32-R34 VanDerWaalsContact C-N 3.27Å; V32-R34 PolarHBondContact O-N 3.29Å; R34-K36 VanDerWaalsContact C-N 3.33Å; R34-S37 WeakPolarHBondContact O-CB 3.46Å; R34-S37 PolarHBondContact O-N 3.27Å; R34-L38 PolarHBondContact O-N 3.35Å
35	L	96.1	Very high	95.3	Very high	120 Å²	120	96.7 Å²	96.7	63%	0.628	52%	0.518	S	S	*	.	H	α-helix	trans	-62.3	-40.2	173.4	-75.5	170.9	0	0	0	112	K31 V32 S37 L38 A39	K31-L35 WeakPolarHBondContact O-CG 3.38Å; K31-L35 PolarHBondContact O-N 2.82Å; V32-L35 PolarHBondContact O-N 3.39Å; L35-S37 VanDerWaalsContact C-N 3.33Å; L35-S37 PolarHBondContact O-N 2.99Å; L35-L38 PolarHBondContact O-N 3.4Å; L35-A39 WeakPolarHBondContact O-CB 3.46Å; L35-A39 PolarHBondContact O-N 3.48Å
36	K	96.8	Very high	95.2	Very high	146 Å²	146	96.8 Å²	96.8	64%	0.635	52%	0.519	S	S	*	.	H	α-helix	trans	-61.3	-42.2	174.8	-176.4	-179.3	179	-175.8	0	111.7	V32 T33 R34 A39 L40	V32-K36 WeakPolarHBondContact O-CB 3.5Å; V32-K36 PolarHBondContact O-N 3.35Å; T33-K36 PolarHBondContact O-N 3.3Å; R34-K36 VanDerWaalsContact C-N 3.33Å; K36-A39 PolarHBondContact O-N 3.05Å; K36-L40 HydrophobicContact CG-CD1 4.45Å; K36-L40 WeakPolarHBondContact O-CG 3.24Å; K36-L40 PolarHBondContact O-N 2.88Å
37	S	96.1	Very high	95.1	Very high	60 Å²	60	96.6 Å²	96.6	42%	0.42	52%	0.515	S	S	.	.	H	α-helix	trans	-61.1	-48.9	174.7	-165.7	0	0	0	0	111.1	T33 R34 L35 A39 L40 D41	T33-S37 PolarHBondContact O-N 2.99Å; R34-S37 WeakPolarHBondContact O-CB 3.46Å; R34-S37 PolarHBondContact O-N 3.27Å; L35-S37 VanDerWaalsContact C-N 3.33Å; L35-S37 PolarHBondContact O-N 2.99Å; S37-A39 VanDerWaalsContact C-N 3.3Å; S37-A39 PolarHBondContact O-N 2.87Å; S37-L40 PolarHBondContact O-N 3.39Å; S37-L40 VanDerWaalsContact O-N 3.13Å; S37-D41 VanDerWaalsContact O-CG 3.26Å; S37-D41 PolarHBondContact O-N 2.87Å
38	L	95.8	Very high	95	Very high	85 Å²	85	98.5 Å²	98.5	45%	0.445	52%	0.521	S	S	.	.	H	α-helix	trans	-57.4	-42	176.6	-97.9	136.5	0	0	0	112.5	R34 L35 D41 I42	R34-L38 PolarHBondContact O-N 3.35Å; L35-L38 PolarHBondContact O-N 3.4Å; L38-D41 PolarHBondContact O-N 3.34Å; L38-I42 WeakPolarHBondContact O-CD1 3.42Å; L38-I42 VanDerWaalsContact O-CG1 3.24Å; L38-I42 WeakPolarHBondContact O-CG1 3.31Å; L38-I42 PolarHBondContact O-N 2.93Å
39	A	94.9	Very high	94.8	Very high	60 Å²	60	99.2 Å²	99.2	50%	0.496	52%	0.521	S	S	.	.	H	α-helix	trans	-64	-40.8	177.3	0	0	0	0	0	112.1	L35 K36 S37 I42 D43	L35-A39 WeakPolarHBondContact O-CB 3.46Å; L35-A39 PolarHBondContact O-N 3.48Å; K36-A39 PolarHBondContact O-N 3.05Å; S37-A39 VanDerWaalsContact C-N 3.3Å; S37-A39 PolarHBondContact O-N 2.87Å; A39-I42 PolarHBondContact O-N 3.03Å; A39-D43 WeakPolarHBondContact O-CB 3.45Å; A39-D43 PolarHBondContact O-N 3.5Å
40	L	96.1	Very high	94.5	Very high	85 Å²	85	101.2 Å²	101.2	45%	0.445	53%	0.525	S	S	.	.	H	α-helix	trans	-67.1	-37.9	175.1	-74.8	168.8	0	0	0	112.4	K36 S37 D43 R44	K36-L40 HydrophobicContact CG-CD1 4.45Å; K36-L40 WeakPolarHBondContact O-CG 3.24Å; K36-L40 PolarHBondContact O-N 2.88Å; S37-L40 PolarHBondContact O-N 3.39Å; S37-L40 VanDerWaalsContact O-N 3.13Å; L40-D43 PolarHBondContact O-N 2.88Å; L40-R44 WeakPolarHBondContact O-CG 3.46Å; L40-R44 PolarHBondContact O-N 3.41Å; L40-R44 VanDerWaalsContact O-N 3.1Å
41	D	96	Very high	94.1	Very high	73 Å²	73	104.5 Å²	104.5	39%	0.39	53%	0.527	S	S	.	.	H	α-helix	trans	-66.7	-42.4	177.1	-66	-25.3	0	0	0	110.5	S37 L38 D43 R44 D45	S37-D41 VanDerWaalsContact O-CG 3.26Å; S37-D41 PolarHBondContact O-N 2.87Å; L38-D41 PolarHBondContact O-N 3.34Å; D41-D43 PolarHBondContact O-N 3.36Å; D41-R44 PolarHBondContact O-N 3.47Å; D41-D45 WeakPolarHBondContact O-CB 3.45Å; D41-D45 PolarHBondContact O-N 3.44Å
42	I	94.7	Very high	93.6	Very high	106 Å²	106	106.6 Å²	106.6	54%	0.544	53%	0.532	S	S	.	.	H	α-helix	trans	-62.3	-41.6	174.8	-69	164.3	0	0	0	111.7	L38 A39 R44 D45 A46	L38-I42 WeakPolarHBondContact O-CD1 3.42Å; L38-I42 VanDerWaalsContact O-CG1 3.24Å; L38-I42 WeakPolarHBondContact O-CG1 3.31Å; L38-I42 PolarHBondContact O-N 2.93Å; A39-I42 PolarHBondContact O-N 3.03Å; I42-R44 VanDerWaalsContact C-N 3.35Å; I42-D45 PolarHBondContact O-N 3.38Å; I42-A46 VanDerWaalsContact O-CB 3.31Å; I42-A46 WeakPolarHBondContact O-CB 3.42Å; I42-A46 PolarHBondContact O-N 3.13Å
43	D	95	Very high	93.1	Very high	106 Å²	106	106.9 Å²	106.9	57%	0.567	53%	0.531	S	S	*	.	H	α-helix	trans	-61.1	-45	178.6	-169.3	57.6	0	0	0	111.1	A39 L40 D41 A46 E47	A39-D43 WeakPolarHBondContact O-CB 3.45Å; A39-D43 PolarHBondContact O-N 3.5Å; L40-D43 PolarHBondContact O-N 2.88Å; D41-D43 PolarHBondContact O-N 3.36Å; D43-A46 PolarHBondContact O-N 2.87Å; D43-E47 PolarHBondContact O-N 3.18Å
44	R	94.4	Very high	92.7	Very high	155 Å²	155	107.6 Å²	107.6	59%	0.585	53%	0.531	S	S	*	.	H	α-helix	trans	-64.7	-45.9	174.6	-72.3	174.7	178.6	169.1	-1	112.6	L40 D41 I42 A46 E47 D48	L40-R44 WeakPolarHBondContact O-CG 3.46Å; L40-R44 PolarHBondContact O-N 3.41Å; L40-R44 VanDerWaalsContact O-N 3.1Å; D41-R44 PolarHBondContact O-N 3.47Å; I42-R44 VanDerWaalsContact C-N 3.35Å; R44-A46 VanDerWaalsContact C-N 3.26Å; R44-A46 PolarHBondContact O-N 2.89Å; R44-E47 PolarHBondContact O-N 2.87Å; R44-D48 PolarHBondContact O-N 3.1Å
45	D	93.2	Very high	92.1	Very high	93 Å²	93	100.3 Å²	100.3	50%	0.497	51%	0.514	S	S	.	.	H	α-helix	trans	-60.4	-39.5	178	-82.9	-3.3	0	0	0	111	D41 I42 Q49	D41-D45 WeakPolarHBondContact O-CB 3.45Å; D41-D45 PolarHBondContact O-N 3.44Å; I42-D45 PolarHBondContact O-N 3.38Å; D45-Q49 WeakPolarHBondContact O-CB 3.16Å; D45-Q49 WeakPolarHBondContact O-CG 3.21Å; D45-Q49 PolarHBondContact O-N 2.9Å
46	A	92.9	Very high	91.5	Very high	54 Å²	54	98.8 Å²	98.8	45%	0.446	50%	0.504	S	S	.	.	H	α-helix	trans	-65.6	-41.6	176	0	0	0	0	0	111.7	I42 D43 R44 N50	I42-A46 VanDerWaalsContact O-CB 3.31Å; I42-A46 WeakPolarHBondContact O-CB 3.42Å; I42-A46 PolarHBondContact O-N 3.13Å; D43-A46 PolarHBondContact O-N 2.87Å; R44-A46 VanDerWaalsContact C-N 3.26Å; R44-A46 PolarHBondContact O-N 2.89Å; A46-N50 VanDerWaalsContact O-CB 3.32Å; A46-N50 WeakPolarHBondContact O-CB 3.33Å; A46-N50 PolarHBondContact O-N 2.9Å
47	E	92.1	Very high	90.9	Very high	114 Å²	114	97.3 Å²	97.3	53%	0.533	50%	0.503	S	S	.	.	H	α-helix	trans	-66.5	-43.8	177.6	-154.6	-167.7	150	0	0	112	D43 R44 N50 R51	D43-E47 PolarHBondContact O-N 3.18Å; R44-E47 PolarHBondContact O-N 2.87Å; E47-N50 PolarHBondContact O-N 2.89Å; E47-R51 PolarHBondContact O-N 2.87Å; E47-R51 IonicContact OE1-NH2 2.75Å; E47-R51 PolarHBondContact OE1-NH2 2.91Å
48	D	91.9	Very high	90.3	Very high	90 Å²	90	97.7 Å²	97.7	48%	0.481	51%	0.506	S	S	.	.	H	α-helix	trans	-67.6	-40.2	177.1	-84.2	-12.3	0	0	0	111.8	R44 R51 Y52	R44-D48 PolarHBondContact O-N 3.1Å; D48-R51 PolarHBondContact O-N 3.16Å; D48-R51 IonicContact OD1-CZ 3.29Å; D48-R51 IonicContact OD1-NH1 3.9Å; D48-R51 PolarHBondContact OD1-NH1 3.33Å; D48-Y52 WeakPolarHBondContact O-CB 3.32Å; D48-Y52 PolarHBondContact O-N 3.45Å
49	Q	90.3	Very high	89.9	Confident	123 Å²	123	98.8 Å²	98.8	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-63.8	-40.4	172.6	-76.5	175.4	30.9	0	0	111.7	D45 R51 Y52 L53	D45-Q49 WeakPolarHBondContact O-CB 3.16Å; D45-Q49 WeakPolarHBondContact O-CG 3.21Å; D45-Q49 PolarHBondContact O-N 2.9Å; Q49-R51 VanDerWaalsContact C-N 3.31Å; Q49-R51 PolarHBondContact O-N 3Å; Q49-Y52 WeakPolarHBondContact O-CB 3.42Å; Q49-Y52 PolarHBondContact O-N 3.04Å; Q49-Y52 VanDerWaalsContact O-N 3.16Å; Q49-L53 WeakPolarHBondContact O-CG 3.48Å; Q49-L53 PolarHBondContact O-N 3.34Å
50	N	89	Confident	89.5	Confident	94 Å²	94	102.6 Å²	102.6	50%	0.503	52%	0.518	S	S	.	.	H	α-helix	trans	-62.3	-42.3	176.6	-166.5	71.5	0	0	0	111.1	A46 E47 Y52 L53 D54	A46-N50 VanDerWaalsContact O-CB 3.32Å; A46-N50 WeakPolarHBondContact O-CB 3.33Å; A46-N50 PolarHBondContact O-N 2.9Å; E47-N50 PolarHBondContact O-N 2.89Å; N50-Y52 VanDerWaalsContact C-N 3.31Å; N50-Y52 PolarHBondContact O-N 3.34Å; N50-L53 PolarHBondContact O-N 3.49Å; N50-D54 PolarHBondContact O-N 3.49Å
51	R	86.6	Confident	89	Confident	140 Å²	140	102.6 Å²	102.6	53%	0.528	52%	0.522	S	S	.	.	H	α-helix	trans	-63.3	-36.9	173.9	-164.7	179.8	-62	127.4	5.1	112.4	E47 D48 Q49 G55	E47-R51 PolarHBondContact O-N 2.87Å; E47-R51 IonicContact OE1-NH2 2.75Å; E47-R51 PolarHBondContact OE1-NH2 2.91Å; D48-R51 PolarHBondContact O-N 3.16Å; D48-R51 IonicContact OD1-CZ 3.29Å; D48-R51 IonicContact OD1-NH1 3.9Å; D48-R51 PolarHBondContact OD1-NH1 3.33Å; Q49-R51 VanDerWaalsContact C-N 3.31Å; Q49-R51 PolarHBondContact O-N 3Å; R51-G55 PolarHBondContact O-N 3.16Å
52	Y	85.3	Confident	88.6	Confident	168 Å²	168	102.3 Å²	102.3	66%	0.659	53%	0.525	S	S	*	.	H	α-helix	trans	-65.5	-41.7	174	179.9	-103.8	0	0	0	112.1	D48 Q49 N50 G55 M56	D48-Y52 WeakPolarHBondContact O-CB 3.32Å; D48-Y52 PolarHBondContact O-N 3.45Å; Q49-Y52 WeakPolarHBondContact O-CB 3.42Å; Q49-Y52 PolarHBondContact O-N 3.04Å; Q49-Y52 VanDerWaalsContact O-N 3.16Å; N50-Y52 VanDerWaalsContact C-N 3.31Å; N50-Y52 PolarHBondContact O-N 3.34Å; Y52-G55 PolarHBondContact O-N 3.01Å; Y52-M56 PolarHBondContact O-N 3.44Å
53	L	87.6	Confident	88.2	Confident	90 Å²	90	103.3 Å²	103.3	47%	0.471	53%	0.53	S	S	.	.	H	α-helix	trans	-62.6	-40.7	175.8	-69	174.8	0	0	0	111.9	Q49 N50 G55 M56 D57	Q49-L53 WeakPolarHBondContact O-CG 3.48Å; Q49-L53 PolarHBondContact O-N 3.34Å; N50-L53 PolarHBondContact O-N 3.49Å; L53-G55 VanDerWaalsContact C-N 3.31Å; L53-G55 PolarHBondContact O-N 3.36Å; L53-M56 HydrophobicContact CD2-CE 3.35Å; L53-M56 WeakPolarHBondContact O-CB 3.37Å; L53-M56 PolarHBondContact O-N 3.23Å; L53-M56 VanDerWaalsContact O-N 3.16Å; L53-D57 PolarHBondContact O-N 3.43Å
54	D	86.4	Confident	87.9	Confident	110 Å²	110	101.4 Å²	101.4	59%	0.588	52%	0.522	S	S	*	.	H	α-helix	trans	-61.6	-38.7	174.8	-72.4	-22.2	0	0	0	111.9	N50 M56	N50-D54 PolarHBondContact O-N 3.49Å; D54-M56 VanDerWaalsContact C-N 3.34Å
55	G	82.1	Confident	87.5	Confident	34 Å²	34	96.1 Å²	96.1	35%	0.351	52%	0.516	S	S	.	.	H	α-helix	trans	-67.2	-34	174.3	0	0	0	0	0	113.3	R51 Y52 L53 D57 S58 D59	R51-G55 PolarHBondContact O-N 3.16Å; Y52-G55 PolarHBondContact O-N 3.01Å; L53-G55 VanDerWaalsContact C-N 3.31Å; L53-G55 PolarHBondContact O-N 3.36Å; G55-D57 PolarHBondContact O-N 3.29Å; G55-S58 WeakPolarHBondContact O-CB 3.32Å; G55-S58 PolarHBondContact O-N 2.86Å; G55-D59 PolarHBondContact O-N 3.29Å; G55-D59 VanDerWaalsContact O-N 3.16Å
56	M	85.1	Confident	87.4	Confident	88 Å²	88	97.8 Å²	97.8	43%	0.433	52%	0.524	S	S	.	.	H	α-helix	trans	-67.1	-35.1	-178.3	-170.8	174.7	54.5	0	0	113.1	Y52 L53 D54 S58 D59 F60	Y52-M56 PolarHBondContact O-N 3.44Å; L53-M56 HydrophobicContact CD2-CE 3.35Å; L53-M56 WeakPolarHBondContact O-CB 3.37Å; L53-M56 PolarHBondContact O-N 3.23Å; L53-M56 VanDerWaalsContact O-N 3.16Å; D54-M56 VanDerWaalsContact C-N 3.34Å; M56-S58 VanDerWaalsContact C-N 3.33Å; M56-S58 PolarHBondContact O-N 3.2Å; M56-D59 PolarHBondContact O-N 3.02Å; M56-F60 WeakPolarHBondContact O-CB 3.43Å; M56-F60 PolarHBondContact O-N 3.24Å
57	D	83.2	Confident	87.2	Confident	115 Å²	115	100.7 Å²	100.7	62%	0.615	53%	0.531	S	S	*	.	H	α-helix	trans	-63.3	-39.7	175.5	-174.7	57.2	0	0	0	111.9	L53 G55 F60 T61	L53-D57 PolarHBondContact O-N 3.43Å; G55-D57 PolarHBondContact O-N 3.29Å; D57-F60 PolarHBondContact O-N 2.91Å; D57-T61 VanDerWaalsContact O-CB 3.3Å; D57-T61 WeakPolarHBondContact O-CB 3.4Å; D57-T61 PolarHBondContact O-N 3.46Å; D57-T61 PolarHBondContact O-OG1 2.76Å
58	S	84.3	Confident	86.9	Confident	69 Å²	69	99.2 Å²	99.2	48%	0.483	53%	0.53	S	S	.	.	H	α-helix	trans	-63.3	-44.8	174.7	169.9	0	0	0	0	111.9	G55 M56 T61 S62	G55-S58 WeakPolarHBondContact O-CB 3.32Å; G55-S58 PolarHBondContact O-N 2.86Å; M56-S58 VanDerWaalsContact C-N 3.33Å; M56-S58 PolarHBondContact O-N 3.2Å; S58-T61 PolarHBondContact O-N 3.45Å; S58-S62 WeakPolarHBondContact O-CB 3.45Å; S58-S62 PolarHBondContact O-N 3.33Å; S58-S62 PolarHBondContact O-OG 2.8Å
59	D	86.4	Confident	86.6	Confident	107 Å²	107	96.5 Å²	96.5	57%	0.572	52%	0.524	S	S	*	.	H	α-helix	trans	-65.2	-41.9	177.7	-74.2	-12.6	0	0	0	111.4	G55 M56 S62 M63	G55-D59 PolarHBondContact O-N 3.29Å; G55-D59 VanDerWaalsContact O-N 3.16Å; M56-D59 PolarHBondContact O-N 3.02Å; D59-S62 PolarHBondContact O-N 3.48Å; D59-M63 WeakPolarHBondContact O-CG 3.08Å; D59-M63 PolarHBondContact O-N 2.91Å
60	F	86.7	Confident	86.3	Confident	140 Å²	140	94.2 Å²	94.2	61%	0.614	52%	0.521	S	S	*	.	H	α-helix	trans	-66.3	-40.4	178.2	-152.5	-88.1	0	0	0	112.1	M56 D57 M63 T64	M56-F60 WeakPolarHBondContact O-CB 3.43Å; M56-F60 PolarHBondContact O-N 3.24Å; D57-F60 PolarHBondContact O-N 2.91Å; F60-M63 PolarHBondContact O-N 2.89Å; F60-T64 WeakPolarHBondContact O-CB 3.24Å; F60-T64 PolarHBondContact O-N 2.88Å; F60-T64 PolarHBondContact O-OG1 2.92Å
61	T	86.8	Confident	86	Confident	85 Å²	85	94.3 Å²	94.3	52%	0.521	53%	0.525	S	S	.	.	H	α-helix	trans	-62.9	-42.7	173.6	-65.7	0	0	0	0	111.1	D57 S58 T64 G65	D57-T61 VanDerWaalsContact O-CB 3.3Å; D57-T61 WeakPolarHBondContact O-CB 3.4Å; D57-T61 PolarHBondContact O-N 3.46Å; D57-T61 PolarHBondContact O-OG1 2.76Å; S58-T61 PolarHBondContact O-N 3.45Å; T61-T64 PolarHBondContact O-N 3.42Å; T61-G65 PolarHBondContact O-N 2.95Å
62	S	87.1	Confident	85.8	Confident	67 Å²	67	95 Å²	95	47%	0.469	53%	0.532	S	S	.	.	H	α-helix	trans	-63.7	-46.1	177.7	-63.5	0	0	0	0	111.9	S58 D59 T64 G65 L66	S58-S62 WeakPolarHBondContact O-CB 3.45Å; S58-S62 PolarHBondContact O-N 3.33Å; S58-S62 PolarHBondContact O-OG 2.8Å; D59-S62 PolarHBondContact O-N 3.48Å; S62-T64 VanDerWaalsContact C-N 3.34Å; S62-T64 PolarHBondContact O-N 3.16Å; S62-G65 PolarHBondContact O-N 3.32Å; S62-L66 WeakPolarHBondContact O-CG 3.37Å; S62-L66 PolarHBondContact O-N 3.35Å; S62-L66 VanDerWaalsContact O-N 3.08Å
63	M	86.7	Confident	85.7	Confident	128 Å²	128	96.6 Å²	96.6	63%	0.631	54%	0.537	S	S	*	.	H	α-helix	trans	-60.3	-43	173.7	-75	-170.5	158.6	0	0	111.9	D59 F60 G65 L66 L67	D59-M63 WeakPolarHBondContact O-CG 3.08Å; D59-M63 PolarHBondContact O-N 2.91Å; F60-M63 PolarHBondContact O-N 2.89Å; M63-G65 VanDerWaalsContact C-N 3.34Å; M63-G65 PolarHBondContact O-N 3.29Å; M63-L66 PolarHBondContact O-N 2.93Å; M63-L67 WeakPolarHBondContact O-CB 3.3Å; M63-L67 VanDerWaalsContact O-CG 3.32Å; M63-L67 WeakPolarHBondContact O-CG 3.45Å; M63-L67 PolarHBondContact O-N 3.46Å
64	T	87.6	Confident	85.3	Confident	65 Å²	65	99.3 Å²	99.3	40%	0.399	55%	0.545	S	S	.	.	H	α-helix	trans	-62.2	-40.3	177.2	-61.2	0	0	0	0	111.8	F60 T61 S62 T68	F60-T64 WeakPolarHBondContact O-CB 3.24Å; F60-T64 PolarHBondContact O-N 2.88Å; F60-T64 PolarHBondContact O-OG1 2.92Å; T61-T64 PolarHBondContact O-N 3.42Å; S62-T64 VanDerWaalsContact C-N 3.34Å; S62-T64 PolarHBondContact O-N 3.16Å; T64-T68 VanDerWaalsContact O-CB 3.24Å; T64-T68 WeakPolarHBondContact O-CB 3.34Å; T64-T68 PolarHBondContact O-N 2.86Å; T64-T68 PolarHBondContact O-OG1 2.91Å
65	G	86.4	Confident	85	Confident	45 Å²	45	97.1 Å²	97.1	46%	0.464	54%	0.538	S	S	.	.	H	α-helix	trans	-62.8	-45	175.6	0	0	0	0	0	112.9	T61 S62 M63 T68 G69	T61-G65 PolarHBondContact O-N 2.95Å; S62-G65 PolarHBondContact O-N 3.32Å; M63-G65 VanDerWaalsContact C-N 3.34Å; M63-G65 PolarHBondContact O-N 3.29Å; G65-T68 PolarHBondContact O-N 2.89Å; G65-G69 PolarHBondContact O-N 2.89Å
66	L	90.9	Very high	84.8	Confident	128 Å²	128	98.2 Å²	98.2	67%	0.67	54%	0.544	S	S	*	.	H	α-helix	trans	-65	-44.5	177.4	-68.2	175.8	0	0	0	112.3	S62 M63 G69 S70	S62-L66 WeakPolarHBondContact O-CG 3.37Å; S62-L66 PolarHBondContact O-N 3.35Å; S62-L66 VanDerWaalsContact O-N 3.08Å; M63-L66 PolarHBondContact O-N 2.93Å; L66-G69 PolarHBondContact O-N 3.41Å; L66-S70 WeakPolarHBondContact O-CB 3.41Å; L66-S70 PolarHBondContact O-N 3.46Å; L66-S70 PolarHBondContact O-OG 3.37Å
67	L	87.8	Confident	84.3	Confident	114 Å²	114	100 Å²	100	60%	0.597	55%	0.553	S	S	*	*	H	α-helix	trans	-64	-45.1	176.3	-70.9	172.6	0	0	0	110.9	M63 G69 S70 V71	M63-L67 WeakPolarHBondContact O-CB 3.3Å; M63-L67 VanDerWaalsContact O-CG 3.32Å; M63-L67 WeakPolarHBondContact O-CG 3.45Å; M63-L67 PolarHBondContact O-N 3.46Å; L67-G69 VanDerWaalsContact C-N 3.32Å; L67-G69 PolarHBondContact O-N 3.44Å; L67-S70 CarbonylContact O-C 3.6Å; L67-S70 WeakPolarHBondContact O-CB 3.5Å; L67-S70 PolarHBondContact O-N 3.5Å; L67-S70 VanDerWaalsContact O-N 3.08Å; L67-V71 WeakPolarHBondContact O-CG2 3.42Å; L67-V71 PolarHBondContact O-N 2.8Å
68	T	86.8	Confident	83.7	Confident	83 Å²	83	97.1 Å²	97.1	51%	0.509	55%	0.545	S	S	.	.	H	α-helix	trans	-58.3	-43.3	176.1	-62.8	0	0	0	0	111.6	T64 G65 S70 V71 K72	T64-T68 VanDerWaalsContact O-CB 3.24Å; T64-T68 WeakPolarHBondContact O-CB 3.34Å; T64-T68 PolarHBondContact O-N 2.86Å; T64-T68 PolarHBondContact O-OG1 2.91Å; G65-T68 PolarHBondContact O-N 2.89Å; T68-S70 VanDerWaalsContact C-N 3.34Å; T68-S70 PolarHBondContact O-N 2.82Å; T68-V71 PolarHBondContact O-N 3.37Å; T68-K72 WeakPolarHBondContact O-CB 3.41Å; T68-K72 PolarHBondContact O-N 2.93Å
69	G	85.4	Confident	82.9	Confident	34 Å²	34	102.3 Å²	102.3	35%	0.351	55%	0.554	S	S	.	*	H	α-helix	trans	-60.7	-42.1	174.2	0	0	0	0	0	112.9	G65 L66 L67 K72 R73	G65-G69 PolarHBondContact O-N 2.89Å; L66-G69 PolarHBondContact O-N 3.41Å; L67-G69 VanDerWaalsContact C-N 3.32Å; L67-G69 PolarHBondContact O-N 3.44Å; G69-K72 PolarHBondContact O-N 2.87Å; G69-R73 PolarHBondContact O-N 3.48Å
70	S	83.7	Confident	81.8	Confident	75 Å²	75	100.6 Å²	100.6	52%	0.524	55%	0.55	S	S	.	*	H	α-helix	trans	-66.1	-47.1	178	-59.6	0	0	0	0	111.8	L66 L67 T68 K72 R73 F74	L66-S70 WeakPolarHBondContact O-CB 3.41Å; L66-S70 PolarHBondContact O-N 3.46Å; L66-S70 PolarHBondContact O-OG 3.37Å; L67-S70 CarbonylContact O-C 3.6Å; L67-S70 WeakPolarHBondContact O-CB 3.5Å; L67-S70 PolarHBondContact O-N 3.5Å; L67-S70 VanDerWaalsContact O-N 3.08Å; T68-S70 VanDerWaalsContact C-N 3.34Å; T68-S70 PolarHBondContact O-N 2.82Å; S70-K72 VanDerWaalsContact C-N 3.32Å; S70-K72 PolarHBondContact O-N 3.29Å; S70-R73 PolarHBondContact O-N 3.46Å; S70-F74 WeakPolarHBondContact O-CB 3.3Å; S70-F74 PolarHBondContact O-N 2.92Å
71	V	83.5	Confident	80.7	Confident	95 Å²	95	96.1 Å²	96.1	58%	0.576	54%	0.544	S	S	*	.	H	α-helix	trans	-64.4	-38.2	176.7	-170.8	0	0	0	0	110.5	L67 T68 F74 S75	L67-V71 WeakPolarHBondContact O-CG2 3.42Å; L67-V71 PolarHBondContact O-N 2.8Å; T68-V71 PolarHBondContact O-N 3.37Å; V71-F74 PolarHBondContact O-N 2.81Å; V71-S75 WeakPolarHBondContact O-CB 3.17Å; V71-S75 PolarHBondContact O-N 3.37Å
72	K	82.6	Confident	79.5	Confident	156 Å²	156	99.3 Å²	99.3	68%	0.678	55%	0.547	S	S	*	.	H	α-helix	trans	-62.9	-47.5	176.5	-169.9	174.7	-176	178.5	0	111.6	T68 G69 S70 S75 A76	T68-K72 WeakPolarHBondContact O-CB 3.41Å; T68-K72 PolarHBondContact O-N 2.93Å; G69-K72 PolarHBondContact O-N 2.87Å; S70-K72 VanDerWaalsContact C-N 3.32Å; S70-K72 PolarHBondContact O-N 3.29Å; K72-S75 PolarHBondContact O-N 3.38Å; K72-S75 PolarHBondContact O-OG 3.45Å; K72-A76 WeakPolarHBondContact O-CB 3.38Å; K72-A76 PolarHBondContact O-N 3.45Å
73	R	81.9	Confident	78.3	Confident	201 Å²	201	100.3 Å²	100.3	76%	0.758	55%	0.546	S	S	*	.	H	α-helix	trans	-62.2	-43	174.4	-84.6	-178	168.9	152.6	-2.5	112.1	G69 S70 A76 M77	G69-R73 PolarHBondContact O-N 3.48Å; S70-R73 PolarHBondContact O-N 3.46Å; R73-A76 PolarHBondContact O-N 3.08Å; R73-M77 WeakPolarHBondContact O-CB 3.38Å; R73-M77 PolarHBondContact O-N 3.28Å
74	F	81	Confident	77.3	Confident	146 Å²	146	98.9 Å²	98.9	64%	0.64	54%	0.541	S	S	*	.	H	α-helix	trans	-62.7	-44.3	176.1	-174.1	-96.9	0	0	0	111.8	S70 V71 A76 M77 A78	S70-F74 WeakPolarHBondContact O-CB 3.3Å; S70-F74 PolarHBondContact O-N 2.92Å; V71-F74 PolarHBondContact O-N 2.81Å; F74-A76 VanDerWaalsContact C-N 3.35Å; F74-A76 PolarHBondContact O-N 3.47Å; F74-M77 PolarHBondContact O-N 3.08Å; F74-A78 VanDerWaalsContact O-CB 3.3Å; F74-A78 WeakPolarHBondContact O-CB 3.2Å; F74-A78 PolarHBondContact O-N 2.99Å
75	S	79.1	Confident	76.5	Confident	64 Å²	64	105.3 Å²	105.3	45%	0.448	56%	0.558	S	S	.	*	H	α-helix	trans	-63.8	-39.4	176.6	84.5	0	0	0	0	112.1	V71 K72 A78 R79	V71-S75 WeakPolarHBondContact O-CB 3.17Å; V71-S75 PolarHBondContact O-N 3.37Å; K72-S75 PolarHBondContact O-N 3.38Å; K72-S75 PolarHBondContact O-OG 3.45Å; S75-A78 PolarHBondContact O-N 2.96Å; S75-R79 WeakPolarHBondContact O-CB 3.36Å; S75-R79 PolarHBondContact O-N 3.11Å
76	A	77.4	Confident	75.9	Confident	58 Å²	58	109.9 Å²	109.9	48%	0.479	57%	0.565	S	S	.	*	H	α-helix	trans	-65.8	-40.9	177	0	0	0	0	0	111	K72 R73 F74 R79 S80	K72-A76 WeakPolarHBondContact O-CB 3.38Å; K72-A76 PolarHBondContact O-N 3.45Å; R73-A76 PolarHBondContact O-N 3.08Å; F74-A76 VanDerWaalsContact C-N 3.35Å; F74-A76 PolarHBondContact O-N 3.47Å; A76-R79 PolarHBondContact O-N 3.26Å; A76-S80 VanDerWaalsContact O-CB 3.28Å; A76-S80 WeakPolarHBondContact O-CB 3.33Å; A76-S80 PolarHBondContact O-N 3.17Å; A76-S80 PolarHBondContact O-OG 3.37Å
77	M	74.2	Confident	75.3	Confident	125 Å²	125	109.6 Å²	109.6	62%	0.616	56%	0.564	S	S	*	*	H	α-helix	trans	-68.4	-44.1	176.4	-166	-170.6	-40.6	0	0	112.3	R73 F74 R79 S80 G81	R73-M77 WeakPolarHBondContact O-CB 3.38Å; R73-M77 PolarHBondContact O-N 3.28Å; F74-M77 PolarHBondContact O-N 3.08Å; M77-R79 VanDerWaalsContact C-N 3.29Å; M77-R79 PolarHBondContact O-N 3.45Å; M77-S80 PolarHBondContact O-N 3.39Å; M77-S80 PolarHBondContact O-OG 3.42Å; M77-S80 VanDerWaalsContact O-OG 3.08Å; M77-G81 PolarHBondContact O-N 3.32Å; M77-G81 VanDerWaalsContact O-N 3.15Å
78	A	72.6	Confident	74.9	Confident	54 Å²	54	109.4 Å²	109.4	45%	0.446	56%	0.563	S	S	.	*	H	α-helix	trans	-64.9	-33.6	176	0	0	0	0	0	112.1	F74 S75	F74-A78 VanDerWaalsContact O-CB 3.3Å; F74-A78 WeakPolarHBondContact O-CB 3.2Å; F74-A78 PolarHBondContact O-N 2.99Å; S75-A78 PolarHBondContact O-N 2.96Å
79	R	66	Low	74.6	Confident	179 Å²	179	109.3 Å²	109.3	68%	0.675	57%	0.565	S	S	*	*	H	α-helix	trans	-79.7	-38.9	177.8	-158.5	170.8	-169.4	162.5	1.9	112.1	S75 A76 M77 G81 R82 D83	S75-R79 WeakPolarHBondContact O-CB 3.36Å; S75-R79 PolarHBondContact O-N 3.11Å; A76-R79 PolarHBondContact O-N 3.26Å; M77-R79 VanDerWaalsContact C-N 3.29Å; M77-R79 PolarHBondContact O-N 3.45Å; R79-G81 VanDerWaalsContact C-N 3.32Å; R79-G81 PolarHBondContact O-N 3.28Å; R79-R82 WeakPolarHBondContact O-CB 3.31Å; R79-R82 PolarHBondContact O-N 3.05Å; R79-D83 PolarHBondContact O-N 3.15Å
80	S	63.4	Low	74.6	Confident	70 Å²	70	109.9 Å²	109.9	49%	0.49	57%	0.571	S	S	.	*	H	α-helix	trans	-64.7	-34.7	177.2	74.1	0	0	0	0	112.5	A76 M77 R82 D83 N84	A76-S80 VanDerWaalsContact O-CB 3.28Å; A76-S80 WeakPolarHBondContact O-CB 3.33Å; A76-S80 PolarHBondContact O-N 3.17Å; A76-S80 PolarHBondContact O-OG 3.37Å; M77-S80 PolarHBondContact O-N 3.39Å; M77-S80 PolarHBondContact O-OG 3.42Å; M77-S80 VanDerWaalsContact O-OG 3.08Å; S80-R82 PolarHBondContact O-N 3.43Å; S80-D83 PolarHBondContact O-N 3.17Å; S80-N84 PolarHBondContact O-N 3.48Å
81	G	63.3	Low	74.6	Confident	47 Å²	47	113 Å²	113	49%	0.485	58%	0.579	S	S	.	*	H	α-helix	trans	-60.8	-28.3	171.8	0	0	0	0	0	113.7	M77 R79 R85	M77-G81 PolarHBondContact O-N 3.32Å; M77-G81 VanDerWaalsContact O-N 3.15Å; R79-G81 VanDerWaalsContact C-N 3.32Å; R79-G81 PolarHBondContact O-N 3.28Å; G81-R85 PolarHBondContact O-N 3.35Å
82	R	61.9	Low	74.8	Confident	152 Å²	152	110.9 Å²	110.9	57%	0.574	57%	0.571	S	S	*	*	H	α-helix	trans	-79.5	-40.6	179.5	-170.7	177.3	-66.2	119.7	0.1	112.7	R79 S80 R85 K86	R79-R82 WeakPolarHBondContact O-CB 3.31Å; R79-R82 PolarHBondContact O-N 3.05Å; S80-R82 PolarHBondContact O-N 3.43Å; R82-R85 PolarHBondContact O-N 3.47Å; R82-K86 PolarHBondContact O-N 3.34Å
83	D	62.7	Low	75.3	Confident	87 Å²	87	107.4 Å²	107.4	47%	0.465	56%	0.563	S	S	.	*	H	α-helix	trans	-71.3	-36.3	179.3	-75.6	-19.3	0	0	0	111.8	R79 S80 R85 K86 L87	R79-D83 PolarHBondContact O-N 3.15Å; S80-D83 PolarHBondContact O-N 3.17Å; D83-R85 VanDerWaalsContact C-N 3.29Å; D83-R85 PolarHBondContact O-N 2.83Å; D83-K86 PolarHBondContact O-N 3Å; D83-L87 PolarHBondContact O-N 3.4Å
84	N	65.2	Low	75.9	Confident	98 Å²	98	99.7 Å²	99.7	52%	0.524	55%	0.546	S	S	.	.	H	α-helix	trans	-61.9	-38	173.9	-161.6	26.2	0	0	0	112	S80 K86 L87 L88	S80-N84 PolarHBondContact O-N 3.48Å; N84-K86 VanDerWaalsContact C-N 3.34Å; N84-K86 PolarHBondContact O-N 3.14Å; N84-L87 PolarHBondContact O-N 3.08Å; N84-L88 WeakPolarHBondContact O-CB 3.37Å; N84-L88 VanDerWaalsContact O-CG 3.27Å; N84-L88 WeakPolarHBondContact O-CG 3.28Å; N84-L88 PolarHBondContact O-N 3.47Å
85	R	71.1	Confident	76.4	Confident	201 Å²	201	98.7 Å²	98.7	76%	0.758	55%	0.547	S	S	*	.	H	α-helix	trans	-66.5	-34	176.5	-167	171.8	-177.8	-99.1	1.6	112.8	G81 R82 D83 C89	G81-R85 PolarHBondContact O-N 3.35Å; R82-R85 PolarHBondContact O-N 3.47Å; D83-R85 VanDerWaalsContact C-N 3.29Å; D83-R85 PolarHBondContact O-N 2.83Å; R85-C89 WeakPolarHBondContact O-CB 3.22Å; R85-C89 PolarHBondContact O-N 2.91Å; R85-C89 VanDerWaalsContact O-N 3.11Å
86	K	74.1	Confident	77.1	Confident	140 Å²	140	100.3 Å²	100.3	61%	0.609	55%	0.549	S	S	*	.	H	α-helix	trans	-69.2	-43.7	175.1	-72.4	-177.6	176.9	-179.7	0	111.7	R82 D83 N84 C89 G90	R82-K86 PolarHBondContact O-N 3.34Å; D83-K86 PolarHBondContact O-N 3Å; N84-K86 VanDerWaalsContact C-N 3.34Å; N84-K86 PolarHBondContact O-N 3.14Å; K86-C89 PolarHBondContact O-N 3.38Å; K86-G90 PolarHBondContact O-N 3.33Å
87	L	77.5	Confident	78	Confident	123 Å²	123	101.2 Å²	101.2	64%	0.644	55%	0.549	S	S	*	.	H	α-helix	trans	-63.4	-44.7	176.8	-71.9	170.1	0	0	0	111.9	D83 N84 C89 G90 M91	D83-L87 PolarHBondContact O-N 3.4Å; N84-L87 PolarHBondContact O-N 3.08Å; L87-C89 PolarHBondContact O-N 3.08Å; L87-G90 PolarHBondContact O-N 2.97Å; L87-M91 PolarHBondContact O-N 3.08Å
88	L	79.2	Confident	78.9	Confident	110 Å²	110	97.8 Å²	97.8	58%	0.576	54%	0.54	S	S	*	.	H	α-helix	trans	-61.1	-43.7	176.7	-74.3	168.6	0	0	0	112.2	N84 A92	N84-L88 WeakPolarHBondContact O-CB 3.37Å; N84-L88 VanDerWaalsContact O-CG 3.27Å; N84-L88 WeakPolarHBondContact O-CG 3.28Å; N84-L88 PolarHBondContact O-N 3.47Å; L88-A92 WeakPolarHBondContact O-CB 3.32Å; L88-A92 PolarHBondContact O-N 3.43Å; L88-A92 VanDerWaalsContact O-N 3.08Å
89	C	81.3	Confident	79.9	Confident	80 Å²	80	102.2 Å²	102.2	54%	0.541	55%	0.55	S	S	.	.	H	α-helix	trans	-66.1	-41.3	177.6	-162.1	0	0	0	0	111.8	R85 K86 L87 A92 V93	R85-C89 WeakPolarHBondContact O-CB 3.22Å; R85-C89 PolarHBondContact O-N 2.91Å; R85-C89 VanDerWaalsContact O-N 3.11Å; K86-C89 PolarHBondContact O-N 3.38Å; L87-C89 PolarHBondContact O-N 3.08Å; C89-A92 PolarHBondContact O-N 2.95Å; C89-V93 VanDerWaalsContact O-CG2 3.31Å; C89-V93 WeakPolarHBondContact O-CG2 3.5Å; C89-V93 PolarHBondContact O-N 2.99Å; C89-V93 VanDerWaalsContact O-N 3.08Å
90	G	85.7	Confident	81.3	Confident	46 Å²	46	100.3 Å²	100.3	47%	0.474	55%	0.546	S	S	.	.	H	α-helix	trans	-62.2	-44.5	176.4	0	0	0	0	0	113.1	K86 L87 V93 G94	K86-G90 PolarHBondContact O-N 3.33Å; L87-G90 PolarHBondContact O-N 2.97Å; G90-V93 PolarHBondContact O-N 2.96Å; G90-G94 PolarHBondContact O-N 2.78Å
91	M	83.8	Confident	82.7	Confident	141 Å²	141	101.2 Å²	101.2	70%	0.695	55%	0.545	S	S	*	.	H	α-helix	trans	-62.4	-43.3	175.5	-80.7	-71.5	-172.8	0	0	112.3	L87 G94 L95	L87-M91 PolarHBondContact O-N 3.08Å; M91-G94 PolarHBondContact O-N 3.49Å; M91-L95 WeakPolarHBondContact O-CG 3.27Å; M91-L95 PolarHBondContact O-N 3.28Å
92	A	88	Confident	84.1	Confident	51 Å²	51	104.3 Å²	104.3	42%	0.421	55%	0.55	S	S	.	.	H	α-helix	trans	-61.5	-46	178.3	0	0	0	0	0	112.1	L88 C89 L95 I96	L88-A92 WeakPolarHBondContact O-CB 3.32Å; L88-A92 PolarHBondContact O-N 3.43Å; L88-A92 VanDerWaalsContact O-N 3.08Å; C89-A92 PolarHBondContact O-N 2.95Å; A92-L95 PolarHBondContact O-N 2.96Å; A92-I96 VanDerWaalsContact O-CG1 3.32Å; A92-I96 WeakPolarHBondContact O-CG1 3.41Å; A92-I96 PolarHBondContact O-N 3.39Å; A92-I96 VanDerWaalsContact O-N 3.14Å
93	V	92.8	Very high	85.4	Confident	82 Å²	82	99 Å²	99	50%	0.497	54%	0.536	S	S	.	.	H	α-helix	trans	-64	-42.3	176.5	175.8	0	0	0	0	111	C89 G90 L95 I96 V97	C89-V93 VanDerWaalsContact O-CG2 3.31Å; C89-V93 WeakPolarHBondContact O-CG2 3.5Å; C89-V93 PolarHBondContact O-N 2.99Å; C89-V93 VanDerWaalsContact O-N 3.08Å; G90-V93 PolarHBondContact O-N 2.96Å; V93-L95 PolarHBondContact O-N 3.02Å; V93-I96 PolarHBondContact O-N 3.27Å; V93-V97 HydrophobicContact CG1-CG2 4.42Å; V93-V97 WeakPolarHBondContact O-CG2 3.5Å; V93-V97 PolarHBondContact O-N 3.06Å
94	G	93.3	Very high	86.9	Confident	40 Å²	40	101.8 Å²	101.8	41%	0.412	54%	0.541	S	S	.	.	H	α-helix	trans	-59	-43.5	177	0	0	0	0	0	113	G90 M91 V97 A98	G90-G94 PolarHBondContact O-N 2.78Å; M91-G94 PolarHBondContact O-N 3.49Å; G94-V97 PolarHBondContact O-N 2.92Å; G94-A98 VanDerWaalsContact O-CB 3.32Å; G94-A98 WeakPolarHBondContact O-CB 3.5Å; G94-A98 PolarHBondContact O-N 3.47Å
95	L	92.9	Very high	88.1	Confident	125 Å²	125	103.2 Å²	103.2	65%	0.654	54%	0.543	S	S	*	.	H	α-helix	trans	-64.7	-40.1	176.6	-72.9	176.9	0	0	0	112.5	M91 A92 V93 A98 F99	M91-L95 WeakPolarHBondContact O-CG 3.27Å; M91-L95 PolarHBondContact O-N 3.28Å; A92-L95 PolarHBondContact O-N 2.96Å; V93-L95 PolarHBondContact O-N 3.02Å; L95-A98 PolarHBondContact O-N 3.24Å; L95-F99 WeakPolarHBondContact O-CB 3.37Å; L95-F99 PolarHBondContact O-N 3.26Å
96	I	93.9	Very high	88.9	Confident	98 Å²	98	98.9 Å²	98.9	50%	0.503	53%	0.534	S	S	.	.	H	α-helix	trans	-61.9	-49.3	176.1	-67.5	165.7	0	0	0	110	A92 V93 A98 F99 F100	A92-I96 VanDerWaalsContact O-CG1 3.32Å; A92-I96 WeakPolarHBondContact O-CG1 3.41Å; A92-I96 PolarHBondContact O-N 3.39Å; A92-I96 VanDerWaalsContact O-N 3.14Å; V93-I96 PolarHBondContact O-N 3.27Å; I96-A98 PolarHBondContact O-N 3.43Å; I96-F99 WeakPolarHBondContact O-CB 3.41Å; I96-F99 PolarHBondContact O-N 3.45Å; I96-F100 HydrophobicContact CG2-CD2 3.8Å; I96-F100 HydrophobicContact CG2-CE2 3.69Å; I96-F100 VanDerWaalsContact O-CD2 3.22Å; I96-F100 WeakPolarHBondContact O-CD2 3.36Å; I96-F100 PolarHBondContact O-N 2.91Å
97	V	94.9	Very high	89.5	Confident	77 Å²	77	95.8 Å²	95.8	47%	0.467	53%	0.53	S	S	.	.	H	α-helix	trans	-61.7	-44.7	178.8	173.2	0	0	0	0	111.2	V93 G94 F99 F100 I101	V93-V97 HydrophobicContact CG1-CG2 4.42Å; V93-V97 WeakPolarHBondContact O-CG2 3.5Å; V93-V97 PolarHBondContact O-N 3.06Å; G94-V97 PolarHBondContact O-N 2.92Å; V97-F99 VanDerWaalsContact C-N 3.33Å; V97-F99 PolarHBondContact O-N 3.44Å; V97-F100 PolarHBondContact O-N 3.36Å; V97-I101 HydrophobicContact CG1-CD1 3.76Å; V97-I101 HydrophobicContact CG1-CG1 4.39Å; V97-I101 WeakPolarHBondContact O-CG1 3.39Å; V97-I101 PolarHBondContact O-N 2.89Å
98	A	93.5	Very high	89.9	Confident	52 Å²	52	97.8 Å²	97.8	43%	0.43	53%	0.529	S	S	.	.	H	α-helix	trans	-60.3	-42.6	177.2	0	0	0	0	0	111.7	G94 L95 I96 I101 L102	G94-A98 VanDerWaalsContact O-CB 3.32Å; G94-A98 WeakPolarHBondContact O-CB 3.5Å; G94-A98 PolarHBondContact O-N 3.47Å; L95-A98 PolarHBondContact O-N 3.24Å; I96-A98 PolarHBondContact O-N 3.43Å; A98-I101 PolarHBondContact O-N 3.41Å; A98-L102 WeakPolarHBondContact O-CB 3.32Å; A98-L102 PolarHBondContact O-N 2.7Å
99	F	94.2	Very high	89.8	Confident	148 Å²	148	96.6 Å²	96.6	65%	0.649	54%	0.535	S	S	*	.	H	α-helix	trans	-60.8	-44.6	175.7	-177.3	-96.5	0	0	0	111.9	L95 I96 V97 L102 S103	L95-F99 WeakPolarHBondContact O-CB 3.37Å; L95-F99 PolarHBondContact O-N 3.26Å; I96-F99 WeakPolarHBondContact O-CB 3.41Å; I96-F99 PolarHBondContact O-N 3.45Å; V97-F99 VanDerWaalsContact C-N 3.33Å; V97-F99 PolarHBondContact O-N 3.44Å; F99-L102 PolarHBondContact O-N 2.97Å; F99-S103 VanDerWaalsContact O-CB 3.27Å; F99-S103 WeakPolarHBondContact O-CB 3.26Å; F99-S103 PolarHBondContact O-N 3.31Å; F99-S103 PolarHBondContact O-OG 2.84Å
100	F	94	Very high	89.2	Confident	138 Å²	138	104 Å²	104	61%	0.605	55%	0.552	S	S	*	*	H	α-helix	trans	-61.3	-46.8	175.5	-85.8	-73.5	0	0	0	112	I96 V97 L102 S103 Y104	I96-F100 HydrophobicContact CG2-CD2 3.8Å; I96-F100 HydrophobicContact CG2-CE2 3.69Å; I96-F100 VanDerWaalsContact O-CD2 3.22Å; I96-F100 WeakPolarHBondContact O-CD2 3.36Å; I96-F100 PolarHBondContact O-N 2.91Å; V97-F100 PolarHBondContact O-N 3.36Å; F100-L102 PolarHBondContact O-N 3.48Å; F100-S103 WeakPolarHBondContact CA-OG 3.27Å; F100-S103 PolarHBondContact O-N 2.94Å; F100-S103 PolarHBondContact O-OG 2.83Å; F100-Y104 WeakPolarHBondContact O-CB 3.39Å; F100-Y104 PolarHBondContact O-N 3.34Å
101	I	93.4	Very high	87.6	Confident	90 Å²	90	110.1 Å²	110.1	46%	0.462	58%	0.58	S	S	.	*	H	α-helix	trans	-60.6	-47.2	177.5	-67	169.5	0	0	0	110.5	V97 A98 S103 Y104 F105	V97-I101 HydrophobicContact CG1-CD1 3.76Å; V97-I101 HydrophobicContact CG1-CG1 4.39Å; V97-I101 WeakPolarHBondContact O-CG1 3.39Å; V97-I101 PolarHBondContact O-N 2.89Å; A98-I101 PolarHBondContact O-N 3.41Å; I101-S103 PolarHBondContact O-N 2.89Å; I101-Y104 PolarHBondContact O-N 3.34Å; I101-F105 HydrophobicContact CG2-CD2 3.78Å; I101-F105 HydrophobicContact CG2-CE2 3.96Å; I101-F105 WeakPolarHBondContact O-CD2 3.33Å; I101-F105 PolarHBondContact O-N 2.89Å
102	L	92.4	Very high	87.8	Confident	112 Å²	112	108.6 Å²	108.6	59%	0.586	58%	0.575	S	S	*	*	H	α-helix	trans	-63.2	-43.3	-180	-144.1	100.6	0	0	0	111.3	A98 F99 F100 Y104 F105 L106	A98-L102 WeakPolarHBondContact O-CB 3.32Å; A98-L102 PolarHBondContact O-N 2.7Å; F99-L102 PolarHBondContact O-N 2.97Å; F100-L102 PolarHBondContact O-N 3.48Å; L102-Y104 VanDerWaalsContact C-N 3.32Å; L102-Y104 PolarHBondContact O-N 3.46Å; L102-F105 PolarHBondContact O-N 3.5Å; L102-L106 HydrophobicContact CD2-CD1 3.9Å; L102-L106 HydrophobicContact CG-CD1 4.34Å; L102-L106 VanDerWaalsContact O-CB 3.32Å; L102-L106 WeakPolarHBondContact O-CB 3.3Å; L102-L106 WeakPolarHBondContact O-CD1 3.36Å; L102-L106 WeakPolarHBondContact O-CG 3.49Å; L102-L106 PolarHBondContact O-N 3.36Å
103	S	90.4	Very high	87.8	Confident	41 Å²	41	111.6 Å²	111.6	29%	0.287	58%	0.583	S	S	.	*	H	α-helix	trans	-63.5	-37.3	177.1	75	0	0	0	0	112.2	F99 F100 I101 S107	F99-S103 VanDerWaalsContact O-CB 3.27Å; F99-S103 WeakPolarHBondContact O-CB 3.26Å; F99-S103 PolarHBondContact O-N 3.31Å; F99-S103 PolarHBondContact O-OG 2.84Å; F100-S103 WeakPolarHBondContact CA-OG 3.27Å; F100-S103 PolarHBondContact O-N 2.94Å; F100-S103 PolarHBondContact O-OG 2.83Å; I101-S103 PolarHBondContact O-N 2.89Å; S103-S107 VanDerWaalsContact O-CB 3.26Å; S103-S107 WeakPolarHBondContact O-CB 3.27Å; S103-S107 PolarHBondContact O-N 3.39Å; S103-S107 PolarHBondContact O-OG 2.92Å
104	Y	93.3	Very high	87.5	Confident	145 Å²	145	113.3 Å²	113.3	57%	0.569	59%	0.587	S	S	*	*	H	α-helix	trans	-67.5	-46.1	175.5	178.6	-100.5	0	0	0	111.3	F100 I101 L102 S107 R108	F100-Y104 WeakPolarHBondContact O-CB 3.39Å; F100-Y104 PolarHBondContact O-N 3.34Å; I101-Y104 PolarHBondContact O-N 3.34Å; L102-Y104 VanDerWaalsContact C-N 3.32Å; L102-Y104 PolarHBondContact O-N 3.46Å; Y104-S107 PolarHBondContact O-N 3.39Å; Y104-R108 VanDerWaalsContact O-CB 3.27Å; Y104-R108 WeakPolarHBondContact O-CB 3.35Å; Y104-R108 PolarHBondContact O-N 3.46Å
105	F	91.2	Very high	87.2	Confident	128 Å²	128	117.6 Å²	117.6	56%	0.561	60%	0.598	S	S	*	*	H	α-helix	trans	-63.4	-42.5	175.7	-92.9	-81.7	0	0	0	112.4	I101 L102 R108 A109	I101-F105 HydrophobicContact CG2-CD2 3.78Å; I101-F105 HydrophobicContact CG2-CE2 3.96Å; I101-F105 WeakPolarHBondContact O-CD2 3.33Å; I101-F105 PolarHBondContact O-N 2.89Å; L102-F105 PolarHBondContact O-N 3.5Å; F105-R108 PolarHBondContact O-N 3.26Å; F105-A109 VanDerWaalsContact O-CB 3.27Å; F105-A109 WeakPolarHBondContact O-CB 3.32Å; F105-A109 PolarHBondContact O-N 2.85Å
106	L	86.8	Confident	86.8	Confident	110 Å²	110	117.1 Å²	117.1	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-64.7	-42.3	176	-80.3	161.4	0	0	0	112	L102 R108 A109 R110	L102-L106 HydrophobicContact CD2-CD1 3.9Å; L102-L106 HydrophobicContact CG-CD1 4.34Å; L102-L106 VanDerWaalsContact O-CB 3.32Å; L102-L106 WeakPolarHBondContact O-CB 3.3Å; L102-L106 WeakPolarHBondContact O-CD1 3.36Å; L102-L106 WeakPolarHBondContact O-CG 3.49Å; L102-L106 PolarHBondContact O-N 3.36Å; L106-R108 VanDerWaalsContact C-N 3.31Å; L106-R108 PolarHBondContact O-N 3.47Å; L106-A109 PolarHBondContact O-N 3.01Å; L106-R110 VanDerWaalsContact O-CB 3.3Å; L106-R110 WeakPolarHBondContact O-CB 3.27Å; L106-R110 PolarHBondContact O-N 3.34Å
107	S	87.6	Confident	86.4	Confident	74 Å²	74	118.4 Å²	118.4	52%	0.517	60%	0.6	S	S	.	*	H	α-helix	trans	-65.2	-38.6	176.5	-57.9	0	0	0	0	111.1	S103 Y104 R110 T111	S103-S107 VanDerWaalsContact O-CB 3.26Å; S103-S107 WeakPolarHBondContact O-CB 3.27Å; S103-S107 PolarHBondContact O-N 3.39Å; S103-S107 PolarHBondContact O-OG 2.92Å; Y104-S107 PolarHBondContact O-N 3.39Å; S107-R110 PolarHBondContact O-N 2.84Å; S107-T111 PolarHBondContact O-N 3.34Å; S107-T111 PolarHBondContact O-OG1 2.82Å
108	R	85.6	Confident	85.7	Confident	165 Å²	165	121.4 Å²	121.4	62%	0.623	61%	0.61	S	S	*	*	H	α-helix	trans	-72.4	-30.3	176.1	-166	-177.8	179.1	-171.7	1.6	113.3	Y104 F105 L106 T111	Y104-R108 VanDerWaalsContact O-CB 3.27Å; Y104-R108 WeakPolarHBondContact O-CB 3.35Å; Y104-R108 PolarHBondContact O-N 3.46Å; F105-R108 PolarHBondContact O-N 3.26Å; L106-R108 VanDerWaalsContact C-N 3.31Å; L106-R108 PolarHBondContact O-N 3.47Å; R108-T111 VanDerWaalsContact O-OXT 3.13Å
109	A	76.1	Confident	85.2	Confident	86 Å²	86	126.7 Å²	126.7	71%	0.711	62%	0.624	S	S	*	*	H	α-helix	trans	-80.3	-19.2	176.1	0	0	0	0	0	113.1	F105 L106	F105-A109 VanDerWaalsContact O-CB 3.27Å; F105-A109 WeakPolarHBondContact O-CB 3.32Å; F105-A109 PolarHBondContact O-N 2.85Å; L106-A109 PolarHBondContact O-N 3.01Å
110	R	69.9	Low	84.4	Confident	235 Å²	235	124.9 Å²	124.9	89%	0.887	62%	0.621	S	S	*	*			trans	-91.8	-8.7	177.6	-161.4	173	-170.7	161.9	3.6	113.2	L106 S107	L106-R110 VanDerWaalsContact O-CB 3.3Å; L106-R110 WeakPolarHBondContact O-CB 3.27Å; L106-R110 PolarHBondContact O-N 3.34Å; S107-R110 PolarHBondContact O-N 2.84Å
111	T	52.2	Low	83.5	Confident	175 Å²	175	123.7 Å²	123.7	100%	1.074	62%	0.623	S	S	*	*			trans	-102.3	0	172.3	-40.4	0	0	0	0	108.8	S107 R108	S107-T111 PolarHBondContact O-N 3.34Å; S107-T111 PolarHBondContact O-OG1 2.82Å; R108-T111 VanDerWaalsContact O-OXT 3.13Å

Retrieved 111 of 111 residues in 605.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).