A0A2K6BUM6_MACNE Loading...

A-kinase anchor inhibitor 1

AlphaFold DB , UniProt , Accession A0A2K6BUM6, Species MACNE (Macaca nemestrina, Pig-tailed macaque), Gene AKAIN1, Length 69 aa.

						>A0A2K6BUM6_MACNE|A0A2K6BUM6|AKAIN1
MVFAPGEKPGNEPEEVKLQNASKQIVQNAILRAVQQVSQESQRREERISDNQGHIQLGVGELTKKHEKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.7	Low	59.2	Low	221 Å²	221	120.5 Å²	120.5	100%	1.089	69%	0.691	S	S	*	*				0	110.3	0	-148.1	160.7	-177.6	0	0	106
2	V	51.5	Low	61.2	Low	146 Å²	146	120.5 Å²	120.5	89%	0.885	68%	0.68	S	S	*	*			trans	-103.4	111.4	-175.3	-168.8	0	0	0	0	106.2
3	F	56.2	Low	62.7	Low	147 Å²	147	117.8 Å²	117.8	65%	0.645	67%	0.671	S	S	*	*			trans	-76	129.6	174.4	-78.9	-85.8	0	0	0	108.9
4	A	62.1	Low	64.4	Low	55 Å²	55	120.9 Å²	120.9	46%	0.455	68%	0.677	S	S	.	*			trans	-70.3	138.6	177.1	0	0	0	0	0	109.6	G6 E7	A4-G6 VanDerWaalsContact C-N 3.34Å; A4-G6 PolarHBondContact O-N 3.49Å; A4-E7 PolarHBondContact N-OE2 3.41Å; A4-E7 PolarHBondContact O-N 3.4Å
5	P	48.7	Very low	66	Low	142 Å²	142	117.8 Å²	117.8	92%	0.922	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.8	92.8	177.1	27.1	-30.3	0	0	0	109.1
6	G	60.8	Low	67.4	Low	75 Å²	75	113.8 Å²	113.8	77%	0.773	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	151.5	-20.6	-176.7	0	0	0	0	0	114.6	A4 K8	A4-G6 VanDerWaalsContact C-N 3.34Å; A4-G6 PolarHBondContact O-N 3.49Å; G6-K8 PolarHBondContact O-N 2.85Å
7	E	57.8	Low	68.8	Low	114 Å²	114	115.9 Å²	115.9	53%	0.533	64%	0.635	S	S	.	*			trans	-72.3	115.1	170.4	-74.1	176.2	129.8	0	0	108.9	A4 P9	A4-E7 PolarHBondContact N-OE2 3.41Å; A4-E7 PolarHBondContact O-N 3.4Å; E7-P9 WeakPolarHBondContact O-CD 3.33Å
8	K	65.6	Low	70.2	Confident	169 Å²	169	116.4 Å²	116.4	74%	0.735	64%	0.636	S	S	*	*			trans	-66.8	114.8	170.1	-71	179	-177.3	170.6	0	107.1	G6 G10	G6-K8 PolarHBondContact O-N 2.85Å; K8-G10 PolarHBondContact O-N 2.86Å
9	P	64.1	Low	71.4	Confident	114 Å²	114	114.6 Å²	114.6	74%	0.74	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.3	126.8	170.9	25.9	-31.3	0	0	0	107.1	E7	E7-P9 WeakPolarHBondContact O-CD 3.33Å
10	G	63.7	Low	72.6	Confident	13 Å²	13	112.8 Å²	112.8	13%	0.134	61%	0.612	C	S	.	*	T	Hydrogen-bonded Turn	trans	117.6	-4.9	179.7	0	0	0	0	0	117.8	K8 E15 V16	K8-G10 PolarHBondContact O-N 2.86Å; G10-E15 WeakPolarHBondContact CA-OE2 3.37Å; G10-E15 PolarHBondContact N-OE1 3.08Å; G10-E15 PolarHBondContact N-OE2 2.88Å; G10-V16 WeakPolarHBondContact O-CG2 3.48Å
11	N	67.6	Low	73.8	Confident	129 Å²	129	109.5 Å²	109.5	69%	0.69	60%	0.601	S	S	*	*			trans	-102.5	-3.2	-178.8	-110.3	29.7	0	0	0	114.7
12	E	83.3	Confident	75.9	Confident	121 Å²	121	102.1 Å²	102.1	57%	0.565	57%	0.571	S	S	*	*	S	Bend	trans	-67.3	135.4	174.7	-69	-57	105	0	0	110	E14 E15 V16	E12-E14 PolarHBondContact O-N 3.04Å; E12-E15 HydrophobicContact CB-CB 4.31Å; E12-E15 PolarHBondContact O-N 3.37Å; E12-V16 PolarHBondContact O-N 3.4Å; E12-V16 VanDerWaalsContact O-N 3.07Å
13	P	81.1	Confident	78.1	Confident	86 Å²	86	100.9 Å²	100.9	56%	0.558	55%	0.554	S	S	*	*	H	α-helix	trans	-54.8	-30.3	-176.8	-26.4	33	0	0	0	113.9	K17	P13-K17 VanDerWaalsContact O-CG 3.29Å; P13-K17 WeakPolarHBondContact O-CG 3.35Å; P13-K17 PolarHBondContact O-N 3.33Å
14	E	87	Confident	80.1	Confident	161 Å²	161	99.7 Å²	99.7	75%	0.752	55%	0.55	S	S	*	*	H	α-helix	trans	-72	-43.6	176.3	-174.3	174.2	-176.3	0	0	112.3	E12 V16 K17 L18	E12-E14 PolarHBondContact O-N 3.04Å; E14-V16 VanDerWaalsContact C-N 3.34Å; E14-V16 PolarHBondContact O-N 2.93Å; E14-K17 WeakPolarHBondContact O-CB 3.4Å; E14-K17 PolarHBondContact O-N 3.11Å; E14-L18 PolarHBondContact O-N 3.4Å
15	E	87.6	Confident	81.8	Confident	74 Å²	74	102.6 Å²	102.6	35%	0.346	56%	0.557	S	S	.	*	H	α-helix	trans	-66.1	-38.7	179.5	-165.3	174.1	173.9	0	0	111.3	G10 E12 K17 L18 Q19	G10-E15 WeakPolarHBondContact CA-OE2 3.37Å; G10-E15 PolarHBondContact N-OE1 3.08Å; G10-E15 PolarHBondContact N-OE2 2.88Å; E12-E15 HydrophobicContact CB-CB 4.31Å; E12-E15 PolarHBondContact O-N 3.37Å; E15-K17 PolarHBondContact O-N 3.39Å; E15-L18 PolarHBondContact O-N 3.49Å; E15-Q19 VanDerWaalsContact O-CG 3.32Å; E15-Q19 WeakPolarHBondContact O-CG 3.32Å; E15-Q19 PolarHBondContact O-N 3.42Å
16	V	88.6	Confident	84.2	Confident	53 Å²	53	99.6 Å²	99.6	32%	0.321	54%	0.536	S	S	.	.	H	α-helix	trans	-62.7	-41.5	174.4	176.1	0	0	0	0	111.6	G10 E12 E14 Q19 N20	G10-V16 WeakPolarHBondContact O-CG2 3.48Å; E12-V16 PolarHBondContact O-N 3.4Å; E12-V16 VanDerWaalsContact O-N 3.07Å; E14-V16 VanDerWaalsContact C-N 3.34Å; E14-V16 PolarHBondContact O-N 2.93Å; V16-Q19 PolarHBondContact O-N 2.84Å; V16-N20 WeakPolarHBondContact O-CB 3.4Å; V16-N20 VanDerWaalsContact O-CG 3.25Å; V16-N20 PolarHBondContact O-N 2.97Å; V16-N20 PolarHBondContact O-ND2 2.87Å
17	K	92.3	Very high	86	Confident	151 Å²	151	102.2 Å²	102.2	66%	0.657	53%	0.528	S	S	*	.	H	α-helix	trans	-62.2	-44	175.1	-74.5	171	-175.5	177.5	0	111.3	P13 E14 E15 N20 A21	P13-K17 VanDerWaalsContact O-CG 3.29Å; P13-K17 WeakPolarHBondContact O-CG 3.35Å; P13-K17 PolarHBondContact O-N 3.33Å; E14-K17 WeakPolarHBondContact O-CB 3.4Å; E14-K17 PolarHBondContact O-N 3.11Å; E15-K17 PolarHBondContact O-N 3.39Å; K17-N20 PolarHBondContact O-N 3.41Å; K17-A21 WeakPolarHBondContact O-CB 3.44Å; K17-A21 PolarHBondContact O-N 3.48Å
18	L	93.6	Very high	87.9	Confident	125 Å²	125	100.7 Å²	100.7	65%	0.654	52%	0.523	S	S	*	.	H	α-helix	trans	-62.8	-44.1	178.1	-175.9	64	0	0	0	111.5	E14 E15 N20 A21 S22	E14-L18 PolarHBondContact O-N 3.4Å; E15-L18 PolarHBondContact O-N 3.49Å; L18-N20 VanDerWaalsContact C-N 3.34Å; L18-N20 PolarHBondContact O-N 3.34Å; L18-A21 PolarHBondContact O-N 3.46Å; L18-S22 WeakPolarHBondContact O-CB 3.42Å; L18-S22 PolarHBondContact O-N 2.99Å
19	Q	93.3	Very high	89.5	Confident	82 Å²	82	95.3 Å²	95.3	38%	0.383	51%	0.511	S	S	.	.	H	α-helix	trans	-61.8	-41.8	175.8	-72.4	-179	10.3	0	0	112	E15 V16 S22 K23	E15-Q19 VanDerWaalsContact O-CG 3.32Å; E15-Q19 WeakPolarHBondContact O-CG 3.32Å; E15-Q19 PolarHBondContact O-N 3.42Å; V16-Q19 PolarHBondContact O-N 2.84Å; Q19-S22 WeakPolarHBondContact O-CB 3.46Å; Q19-S22 PolarHBondContact O-N 2.93Å; Q19-K23 WeakPolarHBondContact O-CG 3.07Å; Q19-K23 PolarHBondContact O-N 3.25Å
20	N	95.6	Very high	91	Very high	77 Å²	77	94.7 Å²	94.7	41%	0.412	50%	0.5	S	S	.	.	H	α-helix	trans	-64.8	-42.8	176.7	-73.3	-22.6	0	0	0	111.9	V16 K17 L18 K23 Q24	V16-N20 WeakPolarHBondContact O-CB 3.4Å; V16-N20 VanDerWaalsContact O-CG 3.25Å; V16-N20 PolarHBondContact O-N 2.97Å; V16-N20 PolarHBondContact O-ND2 2.87Å; K17-N20 PolarHBondContact O-N 3.41Å; L18-N20 VanDerWaalsContact C-N 3.34Å; L18-N20 PolarHBondContact O-N 3.34Å; N20-K23 PolarHBondContact O-N 3.35Å; N20-Q24 WeakPolarHBondContact O-CG 3.23Å; N20-Q24 PolarHBondContact O-N 3.49Å; N20-Q24 VanDerWaalsContact O-N 3.08Å
21	A	97.1	Very high	92.7	Very high	45 Å²	45	98.5 Å²	98.5	37%	0.372	52%	0.517	S	S	.	.	H	α-helix	trans	-61.8	-44.2	174.4	0	0	0	0	0	111.6	K17 L18 K23 Q24 I25	K17-A21 WeakPolarHBondContact O-CB 3.44Å; K17-A21 PolarHBondContact O-N 3.48Å; L18-A21 PolarHBondContact O-N 3.46Å; A21-K23 PolarHBondContact O-N 3.43Å; A21-Q24 PolarHBondContact O-N 3.18Å; A21-Q24 VanDerWaalsContact O-N 3.16Å; A21-I25 WeakPolarHBondContact O-CG1 3.34Å; A21-I25 PolarHBondContact O-N 3.38Å
22	S	97.3	Very high	94	Very high	66 Å²	66	100.8 Å²	100.8	46%	0.462	52%	0.516	S	S	.	.	H	α-helix	trans	-56.8	-47.9	175.7	-179.5	0	0	0	0	111.9	L18 Q19 Q24 I25 V26	L18-S22 WeakPolarHBondContact O-CB 3.42Å; L18-S22 PolarHBondContact O-N 2.99Å; Q19-S22 WeakPolarHBondContact O-CB 3.46Å; Q19-S22 PolarHBondContact O-N 2.93Å; S22-Q24 VanDerWaalsContact C-N 3.33Å; S22-Q24 PolarHBondContact O-N 2.92Å; S22-I25 PolarHBondContact O-N 2.93Å; S22-V26 WeakPolarHBondContact O-CG2 3.44Å; S22-V26 PolarHBondContact O-N 3.28Å
23	K	97.8	Very high	94.6	Very high	120 Å²	120	97.3 Å²	97.3	52%	0.522	51%	0.507	S	S	.	.	H	α-helix	trans	-57.9	-43.6	175.3	-72.1	172.7	-174.2	173.3	0	112.1	Q19 N20 A21 V26 Q27	Q19-K23 WeakPolarHBondContact O-CG 3.07Å; Q19-K23 PolarHBondContact O-N 3.25Å; N20-K23 PolarHBondContact O-N 3.35Å; A21-K23 PolarHBondContact O-N 3.43Å; K23-V26 PolarHBondContact O-N 3.34Å; K23-Q27 WeakPolarHBondContact O-CG 3.25Å; K23-Q27 PolarHBondContact O-N 3.29Å
24	Q	98.1	Very high	95.4	Very high	121 Å²	121	97.4 Å²	97.4	57%	0.565	51%	0.506	S	S	*	.	H	α-helix	trans	-65.2	-40	178.7	-73.4	-169.4	43.8	0	0	112.6	N20 A21 S22 Q27 N28	N20-Q24 WeakPolarHBondContact O-CG 3.23Å; N20-Q24 PolarHBondContact O-N 3.49Å; N20-Q24 VanDerWaalsContact O-N 3.08Å; A21-Q24 PolarHBondContact O-N 3.18Å; A21-Q24 VanDerWaalsContact O-N 3.16Å; S22-Q24 VanDerWaalsContact C-N 3.33Å; S22-Q24 PolarHBondContact O-N 2.92Å; Q24-Q27 PolarHBondContact O-N 3.13Å; Q24-N28 WeakPolarHBondContact O-CB 3.43Å; Q24-N28 PolarHBondContact O-N 3.19Å; Q24-N28 PolarHBondContact O-ND2 3.42Å
25	I	98.1	Very high	95.6	Very high	117 Å²	117	94.4 Å²	94.4	60%	0.6	49%	0.492	S	S	*	.	H	α-helix	trans	-61.4	-47.6	177.3	-69	163.7	0	0	0	110.1	A21 S22 N28 A29	A21-I25 WeakPolarHBondContact O-CG1 3.34Å; A21-I25 PolarHBondContact O-N 3.38Å; S22-I25 PolarHBondContact O-N 2.93Å; I25-N28 PolarHBondContact O-N 3.26Å; I25-A29 WeakPolarHBondContact O-CB 3.33Å; I25-A29 PolarHBondContact O-N 3.38Å
26	V	98.6	Very high	95.8	Very high	79 Å²	79	96.7 Å²	96.7	48%	0.479	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-47.8	179	173.3	0	0	0	0	111	S22 K23 N28 A29 I30	S22-V26 WeakPolarHBondContact O-CG2 3.44Å; S22-V26 PolarHBondContact O-N 3.28Å; K23-V26 PolarHBondContact O-N 3.34Å; V26-N28 VanDerWaalsContact C-N 3.35Å; V26-N28 PolarHBondContact O-N 3.01Å; V26-A29 PolarHBondContact O-N 3.44Å; V26-I30 HydrophobicContact CG1-CD1 3.82Å; V26-I30 HydrophobicContact CG1-CG1 4.49Å; V26-I30 WeakPolarHBondContact O-CG1 3.34Å; V26-I30 PolarHBondContact O-N 2.9Å
27	Q	98.3	Very high	95.8	Very high	130 Å²	130	98.5 Å²	98.5	61%	0.607	51%	0.514	S	S	*	.	H	α-helix	trans	-60	-44.4	178.2	-73.7	177.6	13.8	0	0	112.1	K23 Q24 A29 I30 L31	K23-Q27 WeakPolarHBondContact O-CG 3.25Å; K23-Q27 PolarHBondContact O-N 3.29Å; Q24-Q27 PolarHBondContact O-N 3.13Å; Q27-A29 PolarHBondContact O-N 3.38Å; Q27-I30 PolarHBondContact O-N 2.91Å; Q27-L31 WeakPolarHBondContact O-CB 3.4Å; Q27-L31 PolarHBondContact O-N 3.36Å
28	N	98.1	Very high	95.4	Very high	82 Å²	82	94.2 Å²	94.2	44%	0.439	50%	0.503	S	S	.	.	H	α-helix	trans	-64.3	-39.4	177.2	-80	-29.7	0	0	0	112.3	Q24 I25 V26 L31 R32	Q24-N28 WeakPolarHBondContact O-CB 3.43Å; Q24-N28 PolarHBondContact O-N 3.19Å; Q24-N28 PolarHBondContact O-ND2 3.42Å; I25-N28 PolarHBondContact O-N 3.26Å; V26-N28 VanDerWaalsContact C-N 3.35Å; V26-N28 PolarHBondContact O-N 3.01Å; N28-L31 PolarHBondContact O-N 3Å; N28-R32 WeakPolarHBondContact O-CB 3.3Å; N28-R32 VanDerWaalsContact O-CG 3.27Å; N28-R32 WeakPolarHBondContact O-CG 3.46Å; N28-R32 PolarHBondContact O-N 3.4Å
29	A	97.7	Very high	94.6	Very high	56 Å²	56	93.2 Å²	93.2	46%	0.463	50%	0.495	S	S	.	.	H	α-helix	trans	-63.1	-44.1	176	0	0	0	0	0	111.5	I25 V26 Q27 R32 A33	I25-A29 WeakPolarHBondContact O-CB 3.33Å; I25-A29 PolarHBondContact O-N 3.38Å; V26-A29 PolarHBondContact O-N 3.44Å; Q27-A29 PolarHBondContact O-N 3.38Å; A29-R32 PolarHBondContact O-N 3.47Å; A29-A33 WeakPolarHBondContact O-CB 3.31Å; A29-A33 PolarHBondContact O-N 3.29Å
30	I	97.6	Very high	93.7	Very high	101 Å²	101	94.9 Å²	94.9	52%	0.518	50%	0.503	S	S	.	.	H	α-helix	trans	-62.3	-47.6	176.2	-67.2	167.4	0	0	0	110.6	V26 Q27 R32 A33 V34	V26-I30 HydrophobicContact CG1-CD1 3.82Å; V26-I30 HydrophobicContact CG1-CG1 4.49Å; V26-I30 WeakPolarHBondContact O-CG1 3.34Å; V26-I30 PolarHBondContact O-N 2.9Å; Q27-I30 PolarHBondContact O-N 2.91Å; I30-R32 VanDerWaalsContact C-N 3.32Å; I30-R32 PolarHBondContact O-N 2.79Å; I30-A33 PolarHBondContact O-N 3.4Å; I30-A33 VanDerWaalsContact O-N 3.16Å; I30-V34 HydrophobicContact CG2-CG2 4.33Å; I30-V34 WeakPolarHBondContact O-CG2 3.24Å; I30-V34 PolarHBondContact O-N 2.91Å
31	L	97.7	Very high	92.6	Very high	93 Å²	93	94.3 Å²	94.3	49%	0.487	51%	0.505	S	S	.	.	H	α-helix	trans	-58.5	-44.9	179.5	-178.6	63.7	0	0	0	111.5	Q27 N28 V34 Q35	Q27-L31 WeakPolarHBondContact O-CB 3.4Å; Q27-L31 PolarHBondContact O-N 3.36Å; N28-L31 PolarHBondContact O-N 3Å; L31-V34 PolarHBondContact O-N 2.88Å; L31-Q35 VanDerWaalsContact O-CG 3.31Å; L31-Q35 WeakPolarHBondContact O-CG 3.38Å; L31-Q35 PolarHBondContact O-N 3.37Å
32	R	96.4	Very high	91.1	Very high	177 Å²	177	97.8 Å²	97.8	67%	0.668	51%	0.514	S	S	*	.	H	α-helix	trans	-62.6	-43	176	-71.9	174.1	-175.7	-169.2	1.7	111.8	N28 A29 I30 Q35 Q36	N28-R32 WeakPolarHBondContact O-CB 3.3Å; N28-R32 VanDerWaalsContact O-CG 3.27Å; N28-R32 WeakPolarHBondContact O-CG 3.46Å; N28-R32 PolarHBondContact O-N 3.4Å; A29-R32 PolarHBondContact O-N 3.47Å; I30-R32 VanDerWaalsContact C-N 3.32Å; I30-R32 PolarHBondContact O-N 2.79Å; R32-Q35 PolarHBondContact O-N 2.9Å; R32-Q36 WeakPolarHBondContact O-CB 3.31Å; R32-Q36 PolarHBondContact O-N 3.48Å
33	A	95.9	Very high	89.8	Confident	47 Å²	47	102.6 Å²	102.6	39%	0.388	52%	0.521	S	S	.	.	H	α-helix	trans	-63	-43.1	178	0	0	0	0	0	111.8	A29 I30 Q36 V37	A29-A33 WeakPolarHBondContact O-CB 3.31Å; A29-A33 PolarHBondContact O-N 3.29Å; I30-A33 PolarHBondContact O-N 3.4Å; I30-A33 VanDerWaalsContact O-N 3.16Å; A33-Q36 PolarHBondContact O-N 3.38Å; A33-V37 VanDerWaalsContact O-CG2 3.3Å; A33-V37 WeakPolarHBondContact O-CG2 3.49Å; A33-V37 PolarHBondContact O-N 3.26Å
34	V	96.1	Very high	88.5	Confident	89 Å²	89	105.8 Å²	105.8	54%	0.539	53%	0.53	S	S	.	.	H	α-helix	trans	-63.3	-43.8	176.3	171.7	0	0	0	0	111.2	I30 L31 Q36 V37 S38	I30-V34 HydrophobicContact CG2-CG2 4.33Å; I30-V34 WeakPolarHBondContact O-CG2 3.24Å; I30-V34 PolarHBondContact O-N 2.91Å; L31-V34 PolarHBondContact O-N 2.88Å; V34-Q36 VanDerWaalsContact C-N 3.34Å; V34-Q36 PolarHBondContact O-N 3.16Å; V34-V37 PolarHBondContact O-N 2.88Å; V34-S38 WeakPolarHBondContact O-CB 3.48Å; V34-S38 PolarHBondContact O-N 2.92Å
35	Q	92.3	Very high	86.8	Confident	97 Å²	97	106.6 Å²	106.6	45%	0.453	53%	0.534	S	S	.	.	H	α-helix	trans	-61.2	-43.3	175.2	-72.9	173.2	3.4	0	0	111.7	L31 R32 S38 Q39	L31-Q35 VanDerWaalsContact O-CG 3.31Å; L31-Q35 WeakPolarHBondContact O-CG 3.38Å; L31-Q35 PolarHBondContact O-N 3.37Å; R32-Q35 PolarHBondContact O-N 2.9Å; Q35-S38 PolarHBondContact O-N 3.34Å; Q35-Q39 WeakPolarHBondContact O-CB 3.33Å; Q35-Q39 VanDerWaalsContact O-CG 3.31Å; Q35-Q39 WeakPolarHBondContact O-CG 3.33Å; Q35-Q39 PolarHBondContact O-N 3.43Å
36	Q	91.1	Very high	85.1	Confident	122 Å²	122	106.7 Å²	106.7	57%	0.57	53%	0.532	S	S	*	.	H	α-helix	trans	-61.8	-47.1	177.1	-178.3	-179.7	-12.1	0	0	111.2	R32 A33 V34 S38 Q39 E40	R32-Q36 WeakPolarHBondContact O-CB 3.31Å; R32-Q36 PolarHBondContact O-N 3.48Å; A33-Q36 PolarHBondContact O-N 3.38Å; V34-Q36 VanDerWaalsContact C-N 3.34Å; V34-Q36 PolarHBondContact O-N 3.16Å; Q36-S38 VanDerWaalsContact C-N 3.35Å; Q36-S38 PolarHBondContact O-N 3.08Å; Q36-Q39 PolarHBondContact O-N 3.34Å; Q36-E40 VanDerWaalsContact O-CB 3.24Å; Q36-E40 WeakPolarHBondContact O-CB 3.3Å; Q36-E40 PolarHBondContact O-N 3.43Å
37	V	88.9	Confident	83.4	Confident	91 Å²	91	112.3 Å²	112.3	55%	0.552	55%	0.545	S	S	*	.	H	α-helix	trans	-62.3	-43.6	178.5	171.7	0	0	0	0	110.8	A33 V34 Q39 E40 S41	A33-V37 VanDerWaalsContact O-CG2 3.3Å; A33-V37 WeakPolarHBondContact O-CG2 3.49Å; A33-V37 PolarHBondContact O-N 3.26Å; V34-V37 PolarHBondContact O-N 2.88Å; V37-Q39 VanDerWaalsContact C-N 3.33Å; V37-Q39 PolarHBondContact O-N 3.49Å; V37-E40 PolarHBondContact O-N 2.91Å; V37-S41 PolarHBondContact O-N 2.99Å; V37-S41 PolarHBondContact O-OG 2.97Å
38	S	84.5	Confident	81.7	Confident	62 Å²	62	110.9 Å²	110.9	43%	0.434	54%	0.54	S	S	.	.	H	α-helix	trans	-60.7	-41.7	176.6	-174.5	0	0	0	0	112.3	V34 Q35 Q36 Q42	V34-S38 WeakPolarHBondContact O-CB 3.48Å; V34-S38 PolarHBondContact O-N 2.92Å; Q35-S38 PolarHBondContact O-N 3.34Å; Q36-S38 VanDerWaalsContact C-N 3.35Å; Q36-S38 PolarHBondContact O-N 3.08Å; S38-Q42 WeakPolarHBondContact O-CG 3.33Å; S38-Q42 PolarHBondContact O-N 3.36Å
39	Q	77.1	Confident	79.9	Confident	103 Å²	103	110 Å²	110	48%	0.481	54%	0.54	S	S	.	.	H	α-helix	trans	-71.9	-36.1	177.3	-71.3	176.5	27	0	0	112.1	Q35 Q36 V37 Q42 R43	Q35-Q39 WeakPolarHBondContact O-CB 3.33Å; Q35-Q39 VanDerWaalsContact O-CG 3.31Å; Q35-Q39 WeakPolarHBondContact O-CG 3.33Å; Q35-Q39 PolarHBondContact O-N 3.43Å; Q36-Q39 PolarHBondContact O-N 3.34Å; V37-Q39 VanDerWaalsContact C-N 3.33Å; V37-Q39 PolarHBondContact O-N 3.49Å; Q39-Q42 PolarHBondContact O-N 3.44Å; Q39-R43 WeakPolarHBondContact O-CB 3.27Å; Q39-R43 WeakPolarHBondContact O-CG 3.48Å; Q39-R43 PolarHBondContact O-N 3.46Å
40	E	72.5	Confident	78.2	Confident	117 Å²	117	112.3 Å²	112.3	55%	0.547	55%	0.545	S	S	.	.	H	α-helix	trans	-69.4	-38.9	179.4	-174.7	162.4	-176.5	0	0	111.6	Q36 V37 R43 R44	Q36-E40 VanDerWaalsContact O-CB 3.24Å; Q36-E40 WeakPolarHBondContact O-CB 3.3Å; Q36-E40 PolarHBondContact O-N 3.43Å; V37-E40 PolarHBondContact O-N 2.91Å; E40-R43 PolarHBondContact O-N 2.97Å; E40-R44 VanDerWaalsContact O-CB 3.25Å; E40-R44 WeakPolarHBondContact O-CB 3.39Å; E40-R44 PolarHBondContact O-N 3.24Å
41	S	73.1	Confident	76.3	Confident	65 Å²	65	112.1 Å²	112.1	46%	0.455	55%	0.545	S	S	.	.	H	α-helix	trans	-56.8	-49	169.9	-68.4	0	0	0	0	111.6	V37 R44 E45	V37-S41 PolarHBondContact O-N 2.99Å; V37-S41 PolarHBondContact O-OG 2.97Å; S41-R44 PolarHBondContact O-N 2.93Å; S41-E45 PolarHBondContact O-N 3.16Å; S41-E45 VanDerWaalsContact O-N 3.13Å
42	Q	66.6	Low	74.4	Confident	119 Å²	119	113.9 Å²	113.9	56%	0.556	55%	0.55	S	S	*	*	H	α-helix	trans	-63.3	-47.8	178.5	-70.8	172.8	7.7	0	0	112.2	S38 Q39 R44 E45 E46	S38-Q42 WeakPolarHBondContact O-CG 3.33Å; S38-Q42 PolarHBondContact O-N 3.36Å; Q39-Q42 PolarHBondContact O-N 3.44Å; Q42-R44 VanDerWaalsContact C-N 3.29Å; Q42-R44 PolarHBondContact O-N 3.32Å; Q42-E45 PolarHBondContact O-N 3.3Å; Q42-E46 WeakPolarHBondContact O-CB 3.5Å; Q42-E46 PolarHBondContact O-N 2.96Å
43	R	69.8	Low	72.4	Confident	166 Å²	166	107.3 Å²	107.3	63%	0.626	54%	0.538	S	S	*	.	H	α-helix	trans	-63.4	-34.7	179.2	-75.1	-172.9	-178.2	-145	1.7	112.4	Q39 E40 R47	Q39-R43 WeakPolarHBondContact O-CB 3.27Å; Q39-R43 WeakPolarHBondContact O-CG 3.48Å; Q39-R43 PolarHBondContact O-N 3.46Å; E40-R43 PolarHBondContact O-N 2.97Å; R43-R47 WeakPolarHBondContact O-CB 3.46Å; R43-R47 WeakPolarHBondContact O-CG 3.44Å; R43-R47 PolarHBondContact O-N 3.37Å
44	R	69.2	Low	70.5	Confident	188 Å²	188	112 Å²	112	71%	0.709	55%	0.552	S	S	*	*	H	α-helix	trans	-69.2	-40.5	178.3	-165.3	178.5	-156.1	-150.6	5.2	111.3	E40 S41 Q42 I48	E40-R44 VanDerWaalsContact O-CB 3.25Å; E40-R44 WeakPolarHBondContact O-CB 3.39Å; E40-R44 PolarHBondContact O-N 3.24Å; S41-R44 PolarHBondContact O-N 2.93Å; Q42-R44 VanDerWaalsContact C-N 3.29Å; Q42-R44 PolarHBondContact O-N 3.32Å; R44-I48 HydrophobicContact CG-CD1 4.38Å; R44-I48 WeakPolarHBondContact O-CD1 3.37Å; R44-I48 VanDerWaalsContact O-CG1 3.23Å; R44-I48 WeakPolarHBondContact O-CG1 3.49Å; R44-I48 PolarHBondContact O-N 2.92Å
45	E	62.7	Low	68.7	Low	138 Å²	138	112.5 Å²	112.5	65%	0.645	55%	0.55	S	S	*	*	H	α-helix	trans	-64.6	-46.2	173.3	-79.6	169.4	-173.7	0	0	111.7	S41 Q42 R47 I48 S49	S41-E45 PolarHBondContact O-N 3.16Å; S41-E45 VanDerWaalsContact O-N 3.13Å; Q42-E45 PolarHBondContact O-N 3.3Å; E45-R47 PolarHBondContact O-N 3.23Å; E45-I48 PolarHBondContact O-N 3.41Å; E45-I48 VanDerWaalsContact O-N 3.08Å; E45-S49 PolarHBondContact O-N 3.44Å; E45-S49 PolarHBondContact O-OG 3.32Å
46	E	63.4	Low	67	Low	118 Å²	118	114.4 Å²	114.4	55%	0.551	56%	0.559	S	S	*	*	H	α-helix	trans	-61.4	-42.5	178.6	-163.9	176.2	-161.4	0	0	111.9	Q42 I48 S49 D50	Q42-E46 WeakPolarHBondContact O-CB 3.5Å; Q42-E46 PolarHBondContact O-N 2.96Å; E46-I48 VanDerWaalsContact C-N 3.29Å; E46-I48 PolarHBondContact O-N 3.39Å; E46-S49 WeakPolarHBondContact CA-OG 3.42Å; E46-S49 PolarHBondContact O-N 3.07Å; E46-S49 PolarHBondContact O-OG 3.47Å; E46-D50 WeakPolarHBondContact O-CB 3.29Å; E46-D50 PolarHBondContact O-N 3.24Å
47	R	62.2	Low	65.2	Low	198 Å²	198	116.1 Å²	116.1	75%	0.747	57%	0.571	S	S	*	*	H	α-helix	trans	-62.6	-33.3	173.8	-69.1	-114.9	-160.8	163.2	7.3	113.3	R43 E45 N51	R43-R47 WeakPolarHBondContact O-CB 3.46Å; R43-R47 WeakPolarHBondContact O-CG 3.44Å; R43-R47 PolarHBondContact O-N 3.37Å; E45-R47 PolarHBondContact O-N 3.23Å; R47-N51 WeakPolarHBondContact O-CB 3.44Å; R47-N51 PolarHBondContact O-N 2.86Å
48	I	62.3	Low	63.3	Low	100 Å²	100	114.9 Å²	114.9	51%	0.513	58%	0.577	S	S	.	*	H	α-helix	trans	-74.6	-43.4	177	-68.6	166.6	0	0	0	109.7	R44 E45 E46 N51 Q52	R44-I48 HydrophobicContact CG-CD1 4.38Å; R44-I48 WeakPolarHBondContact O-CD1 3.37Å; R44-I48 VanDerWaalsContact O-CG1 3.23Å; R44-I48 WeakPolarHBondContact O-CG1 3.49Å; R44-I48 PolarHBondContact O-N 2.92Å; E45-I48 PolarHBondContact O-N 3.41Å; E45-I48 VanDerWaalsContact O-N 3.08Å; E46-I48 VanDerWaalsContact C-N 3.29Å; E46-I48 PolarHBondContact O-N 3.39Å; I48-N51 PolarHBondContact O-N 2.95Å; I48-Q52 WeakPolarHBondContact O-CB 3.33Å; I48-Q52 PolarHBondContact O-N 3.32Å
49	S	60.4	Low	61.7	Low	62 Å²	62	117.3 Å²	117.3	43%	0.434	59%	0.589	S	S	.	*	H	α-helix	trans	-64.6	-39.9	176.9	57.8	0	0	0	0	112.6	E45 E46 Q52 G53	E45-S49 PolarHBondContact O-N 3.44Å; E45-S49 PolarHBondContact O-OG 3.32Å; E46-S49 WeakPolarHBondContact CA-OG 3.42Å; E46-S49 PolarHBondContact O-N 3.07Å; E46-S49 PolarHBondContact O-OG 3.47Å; S49-Q52 PolarHBondContact O-N 3.46Å; S49-G53 PolarHBondContact O-N 3.03Å
50	D	61.5	Low	60.7	Low	106 Å²	106	115.4 Å²	115.4	57%	0.567	60%	0.597	S	S	*	*	H	α-helix	trans	-65.4	-41.3	177.6	-73.3	-13.3	0	0	0	111.5	E46 G53 H54	E46-D50 WeakPolarHBondContact O-CB 3.29Å; E46-D50 PolarHBondContact O-N 3.24Å; D50-G53 PolarHBondContact O-N 3.07Å; D50-H54 WeakPolarHBondContact O-CB 3.47Å; D50-H54 PolarHBondContact O-N 2.89Å
51	N	58.6	Low	59.9	Low	97 Å²	97	117.8 Å²	117.8	52%	0.519	61%	0.608	S	S	.	*	H	α-helix	trans	-69.5	-39	177.7	-154.1	-37.7	0	0	0	111.2	R47 I48 H54 I55	R47-N51 WeakPolarHBondContact O-CB 3.44Å; R47-N51 PolarHBondContact O-N 2.86Å; I48-N51 PolarHBondContact O-N 2.95Å; N51-H54 PolarHBondContact O-N 3.26Å; N51-I55 WeakPolarHBondContact O-CB 3.19Å; N51-I55 VanDerWaalsContact O-CG1 3.3Å; N51-I55 WeakPolarHBondContact O-CG1 3.32Å; N51-I55 PolarHBondContact O-N 3Å; N51-I55 WeakPolarHBondContact OD1-CD1 3.38Å
52	Q	58.1	Low	59.1	Low	129 Å²	129	123 Å²	123	60%	0.603	63%	0.63	S	S	*	*	H	α-helix	trans	-69.6	-35.7	176.3	-163.2	174.2	-14.7	0	0	112.4	I48 S49 Q56	I48-Q52 WeakPolarHBondContact O-CB 3.33Å; I48-Q52 PolarHBondContact O-N 3.32Å; S49-Q52 PolarHBondContact O-N 3.46Å; Q52-Q56 PolarHBondContact O-N 2.96Å; Q52-Q56 VanDerWaalsContact O-N 3.11Å
53	G	54.9	Low	58.6	Low	40 Å²	40	123.6 Å²	123.6	41%	0.412	64%	0.642	S	S	.	*	H	α-helix	trans	-65.5	-36.7	172.4	0	0	0	0	0	113.1	S49 D50	S49-G53 PolarHBondContact O-N 3.03Å; D50-G53 PolarHBondContact O-N 3.07Å
54	H	55.7	Low	57.9	Low	146 Å²	146	124.8 Å²	124.8	68%	0.676	65%	0.652	S	S	*	*	H	α-helix	trans	-75.2	-38.4	176.4	-173	-95.1	0	0	0	112.9	D50 N51 Q56 L57	D50-H54 WeakPolarHBondContact O-CB 3.47Å; D50-H54 PolarHBondContact O-N 2.89Å; N51-H54 PolarHBondContact O-N 3.26Å; H54-Q56 VanDerWaalsContact C-N 3.34Å; H54-Q56 PolarHBondContact O-N 2.84Å; H54-L57 PolarHBondContact O-N 3.3Å
55	I	57.3	Low	57.5	Low	99 Å²	99	125.1 Å²	125.1	51%	0.508	66%	0.659	S	S	.	*	H	α-helix	trans	-69.9	-30.5	177.9	-68.2	-177.3	0	0	0	111.6	N51 L57 G58 V59	N51-I55 WeakPolarHBondContact O-CB 3.19Å; N51-I55 VanDerWaalsContact O-CG1 3.3Å; N51-I55 WeakPolarHBondContact O-CG1 3.32Å; N51-I55 PolarHBondContact O-N 3Å; N51-I55 WeakPolarHBondContact OD1-CD1 3.38Å; I55-L57 VanDerWaalsContact C-N 3.35Å; I55-L57 PolarHBondContact O-N 3.39Å; I55-G58 PolarHBondContact O-N 3.22Å; I55-V59 WeakPolarHBondContact O-CG2 3.19Å
56	Q	56.3	Low	56.9	Low	137 Å²	137	127 Å²	127	64%	0.64	67%	0.667	S	S	*	*	H	α-helix	trans	-72.4	-26.1	177.2	-151.8	74.6	87.9	0	0	113.3	Q52 H54 G58	Q52-Q56 PolarHBondContact O-N 2.96Å; Q52-Q56 VanDerWaalsContact O-N 3.11Å; H54-Q56 VanDerWaalsContact C-N 3.34Å; H54-Q56 PolarHBondContact O-N 2.84Å; Q56-G58 VanDerWaalsContact C-N 3.32Å; Q56-G58 PolarHBondContact O-N 3.48Å
57	L	53.3	Low	56.5	Low	158 Å²	158	129.3 Å²	129.3	83%	0.827	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.7	-10.5	177.1	-70.8	172.1	0	0	0	114	H54 I55	H54-L57 PolarHBondContact O-N 3.3Å; I55-L57 VanDerWaalsContact C-N 3.35Å; I55-L57 PolarHBondContact O-N 3.39Å
58	G	49.5	Very low	56.1	Low	65 Å²	65	128.5 Å²	128.5	67%	0.67	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.9	-8.9	-179.8	0	0	0	0	0	116	I55 Q56	I55-G58 PolarHBondContact O-N 3.22Å; Q56-G58 VanDerWaalsContact C-N 3.32Å; Q56-G58 PolarHBondContact O-N 3.48Å
59	V	51.1	Low	55.8	Low	112 Å²	112	135.4 Å²	135.4	68%	0.679	71%	0.706	S	S	*	*	S	Bend	trans	-94.5	6.2	-174.8	177.9	0	0	0	0	112.4	I55	I55-V59 WeakPolarHBondContact O-CG2 3.19Å
60	G	55.3	Low	55.6	Low	64 Å²	64	139.1 Å²	139.1	66%	0.66	72%	0.72	S	S	*	*	S	Bend	trans	-109.4	23.2	-169.4	0	0	0	0	0	117.3
61	E	56.4	Low	55.3	Low	166 Å²	166	140.8 Å²	140.8	78%	0.776	73%	0.728	S	S	*	*			trans	-156.3	44.5	175.1	-128.4	-175.1	122.6	0	0	117.3
62	L	56	Low	55.1	Low	176 Å²	176	143.3 Å²	143.3	92%	0.921	74%	0.739	S	S	*	*			trans	-122.8	45.2	170.9	-66.9	180	0	0	0	114
63	T	57.2	Low	54.9	Low	131 Å²	131	144.1 Å²	144.1	80%	0.804	75%	0.747	S	S	*	*			trans	-131.7	53	160.4	66.8	0	0	0	0	111.8	K65	T63-K65 PolarHBondContact O-N 3.26Å
64	K	53.9	Low	54.9	Low	191 Å²	191	150.6 Å²	150.6	83%	0.83	77%	0.768	S	S	*	*			trans	-87.7	97.7	155.5	-87.7	-162.2	177.4	179.5	0	109.4	H66	K64-H66 PolarHBondContact O-N 2.82Å
65	K	62.3	Low	54.9	Low	195 Å²	195	150.9 Å²	150.9	85%	0.848	77%	0.774	S	S	*	*			trans	-42.8	124.7	167.6	-51.7	-122.4	-177.3	-176.4	0	109.7	T63	T63-K65 PolarHBondContact O-N 3.26Å
66	H	49.3	Very low	54.7	Low	176 Å²	176	154.6 Å²	154.6	82%	0.815	79%	0.793	S	S	*	*			trans	-105	90.9	162.1	-139	88.3	0	0	0	107.2	K64	K64-H66 PolarHBondContact O-N 2.82Å
67	E	53.9	Low	54.6	Low	167 Å²	167	156 Å²	156	78%	0.78	81%	0.805	S	S	*	*			trans	-85.4	102.8	161.1	-162	-172.6	128.3	0	0	105.5
68	K	53.7	Low	54.7	Low	181 Å²	181	155.8 Å²	155.8	79%	0.787	80%	0.803	S	S	*	*			trans	-103.4	105.2	170.2	-169.6	170.1	179.7	176.9	0	108
69	K	57.4	Low	55.1	Low	246 Å²	246	164.1 Å²	164.1	100%	1.07	82%	0.815	S	S	*	*			trans	-68.2	0	158	-72.7	-171.8	177.9	-171.7	0	110.5

Retrieved 69 of 69 residues in 11.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).