A0A2U9BPB3_SCOMX Loading...

U6 snRNA-associated Sm-like protein LSm6

Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.

AlphaFold DB , UniProt , Accession A0A2U9BPB3, Species SCOMX (Scophthalmus maximus, Turbot), Gene LSM6, Length 80 aa.

						>A0A2U9BPB3_SCOMX|A0A2U9BPB3|LSM6
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAIEQTEEYVNGQLKNKYGDAFLRGNNVLYISTQKRKV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.2	Very low	73.7	Confident	241 Å²	241	134.3 Å²	134.3	100%	1.187	68%	0.682	S	S	*	*				0	119.9	0	-78.9	-178.5	176.5	0	0	108.1	L3	M1-L3 PolarHBondContact O-N 3.15Å
2	S	51.3	Low	74.8	Confident	110 Å²	110	126.1 Å²	126.1	77%	0.769	64%	0.641	S	S	*	*			trans	-64.8	122.5	175.9	178	0	0	0	0	109.4	R4	S2-R4 VanDerWaalsContact C-N 3.3Å; S2-R4 PolarHBondContact O-N 2.92Å
3	L	62.9	Low	75.7	Confident	170 Å²	170	128.1 Å²	128.1	89%	0.89	64%	0.643	S	S	*	*			trans	-62.1	92.7	167.9	-83.9	153.2	0	0	0	107.5	M1 K5	M1-L3 PolarHBondContact O-N 3.15Å; L3-K5 PolarHBondContact O-N 3.37Å
4	R	67.1	Low	76.7	Confident	231 Å²	231	125.1 Å²	125.1	87%	0.872	63%	0.626	S	S	*	*			trans	-60.7	108.4	173	-75	-172.6	176.9	-173.8	-0.1	107.5	S2 Q6	S2-R4 VanDerWaalsContact C-N 3.3Å; S2-R4 PolarHBondContact O-N 2.92Å; R4-Q6 PolarHBondContact O-N 2.82Å
5	K	72.4	Confident	77.6	Confident	199 Å²	199	117 Å²	117	87%	0.865	59%	0.585	S	S	*	*			trans	-56.9	109.7	168.4	-83.4	-177	174.6	179.6	0	107.4	L3 T7	L3-K5 PolarHBondContact O-N 3.37Å; K5-T7 PolarHBondContact O-N 2.83Å
6	Q	79.4	Confident	78.7	Confident	143 Å²	143	114.8 Å²	114.8	67%	0.668	58%	0.575	S	S	*	*			trans	-69.2	123.5	170.7	-72.9	-178	-34.7	0	0	108	R4	R4-Q6 PolarHBondContact O-N 2.82Å
7	T	86.3	Confident	79.6	Confident	62 Å²	62	111.1 Å²	111.1	38%	0.38	57%	0.573	S	S	.	*			trans	-83.4	158.2	172.7	67.9	0	0	0	0	109.8	K5 S9 D10 F11	K5-T7 PolarHBondContact O-N 2.83Å; T7-S9 PolarHBondContact O-N 2.74Å; T7-D10 WeakPolarHBondContact CB-OD2 3.32Å; T7-D10 PolarHBondContact N-OD2 2.91Å; T7-D10 WeakPolarHBondContact O-CB 3.2Å; T7-D10 PolarHBondContact O-N 2.86Å; T7-D10 PolarHBondContact OG1-N 3.28Å; T7-D10 VanDerWaalsContact OG1-N 3.16Å; T7-D10 PolarHBondContact OG1-OD2 3.39Å; T7-F11 PolarHBondContact O-N 2.93Å; T7-F11 VanDerWaalsContact O-N 3.1Å
8	P	84.9	Confident	80.5	Confident	104 Å²	104	112.4 Å²	112.4	68%	0.675	57%	0.569	S	S	*	*	H	α-helix	trans	-53.2	-39.8	170.6	-27.2	35.8	0	0	0	112	D10 F11 L12	P8-D10 VanDerWaalsContact C-N 3.31Å; P8-D10 PolarHBondContact O-N 2.89Å; P8-F11 WeakPolarHBondContact O-CB 3.48Å; P8-F11 PolarHBondContact O-N 3.13Å; P8-F11 VanDerWaalsContact O-N 3.17Å; P8-L12 VanDerWaalsContact O-CG 3.25Å; P8-L12 WeakPolarHBondContact O-CG 3.46Å; P8-L12 PolarHBondContact O-N 2.9Å
9	S	86.2	Confident	81.4	Confident	72 Å²	72	109.7 Å²	109.7	50%	0.503	56%	0.56	S	S	.	*	H	α-helix	trans	-61.5	-36.7	176.5	-54.1	0	0	0	0	113.2	T7 K13	T7-S9 PolarHBondContact O-N 2.74Å; S9-K13 WeakPolarHBondContact O-CG 3.34Å; S9-K13 PolarHBondContact O-N 3.28Å; S9-K13 VanDerWaalsContact O-N 3.16Å
10	D	87.9	Confident	82.1	Confident	61 Å²	61	104.3 Å²	104.3	33%	0.326	53%	0.532	S	S	.	.	H	α-helix	trans	-68.3	-40.3	175.2	-60.9	-44.4	0	0	0	111.5	T7 P8 K13 Q14	T7-D10 WeakPolarHBondContact CB-OD2 3.32Å; T7-D10 PolarHBondContact N-OD2 2.91Å; T7-D10 WeakPolarHBondContact O-CB 3.2Å; T7-D10 PolarHBondContact O-N 2.86Å; T7-D10 PolarHBondContact OG1-N 3.28Å; T7-D10 VanDerWaalsContact OG1-N 3.16Å; T7-D10 PolarHBondContact OG1-OD2 3.39Å; P8-D10 VanDerWaalsContact C-N 3.31Å; P8-D10 PolarHBondContact O-N 2.89Å; D10-K13 PolarHBondContact O-N 3.28Å; D10-Q14 VanDerWaalsContact O-CG 3.3Å; D10-Q14 WeakPolarHBondContact O-CG 3.34Å; D10-Q14 PolarHBondContact O-N 2.88Å
11	F	85.7	Confident	82.9	Confident	84 Å²	84	100.1 Å²	100.1	37%	0.368	51%	0.512	S	S	.	.	H	α-helix	trans	-60.9	-47.7	174.6	170.4	-100.7	0	0	0	111.2	T7 P8 K13 Q14 I15	T7-F11 PolarHBondContact O-N 2.93Å; T7-F11 VanDerWaalsContact O-N 3.1Å; P8-F11 WeakPolarHBondContact O-CB 3.48Å; P8-F11 PolarHBondContact O-N 3.13Å; P8-F11 VanDerWaalsContact O-N 3.17Å; F11-K13 VanDerWaalsContact C-N 3.31Å; F11-K13 PolarHBondContact O-N 2.92Å; F11-Q14 WeakPolarHBondContact O-CB 3.4Å; F11-Q14 PolarHBondContact O-N 2.98Å; F11-I15 HydrophobicContact CD1-CD1 4.42Å; F11-I15 HydrophobicContact CD2-CG2 4.34Å; F11-I15 HydrophobicContact CE1-CD1 3.81Å; F11-I15 HydrophobicContact CE1-CG2 4.34Å; F11-I15 HydrophobicContact CE2-CG2 3.83Å; F11-I15 HydrophobicContact CZ-CD1 4.21Å; F11-I15 HydrophobicContact CZ-CG2 3.83Å; F11-I15 PolarHBondContact O-N 2.82Å
12	L	86.6	Confident	85.2	Confident	36 Å²	36	88.6 Å²	88.6	19%	0.188	46%	0.455	C	S	.	.	H	α-helix	trans	-58.8	-41.9	-179.8	-70.1	172.7	0	0	0	112	P8 Q14 I15 L37	P8-L12 VanDerWaalsContact O-CG 3.25Å; P8-L12 WeakPolarHBondContact O-CG 3.46Å; P8-L12 PolarHBondContact O-N 2.9Å; L12-Q14 VanDerWaalsContact C-N 3.28Å; L12-Q14 PolarHBondContact O-N 2.85Å; L12-I15 HydrophobicContact CD2-CD1 4.23Å; L12-I15 WeakPolarHBondContact O-CG1 3.45Å; L12-I15 PolarHBondContact O-N 2.95Å; L12-L37 HydrophobicContact CB-CD1 3.86Å; L12-L37 HydrophobicContact CB-CD2 4.1Å; L12-L37 HydrophobicContact CD1-CD1 3.63Å; L12-L37 HydrophobicContact CD2-CD1 3.67Å; L12-L37 HydrophobicContact CD2-CD2 3.76Å; L12-L37 HydrophobicContact CD2-CG 4.38Å; L12-L37 HydrophobicContact CG-CD1 3.87Å; L12-L37 HydrophobicContact CG-CD2 4.43Å
13	K	86.8	Confident	87.4	Confident	152 Å²	152	85.7 Å²	85.7	66%	0.661	43%	0.428	S	S	*	.	H	α-helix	trans	-63.1	-32.6	174.8	-72.5	174	-177.8	177	0	113.2	S9 D10 F11 I15	S9-K13 WeakPolarHBondContact O-CG 3.34Å; S9-K13 PolarHBondContact O-N 3.28Å; S9-K13 VanDerWaalsContact O-N 3.16Å; D10-K13 PolarHBondContact O-N 3.28Å; F11-K13 VanDerWaalsContact C-N 3.31Å; F11-K13 PolarHBondContact O-N 2.92Å; K13-I15 VanDerWaalsContact C-N 3.34Å
14	Q	88.6	Confident	89.1	Confident	87 Å²	87	78.6 Å²	78.6	41%	0.407	39%	0.391	S	S	.	.	H	α-helix	trans	-75.4	-22.3	-178.3	-72.2	171.3	23.9	0	0	113.6	D10 F11 L12 R18	D10-Q14 VanDerWaalsContact O-CG 3.3Å; D10-Q14 WeakPolarHBondContact O-CG 3.34Å; D10-Q14 PolarHBondContact O-N 2.88Å; F11-Q14 WeakPolarHBondContact O-CB 3.4Å; F11-Q14 PolarHBondContact O-N 2.98Å; L12-Q14 VanDerWaalsContact C-N 3.28Å; L12-Q14 PolarHBondContact O-N 2.85Å; Q14-R18 WeakPolarHBondContact O-CD 3.39Å; Q14-R18 VanDerWaalsContact O-CZ 3.27Å; Q14-R18 PolarHBondContact O-NE 3.2Å
15	I	91.1	Very high	90.6	Very high	3 Å²	3	72.2 Å²	72.2	2%	0.015	37%	0.374	C	S	.	.	H	α-helix	trans	-97.1	-9.8	-175.2	61.4	163.6	0	0	0	113.9	F11 L12 K13 G17 R18 L34 L37 I73 T75	F11-I15 HydrophobicContact CD1-CD1 4.42Å; F11-I15 HydrophobicContact CD2-CG2 4.34Å; F11-I15 HydrophobicContact CE1-CD1 3.81Å; F11-I15 HydrophobicContact CE1-CG2 4.34Å; F11-I15 HydrophobicContact CE2-CG2 3.83Å; F11-I15 HydrophobicContact CZ-CD1 4.21Å; F11-I15 HydrophobicContact CZ-CG2 3.83Å; F11-I15 PolarHBondContact O-N 2.82Å; L12-I15 HydrophobicContact CD2-CD1 4.23Å; L12-I15 WeakPolarHBondContact O-CG1 3.45Å; L12-I15 PolarHBondContact O-N 2.95Å; K13-I15 VanDerWaalsContact C-N 3.34Å; I15-G17 PolarHBondContact O-N 2.81Å; I15-R18 WeakPolarHBondContact O-CB 3.32Å; I15-R18 PolarHBondContact O-N 2.62Å; I15-R18 VanDerWaalsContact O-N 3.1Å; I15-L34 HydrophobicContact CB-CD2 4.14Å; I15-L34 HydrophobicContact CD1-CD2 3.59Å; I15-L34 HydrophobicContact CG1-CD2 3.53Å; I15-L34 WeakPolarHBondContact O-CD2 3.15Å; I15-L37 HydrophobicContact CD1-CD2 4.38Å; I15-I73 HydrophobicContact CD1-CG2 3.91Å; I15-T75 HydrophobicContact CB-CG2 4.21Å; I15-T75 HydrophobicContact CG2-CG2 3.45Å; I15-T75 VanDerWaalsContact CG2-CG2 3.45Å
16	I	94.2	Very high	91.7	Very high	82 Å²	82	67.1 Å²	67.1	42%	0.421	36%	0.364	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.9	136.8	171.9	-65.4	170.6	0	0	0	109.6	R18 L34 L37	I16-R18 PolarHBondContact O-N 2.87Å; I16-L34 HydrophobicContact CG1-CD2 4.48Å; I16-L37 HydrophobicContact CG1-CD2 4.48Å
17	G	95.2	Very high	92.5	Very high	52 Å²	52	61.9 Å²	61.9	54%	0.536	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	74.8	2.3	-176.3	0	0	0	0	0	114.5	I15 L34	I15-G17 PolarHBondContact O-N 2.81Å; G17-L34 WeakPolarHBondContact CA-O 3.42Å; G17-L34 PolarHBondContact N-O 2.83Å
18	R	95.6	Very high	93.1	Very high	134 Å²	134	60.1 Å²	60.1	51%	0.506	34%	0.338	S	S	.	.	S	Bend	trans	-98.8	151.5	178.6	-58.2	-168.7	-178.5	-172.7	1.1	111.5	Q14 I15 I16 V20 L34	Q14-R18 WeakPolarHBondContact O-CD 3.39Å; Q14-R18 VanDerWaalsContact O-CZ 3.27Å; Q14-R18 PolarHBondContact O-NE 3.2Å; I15-R18 WeakPolarHBondContact O-CB 3.32Å; I15-R18 PolarHBondContact O-N 2.62Å; I15-R18 VanDerWaalsContact O-N 3.1Å; I16-R18 PolarHBondContact O-N 2.87Å; R18-V20 PolarHBondContact O-N 3.25Å; R18-L34 PolarHBondContact O-N 3.18Å
19	P	96.7	Very high	93.7	Very high	62 Å²	62	56.1 Å²	56.1	40%	0.403	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.8	128.9	165.4	-24.2	35.9	0	0	0	110.7	G32 Q76	P19-G32 CarbonylContact C-O 3.57Å; P19-G32 WeakPolarHBondContact CA-O 3.17Å; P19-Q76 HydrophobicContact CB-CB 4.02Å; P19-Q76 PolarHBondContact O-N 2.79Å
20	V	96.7	Very high	94.3	Very high	0 Å²	0	54.2 Å²	54.2	0%	0	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	157.9	-179.6	-64.4	0	0	0	0	111.6	R18 V22 R31 G32 L34 I45 I73 S74	R18-V20 PolarHBondContact O-N 3.25Å; V20-V22 HydrophobicContact CG2-CG2 4.1Å; V20-R31 WeakPolarHBondContact O-CA 3.21Å; V20-G32 PolarHBondContact N-O 3.2Å; V20-G32 PolarHBondContact O-N 3.49Å; V20-L34 HydrophobicContact CG1-CB 4.03Å; V20-L34 HydrophobicContact CG1-CD2 4.35Å; V20-L34 HydrophobicContact CG2-CB 3.89Å; V20-L34 HydrophobicContact CG2-CD1 4.49Å; V20-I45 HydrophobicContact CG2-CD1 4.05Å; V20-I73 HydrophobicContact CB-CG2 4.22Å; V20-I73 HydrophobicContact CG1-CG2 4.26Å; V20-S74 CarbonylContact C-O 3.46Å; V20-S74 WeakPolarHBondContact CA-O 3.38Å; V20-S74 WeakPolarHBondContact CB-O 3.31Å
21	V	97.1	Very high	94.7	Very high	17 Å²	17	54.3 Å²	54.3	10%	0.103	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	122.3	162.8	-175.2	0	0	0	0	107.6	D29 Y30 R31 S74 Q76	V21-D29 HydrophobicContact CG1-CB 4.14Å; V21-Y30 CarbonylContact C-O 3.59Å; V21-Y30 WeakPolarHBondContact CA-O 3.36Å; V21-R31 HydrophobicContact CG1-CG 4.22Å; V21-R31 HydrophobicContact CG2-CG 4.03Å; V21-S74 PolarHBondContact N-O 3.27Å; V21-S74 PolarHBondContact O-N 2.69Å; V21-Q76 HydrophobicContact CG2-CB 4.32Å; V21-Q76 HydrophobicContact CG2-CG 4.5Å
22	V	97.2	Very high	95.3	Very high	0 Å²	0	50.8 Å²	50.8	0%	0	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	113.8	173.9	-174.5	0	0	0	0	107.8	V20 L24 Y30 I43 I45 L65 V70 Y72 I73	V20-V22 HydrophobicContact CG2-CG2 4.1Å; V22-L24 HydrophobicContact CG1-CD2 4.41Å; V22-Y30 PolarHBondContact N-O 3.49Å; V22-Y30 PolarHBondContact O-N 2.81Å; V22-I43 HydrophobicContact CG1-CD1 3.77Å; V22-I43 HydrophobicContact CG2-CD1 4.01Å; V22-I45 HydrophobicContact CG2-CD1 4.46Å; V22-L65 HydrophobicContact CB-CD1 3.84Å; V22-L65 HydrophobicContact CG1-CD1 3.69Å; V22-L65 HydrophobicContact CG2-CD1 4.2Å; V22-V70 HydrophobicContact CG1-CG1 4Å; V22-V70 HydrophobicContact CG1-CG2 4.07Å; V22-Y72 WeakPolarHBondContact CA-O 3.46Å; V22-I73 HydrophobicContact CG1-CG1 4.5Å; V22-I73 HydrophobicContact CG2-CG1 4.45Å; V22-I73 HydrophobicContact CG2-CG2 4.35Å
23	K	97.7	Very high	95.8	Very high	48 Å²	48	50.7 Å²	50.7	21%	0.209	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	131	175.7	-170.6	168.9	-163.8	88.1	0	109.4	G27 D29 L71 Y72	K23-G27 PolarHBondContact NZ-O 3.01Å; K23-D29 WeakPolarHBondContact CD-OD1 3.34Å; K23-D29 VanDerWaalsContact CG-OD1 3.23Å; K23-D29 WeakPolarHBondContact CG-OD1 3.48Å; K23-D29 IonicContact NZ-OD1 2.71Å; K23-D29 PolarHBondContact NZ-OD1 3.1Å; K23-D29 IonicContact NZ-OD2 3.71Å; K23-L71 HydrophobicContact CD-CD2 4.2Å; K23-L71 HydrophobicContact CG-CD2 4.34Å; K23-L71 WeakPolarHBondContact O-CB 3.45Å; K23-L71 PolarHBondContact O-N 3.16Å; K23-Y72 HydrophobicContact CB-CD1 3.86Å; K23-Y72 HydrophobicContact CB-CD2 4.36Å; K23-Y72 HydrophobicContact CB-CE1 3.51Å; K23-Y72 HydrophobicContact CB-CE2 4.02Å; K23-Y72 HydrophobicContact CB-CG 4.27Å; K23-Y72 HydrophobicContact CD-CD1 4.23Å; K23-Y72 HydrophobicContact CD-CE1 3.37Å; K23-Y72 HydrophobicContact CG-CE1 4.02Å; K23-Y72 PolarHBondContact N-O 3.03Å; K23-Y72 PolarHBondContact O-N 3.38Å
24	L	97.9	Very high	96.3	Very high	21 Å²	21	43.4 Å²	43.4	11%	0.11	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	160.5	173.3	-57.3	-168.2	0	0	0	111.4	V22 S26 G27 V28 Y30 N69 V70	V22-L24 HydrophobicContact CG1-CD2 4.41Å; L24-S26 PolarHBondContact O-N 3.03Å; L24-S26 VanDerWaalsContact O-N 3.12Å; L24-G27 PolarHBondContact O-N 3.34Å; L24-V28 PolarHBondContact N-O 3.38Å; L24-Y30 HydrophobicContact CD1-CD2 4.08Å; L24-Y30 HydrophobicContact CD1-CE2 3.49Å; L24-Y30 VanDerWaalsContact CD1-CE2 3.49Å; L24-Y30 HydrophobicContact CG-CD2 3.97Å; L24-Y30 HydrophobicContact CG-CE2 3.88Å; L24-N69 CarbonylContact C-O 3.6Å; L24-N69 WeakPolarHBondContact CA-O 3.25Å; L24-V70 HydrophobicContact CD2-CG2 4.26Å
25	N	97.8	Very high	96.7	Very high	97 Å²	97	40.9 Å²	40.9	52%	0.519	24%	0.239	S	C	.	.	T	Hydrogen-bonded Turn	trans	-57.1	-24.6	174.1	-68.9	-28.6	0	0	0	113	G27 N68 N69	N25-G27 PolarHBondContact O-N 2.77Å; N25-N68 PolarHBondContact ND2-O 3.17Å; N25-N69 PolarHBondContact N-O 3.37Å
26	S	96.7	Very high	96.8	Very high	92 Å²	92	44 Å²	44	64%	0.643	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	-10.4	173.7	59.1	0	0	0	0	114.1	L24 V28	L24-S26 PolarHBondContact O-N 3.03Å; L24-S26 VanDerWaalsContact O-N 3.12Å; S26-V28 WeakPolarHBondContact OG-CG2 3.49Å
27	G	96.5	Very high	96.8	Very high	34 Å²	34	41.8 Å²	41.8	35%	0.351	25%	0.249	S	C	.	.	S	Bend	trans	92.6	-7.3	-176.8	0	0	0	0	0	115	K23 L24 N25	K23-G27 PolarHBondContact NZ-O 3.01Å; L24-G27 PolarHBondContact O-N 3.34Å; N25-G27 PolarHBondContact O-N 2.77Å
28	V	98	Very high	96.5	Very high	25 Å²	25	42.1 Å²	42.1	15%	0.152	24%	0.239	C	C	.	.			trans	-70.9	135.6	177	-177.4	0	0	0	0	110.3	L24 S26 Y30 E50 V52	L24-V28 PolarHBondContact N-O 3.38Å; S26-V28 WeakPolarHBondContact OG-CG2 3.49Å; V28-Y30 HydrophobicContact CB-CE2 4.21Å; V28-Y30 HydrophobicContact CG1-CD2 4.12Å; V28-Y30 HydrophobicContact CG1-CE2 3.55Å; V28-E50 HydrophobicContact CG1-CG 3.65Å; V28-V52 HydrophobicContact CG1-CG2 4.28Å; V28-V52 HydrophobicContact CG2-CG2 4.27Å
29	D	97.8	Very high	96.2	Very high	19 Å²	19	39.5 Å²	39.5	10%	0.102	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	129.5	175.4	-54.5	-34.6	0	0	0	110.2	V21 K23 Y51	V21-D29 HydrophobicContact CG1-CB 4.14Å; K23-D29 WeakPolarHBondContact CD-OD1 3.34Å; K23-D29 VanDerWaalsContact CG-OD1 3.23Å; K23-D29 WeakPolarHBondContact CG-OD1 3.48Å; K23-D29 IonicContact NZ-OD1 2.71Å; K23-D29 PolarHBondContact NZ-OD1 3.1Å; K23-D29 IonicContact NZ-OD2 3.71Å; D29-Y51 PolarHBondContact N-O 3.12Å; D29-Y51 PolarHBondContact O-N 3.19Å
30	Y	98	Very high	96	Very high	33 Å²	33	45.5 Å²	45.5	13%	0.129	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	129.7	169.4	-70.6	-93	0	0	0	109.1	V21 V22 L24 V28 T48 E49 E50 Y60 L65	V21-Y30 CarbonylContact C-O 3.59Å; V21-Y30 WeakPolarHBondContact CA-O 3.36Å; V22-Y30 PolarHBondContact N-O 3.49Å; V22-Y30 PolarHBondContact O-N 2.81Å; L24-Y30 HydrophobicContact CD1-CD2 4.08Å; L24-Y30 HydrophobicContact CD1-CE2 3.49Å; L24-Y30 VanDerWaalsContact CD1-CE2 3.49Å; L24-Y30 HydrophobicContact CG-CD2 3.97Å; L24-Y30 HydrophobicContact CG-CE2 3.88Å; V28-Y30 HydrophobicContact CB-CE2 4.21Å; V28-Y30 HydrophobicContact CG1-CD2 4.12Å; V28-Y30 HydrophobicContact CG1-CE2 3.55Å; Y30-T48 HydrophobicContact CD1-CG2 3.6Å; Y30-T48 HydrophobicContact CE1-CG2 4.48Å; Y30-T48 HydrophobicContact CG-CG2 4.42Å; Y30-E49 CarbonylContact C-O 3.6Å; Y30-E49 WeakPolarHBondContact CA-O 3.47Å; Y30-E50 HydrophobicContact CD1-CB 4.48Å; Y30-E50 HydrophobicContact CE1-CB 4.22Å; Y30-E50 HydrophobicContact CE1-CG 4.27Å; Y30-E50 PolarHBondContact OH-OE1 2.85Å; Y30-Y60 HydrophobicContact CD1-CD2 4.47Å; Y30-Y60 AromaticContact CE1-CD2 3.91Å; Y30-Y60 HydrophobicContact CE1-CD2 3.91Å; Y30-Y60 AromaticContact CE1-CE2 3.73Å; Y30-Y60 HydrophobicContact CE1-CE2 3.73Å; Y30-L65 HydrophobicContact CD1-CD2 4.12Å; Y30-L65 HydrophobicContact CD2-CD1 4.38Å; Y30-L65 HydrophobicContact CD2-CD2 4.06Å; Y30-L65 HydrophobicContact CE1-CD2 4.21Å; Y30-L65 HydrophobicContact CE2-CD2 4.2Å; Y30-L65 HydrophobicContact CG-CD1 4.15Å; Y30-L65 HydrophobicContact CG-CD2 4.02Å
31	R	97.6	Very high	95.9	Very high	62 Å²	62	49.5 Å²	49.5	23%	0.234	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	139.6	179.9	-52.2	-169.8	-174.5	160.9	1.3	109.9	V20 V21 T48 E49 Y51	V20-R31 WeakPolarHBondContact O-CA 3.21Å; V21-R31 HydrophobicContact CG1-CG 4.22Å; V21-R31 HydrophobicContact CG2-CG 4.03Å; R31-T48 CarbonylContact O-C 3.56Å; R31-T48 VanDerWaalsContact O-CA 3.31Å; R31-T48 WeakPolarHBondContact O-CA 3.44Å; R31-E49 PolarHBondContact N-O 3.3Å; R31-E49 PolarHBondContact O-N 3.35Å; R31-Y51 HydrophobicContact CB-CD2 4.5Å; R31-Y51 HydrophobicContact CB-CE2 4.12Å; R31-Y51 VanDerWaalsContact CD-CE2 3.48Å; R31-Y51 HydrophobicContact CG-CD2 3.82Å; R31-Y51 HydrophobicContact CG-CE2 3.78Å
32	G	97.2	Very high	95.8	Very high	10 Å²	10	51.5 Å²	51.5	10%	0.103	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	167.3	-170.8	-176.5	0	0	0	0	0	111.8	P19 V20 E46	P19-G32 CarbonylContact C-O 3.57Å; P19-G32 WeakPolarHBondContact CA-O 3.17Å; V20-G32 PolarHBondContact N-O 3.2Å; V20-G32 PolarHBondContact O-N 3.49Å; G32-E46 CarbonylContact C-O 3.53Å; G32-E46 WeakPolarHBondContact CA-O 3.47Å
33	V	97.3	Very high	95.8	Very high	34 Å²	34	51.6 Å²	51.6	21%	0.206	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	126.2	179	-178.5	0	0	0	0	109.5	A35 I45 E46	V33-A35 PolarHBondContact O-N 2.8Å; V33-A35 VanDerWaalsContact O-N 3.13Å; V33-I45 WeakPolarHBondContact O-CA 3.49Å; V33-E46 HydrophobicContact CB-CB 4.4Å; V33-E46 PolarHBondContact N-O 2.93Å; V33-E46 PolarHBondContact O-N 3Å
34	L	97	Very high	95.8	Very high	0 Å²	0	49.9 Å²	49.9	0%	0	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	105.5	179.4	-175.4	64.1	0	0	0	110.6	I15 I16 G17 R18 V20 L37 I43	I15-L34 HydrophobicContact CB-CD2 4.14Å; I15-L34 HydrophobicContact CD1-CD2 3.59Å; I15-L34 HydrophobicContact CG1-CD2 3.53Å; I15-L34 WeakPolarHBondContact O-CD2 3.15Å; I16-L34 HydrophobicContact CG1-CD2 4.48Å; G17-L34 WeakPolarHBondContact CA-O 3.42Å; G17-L34 PolarHBondContact N-O 2.83Å; R18-L34 PolarHBondContact O-N 3.18Å; V20-L34 HydrophobicContact CG1-CB 4.03Å; V20-L34 HydrophobicContact CG1-CD2 4.35Å; V20-L34 HydrophobicContact CG2-CB 3.89Å; V20-L34 HydrophobicContact CG2-CD1 4.49Å; L34-L37 HydrophobicContact CD1-CD2 4.36Å; L34-L37 HydrophobicContact CD2-CD2 3.57Å; L34-L37 HydrophobicContact CG-CD2 4.32Å; L34-I43 HydrophobicContact CD1-CG2 3.45Å; L34-I43 VanDerWaalsContact CD1-CG2 3.45Å
35	A	96.8	Very high	95.8	Very high	34 Å²	34	49 Å²	49	28%	0.281	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.7	-51.4	179.5	0	0	0	0	0	111.6	V33 A44 E46	V33-A35 PolarHBondContact O-N 2.8Å; V33-A35 VanDerWaalsContact O-N 3.13Å; A35-A44 HydrophobicContact CB-CB 4.18Å; A35-A44 PolarHBondContact N-O 2.8Å; A35-E46 HydrophobicContact CB-CG 3.99Å
36	C	93.8	Very high	95.8	Very high	67 Å²	67	48.1 Å²	48.1	45%	0.453	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.1	164.5	175.7	68.5	0	0	0	0	111.9	A44	C36-A44 PolarHBondContact N-O 2.91Å; C36-A44 PolarHBondContact O-N 3.09Å; C36-A44 WeakPolarHBondContact SG-CB 3.37Å
37	L	93.7	Very high	95.8	Very high	36 Å²	36	50.7 Å²	50.7	19%	0.188	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.7	161.5	173.4	71	95.7	0	0	0	111.1	L12 I15 I16 L34 N42 I43	L12-L37 HydrophobicContact CB-CD1 3.86Å; L12-L37 HydrophobicContact CB-CD2 4.1Å; L12-L37 HydrophobicContact CD1-CD1 3.63Å; L12-L37 HydrophobicContact CD2-CD1 3.67Å; L12-L37 HydrophobicContact CD2-CD2 3.76Å; L12-L37 HydrophobicContact CD2-CG 4.38Å; L12-L37 HydrophobicContact CG-CD1 3.87Å; L12-L37 HydrophobicContact CG-CD2 4.43Å; I15-L37 HydrophobicContact CD1-CD2 4.38Å; I16-L37 HydrophobicContact CG1-CD2 4.48Å; L34-L37 HydrophobicContact CD1-CD2 4.36Å; L34-L37 HydrophobicContact CD2-CD2 3.57Å; L34-L37 HydrophobicContact CG-CD2 4.32Å; L37-N42 WeakPolarHBondContact CA-O 2.98Å; L37-I43 HydrophobicContact CB-CG1 4.23Å
38	D	90.1	Very high	95.9	Very high	60 Å²	60	49 Å²	49	32%	0.321	27%	0.267	S	S	.	.			trans	-118.3	-179.5	174.7	72	14.6	0	0	0	114.1	Y40 M41 N42	D38-Y40 PolarHBondContact O-N 3.48Å; D38-Y40 WeakPolarHBondContact OD1-CA 3.2Å; D38-Y40 WeakPolarHBondContact OD1-CB 3.49Å; D38-Y40 PolarHBondContact OD1-N 2.82Å; D38-M41 PolarHBondContact O-N 3Å; D38-M41 VanDerWaalsContact O-N 3.08Å; D38-M41 PolarHBondContact OD1-N 3.17Å; D38-N42 PolarHBondContact N-O 2.98Å; D38-N42 PolarHBondContact OD1-N 3.05Å; D38-N42 PolarHBondContact OD1-ND2 2.92Å; D38-N42 WeakPolarHBondContact OD2-CB 3.44Å; D38-N42 PolarHBondContact OD2-ND2 2.8Å
39	G	88.3	Confident	95.9	Very high	78 Å²	78	50.1 Å²	50.1	80%	0.804	27%	0.27	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.9	-10.4	178.7	0	0	0	0	0	115.1
40	Y	93.1	Very high	95.9	Very high	188 Å²	188	49.9 Å²	49.9	74%	0.737	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.5	4.8	174.1	-62.2	-74.5	0	0	0	112.3	D38 N42 G67	D38-Y40 PolarHBondContact O-N 3.48Å; D38-Y40 WeakPolarHBondContact OD1-CA 3.2Å; D38-Y40 WeakPolarHBondContact OD1-CB 3.49Å; D38-Y40 PolarHBondContact OD1-N 2.82Å; Y40-N42 VanDerWaalsContact C-N 3.27Å; Y40-N42 PolarHBondContact O-N 3.27Å; Y40-G67 WeakPolarHBondContact O-CA 3.42Å
41	M	94.1	Very high	95.9	Very high	84 Å²	84	49.9 Å²	49.9	41%	0.414	27%	0.269	S	S	.	.			trans	64.5	24.1	-175.9	-50.9	-176.9	-70.1	0	0	114.1	D38 I43 G67	D38-M41 PolarHBondContact O-N 3Å; D38-M41 VanDerWaalsContact O-N 3.08Å; D38-M41 PolarHBondContact OD1-N 3.17Å; M41-I43 WeakPolarHBondContact O-CG1 3Å; M41-G67 WeakPolarHBondContact O-CA 3.39Å
42	N	95.7	Very high	95.8	Very high	60 Å²	60	49.1 Å²	49.1	32%	0.321	27%	0.271	S	S	.	.			trans	-66.8	136.1	163	-58.8	-55.7	0	0	0	108	L37 D38 Y40 L65 G67	L37-N42 WeakPolarHBondContact CA-O 2.98Å; D38-N42 PolarHBondContact N-O 2.98Å; D38-N42 PolarHBondContact OD1-N 3.05Å; D38-N42 PolarHBondContact OD1-ND2 2.92Å; D38-N42 WeakPolarHBondContact OD2-CB 3.44Å; D38-N42 PolarHBondContact OD2-ND2 2.8Å; Y40-N42 VanDerWaalsContact C-N 3.27Å; Y40-N42 PolarHBondContact O-N 3.27Å; N42-L65 WeakPolarHBondContact CA-O 3.4Å; N42-G67 PolarHBondContact OD1-N 3.28Å
43	I	96.6	Very high	95.6	Very high	2 Å²	2	56.1 Å²	56.1	1%	0.01	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	132.8	-169.2	-66.2	155.5	0	0	0	109.4	V22 L34 L37 M41 I45 F64 L65 V70 I73	V22-I43 HydrophobicContact CG1-CD1 3.77Å; V22-I43 HydrophobicContact CG2-CD1 4.01Å; L34-I43 HydrophobicContact CD1-CG2 3.45Å; L34-I43 VanDerWaalsContact CD1-CG2 3.45Å; L37-I43 HydrophobicContact CB-CG1 4.23Å; M41-I43 WeakPolarHBondContact O-CG1 3Å; I43-I45 HydrophobicContact CG2-CB 4.24Å; I43-F64 CarbonylContact O-C 3.48Å; I43-F64 VanDerWaalsContact O-CA 3.32Å; I43-F64 WeakPolarHBondContact O-CA 3.4Å; I43-L65 HydrophobicContact CB-CB 4.27Å; I43-L65 PolarHBondContact N-O 2.88Å; I43-L65 PolarHBondContact O-N 3.36Å; I43-V70 HydrophobicContact CD1-CG1 4.45Å; I43-V70 HydrophobicContact CD1-CG2 3.89Å; I43-I73 HydrophobicContact CD1-CD1 3.6Å; I43-I73 HydrophobicContact CD1-CG1 3.98Å; I43-I73 HydrophobicContact CG1-CD1 4.27Å
44	A	97.4	Very high	95.3	Very high	12 Å²	12	56.9 Å²	56.9	10%	0.099	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	127.2	159.2	0	0	0	0	0	108.8	A35 C36 A63 F64	A35-A44 HydrophobicContact CB-CB 4.18Å; A35-A44 PolarHBondContact N-O 2.8Å; C36-A44 PolarHBondContact N-O 2.91Å; C36-A44 PolarHBondContact O-N 3.09Å; C36-A44 WeakPolarHBondContact SG-CB 3.37Å; A44-A63 WeakPolarHBondContact CA-O 3.48Å; A44-F64 HydrophobicContact CB-CD1 3.95Å; A44-F64 HydrophobicContact CB-CE1 3.7Å; A44-F64 HydrophobicContact CB-CZ 4.45Å
45	I	97.7	Very high	95.3	Very high	1 Å²	1	64 Å²	64	1%	0.005	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	131.8	-179.8	-173.9	166.8	0	0	0	109.4	V20 V22 V33 I43 T48 D62 A63 L65	V20-I45 HydrophobicContact CG2-CD1 4.05Å; V22-I45 HydrophobicContact CG2-CD1 4.46Å; V33-I45 WeakPolarHBondContact O-CA 3.49Å; I43-I45 HydrophobicContact CG2-CB 4.24Å; I45-T48 HydrophobicContact CG2-CG2 3.96Å; I45-T48 WeakPolarHBondContact CG2-OG1 3.34Å; I45-T48 PolarHBondContact O-OG1 3.23Å; I45-D62 CarbonylContact O-C 3.59Å; I45-D62 WeakPolarHBondContact O-CA 3.38Å; I45-A63 HydrophobicContact CG2-CB 4.07Å; I45-A63 WeakPolarHBondContact CG2-O 3.35Å; I45-A63 PolarHBondContact N-O 3.19Å; I45-A63 PolarHBondContact O-N 3.37Å; I45-L65 HydrophobicContact CG2-CD1 4.19Å; I45-L65 HydrophobicContact CG2-CG 4.27Å
46	E	97.9	Very high	95.3	Very high	80 Å²	80	66.3 Å²	66.3	37%	0.374	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	155.3	178.2	-67.7	173.2	-176.2	0	0	110.2	G32 V33 A35 T48 D62	G32-E46 CarbonylContact C-O 3.53Å; G32-E46 WeakPolarHBondContact CA-O 3.47Å; V33-E46 HydrophobicContact CB-CB 4.4Å; V33-E46 PolarHBondContact N-O 2.93Å; V33-E46 PolarHBondContact O-N 3Å; A35-E46 HydrophobicContact CB-CG 3.99Å; E46-T48 PolarHBondContact O-N 3.16Å; E46-D62 WeakPolarHBondContact CG-OD1 3.19Å
47	Q	97.1	Very high	95.5	Very high	145 Å²	145	69.4 Å²	69.4	68%	0.678	37%	0.367	S	S	*	.	E	Extended strand (participates in β ladder)	trans	53.8	41.5	178.4	-55.8	173.8	36.3	0	0	112.5	G61	Q47-G61 PolarHBondContact N-O 3.34Å; Q47-G61 VanDerWaalsContact N-O 3.15Å
48	T	98.1	Very high	95.6	Very high	0 Å²	0	70.7 Å²	70.7	0%	0	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	127.6	-167	-56.2	0	0	0	0	112.3	Y30 R31 I45 E46 K59 Y60 G61 A63	Y30-T48 HydrophobicContact CD1-CG2 3.6Å; Y30-T48 HydrophobicContact CE1-CG2 4.48Å; Y30-T48 HydrophobicContact CG-CG2 4.42Å; R31-T48 CarbonylContact O-C 3.56Å; R31-T48 VanDerWaalsContact O-CA 3.31Å; R31-T48 WeakPolarHBondContact O-CA 3.44Å; I45-T48 HydrophobicContact CG2-CG2 3.96Å; I45-T48 WeakPolarHBondContact CG2-OG1 3.34Å; I45-T48 PolarHBondContact O-OG1 3.23Å; E46-T48 PolarHBondContact O-N 3.16Å; T48-K59 CarbonylContact O-C 3.54Å; T48-K59 WeakPolarHBondContact O-CA 3.21Å; T48-Y60 PolarHBondContact O-N 2.82Å; T48-G61 WeakPolarHBondContact CB-O 3.46Å; T48-G61 PolarHBondContact N-O 2.71Å; T48-G61 PolarHBondContact OG1-O 3Å; T48-A63 HydrophobicContact CG2-CB 4.13Å
49	E	98.2	Very high	96	Very high	47 Å²	47	74.6 Å²	74.6	22%	0.22	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	134.6	171.7	-65.2	-171.3	151.6	0	0	110.4	Y30 R31 Y51 L56 K59	Y30-E49 CarbonylContact C-O 3.6Å; Y30-E49 WeakPolarHBondContact CA-O 3.47Å; R31-E49 PolarHBondContact N-O 3.3Å; R31-E49 PolarHBondContact O-N 3.35Å; E49-Y51 HydrophobicContact CB-CD2 4.29Å; E49-Y51 HydrophobicContact CB-CE2 3.54Å; E49-Y51 PolarHBondContact OE2-OH 3.08Å; E49-L56 HydrophobicContact CB-CD1 3.73Å; E49-L56 HydrophobicContact CG-CD1 4.09Å; E49-K59 HydrophobicContact CG-CD 4.31Å; E49-K59 HydrophobicContact CG-CG 4.21Å; E49-K59 VanDerWaalsContact OE1-CE 3.32Å; E49-K59 WeakPolarHBondContact OE1-CE 3.48Å; E49-K59 IonicContact OE1-NZ 2.74Å; E49-K59 PolarHBondContact OE1-NZ 3.09Å
50	E	98	Very high	96.3	Very high	14 Å²	14	76.2 Å²	76.2	7%	0.065	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	130.1	177	-178.9	-172.4	-106.8	0	0	110.4	V28 Y30 V52 K57 N58 Y60	V28-E50 HydrophobicContact CG1-CG 3.65Å; Y30-E50 HydrophobicContact CD1-CB 4.48Å; Y30-E50 HydrophobicContact CE1-CB 4.22Å; Y30-E50 HydrophobicContact CE1-CG 4.27Å; Y30-E50 PolarHBondContact OH-OE1 2.85Å; E50-V52 HydrophobicContact CG-CG2 4.36Å; E50-K57 PolarHBondContact O-N 2.91Å; E50-K57 WeakPolarHBondContact OE2-CD 3.02Å; E50-N58 HydrophobicContact CB-CB 4.18Å; E50-N58 PolarHBondContact N-O 2.87Å; E50-N58 PolarHBondContact OE2-ND2 3.01Å; E50-Y60 HydrophobicContact CB-CD2 4.22Å; E50-Y60 HydrophobicContact CB-CE2 3.59Å; E50-Y60 VanDerWaalsContact CD-OH 3.28Å; E50-Y60 HydrophobicContact CG-CE2 4.14Å; E50-Y60 PolarHBondContact OE1-OH 3.16Å; E50-Y60 PolarHBondContact OE2-OH 3.33Å
51	Y	98.1	Very high	96.4	Very high	33 Å²	33	68.8 Å²	68.8	13%	0.129	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	126.4	174.8	-64.3	-105.8	0	0	0	110.5	D29 R31 E49 Q55 L56	D29-Y51 PolarHBondContact N-O 3.12Å; D29-Y51 PolarHBondContact O-N 3.19Å; R31-Y51 HydrophobicContact CB-CD2 4.5Å; R31-Y51 HydrophobicContact CB-CE2 4.12Å; R31-Y51 VanDerWaalsContact CD-CE2 3.48Å; R31-Y51 HydrophobicContact CG-CD2 3.82Å; R31-Y51 HydrophobicContact CG-CE2 3.78Å; E49-Y51 HydrophobicContact CB-CD2 4.29Å; E49-Y51 HydrophobicContact CB-CE2 3.54Å; E49-Y51 PolarHBondContact OE2-OH 3.08Å; Y51-Q55 CarbonylContact C-O 3.54Å; Y51-Q55 WeakPolarHBondContact CA-O 3.34Å; Y51-L56 HydrophobicContact CD1-CB 4.27Å; Y51-L56 HydrophobicContact CE1-CB 3.9Å; Y51-L56 HydrophobicContact CE1-CD1 4.41Å; Y51-L56 HydrophobicContact CE2-CD1 4.05Å
52	V	96.6	Very high	96.5	Very high	46 Å²	46	70.7 Å²	70.7	28%	0.279	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	125.4	173	-176.2	0	0	0	0	107.3	V28 E50 G54 Q55 K57	V28-V52 HydrophobicContact CG1-CG2 4.28Å; V28-V52 HydrophobicContact CG2-CG2 4.27Å; E50-V52 HydrophobicContact CG-CG2 4.36Å; V52-G54 PolarHBondContact O-N 3.22Å; V52-Q55 PolarHBondContact N-O 3.44Å; V52-Q55 PolarHBondContact O-N 3.46Å; V52-Q55 VanDerWaalsContact O-N 3.09Å; V52-K57 HydrophobicContact CB-CD 4.22Å; V52-K57 HydrophobicContact CG2-CB 4.28Å; V52-K57 HydrophobicContact CG2-CD 3.59Å
53	N	93.1	Very high	96.6	Very high	158 Å²	158	68.6 Å²	68.6	85%	0.845	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.8	34.8	-174.2	-56.2	-33.6	0	0	0	113.2	Q55	N53-Q55 PolarHBondContact O-N 2.89Å
54	G	91.1	Very high	96.6	Very high	49 Å²	49	77 Å²	77	51%	0.505	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.2	-3	179.6	0	0	0	0	0	115.4	V52	V52-G54 PolarHBondContact O-N 3.22Å
55	Q	95.9	Very high	96.6	Very high	151 Å²	151	77.1 Å²	77.1	71%	0.706	39%	0.39	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.4	137.7	176.3	-64.1	-170.7	2.4	0	0	111.1	Y51 V52 N53 K57	Y51-Q55 CarbonylContact C-O 3.54Å; Y51-Q55 WeakPolarHBondContact CA-O 3.34Å; V52-Q55 PolarHBondContact N-O 3.44Å; V52-Q55 PolarHBondContact O-N 3.46Å; V52-Q55 VanDerWaalsContact O-N 3.09Å; N53-Q55 PolarHBondContact O-N 2.89Å; Q55-K57 PolarHBondContact O-N 3.02Å
56	L	96.9	Very high	96.6	Very high	82 Å²	82	85.1 Å²	85.1	43%	0.429	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.6	122	173.5	177.7	67.9	0	0	0	108.9	E49 Y51	E49-L56 HydrophobicContact CB-CD1 3.73Å; E49-L56 HydrophobicContact CG-CD1 4.09Å; Y51-L56 HydrophobicContact CD1-CB 4.27Å; Y51-L56 HydrophobicContact CE1-CB 3.9Å; Y51-L56 HydrophobicContact CE1-CD1 4.41Å; Y51-L56 HydrophobicContact CE2-CD1 4.05Å
57	K	97.3	Very high	96.6	Very high	131 Å²	131	81.4 Å²	81.4	57%	0.57	40%	0.404	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	-46.9	-180	-169.5	175.4	175.7	-173.5	0	111.6	E50 V52 Q55	E50-K57 PolarHBondContact O-N 2.91Å; E50-K57 WeakPolarHBondContact OE2-CD 3.02Å; V52-K57 HydrophobicContact CB-CD 4.22Å; V52-K57 HydrophobicContact CG2-CB 4.28Å; V52-K57 HydrophobicContact CG2-CD 3.59Å; Q55-K57 PolarHBondContact O-N 3.02Å
58	N	96.9	Very high	96.6	Very high	64 Å²	64	78.8 Å²	78.8	34%	0.342	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.9	162	-174.9	-71.4	-54.9	0	0	0	112.4	E50 Y60	E50-N58 HydrophobicContact CB-CB 4.18Å; E50-N58 PolarHBondContact N-O 2.87Å; E50-N58 PolarHBondContact OE2-ND2 3.01Å; N58-Y60 HydrophobicContact CB-CE1 4.02Å; N58-Y60 HydrophobicContact CB-CE2 3.98Å; N58-Y60 PolarHBondContact ND2-OH 2.81Å
59	K	97.7	Very high	96.5	Very high	142 Å²	142	82.2 Å²	82.2	62%	0.617	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.3	127.8	166.1	-53.9	-161.8	-175.1	-148.2	0	109	T48 E49	T48-K59 CarbonylContact O-C 3.54Å; T48-K59 WeakPolarHBondContact O-CA 3.21Å; E49-K59 HydrophobicContact CG-CD 4.31Å; E49-K59 HydrophobicContact CG-CG 4.21Å; E49-K59 VanDerWaalsContact OE1-CE 3.32Å; E49-K59 WeakPolarHBondContact OE1-CE 3.48Å; E49-K59 IonicContact OE1-NZ 2.74Å; E49-K59 PolarHBondContact OE1-NZ 3.09Å
60	Y	94.9	Very high	96.5	Very high	111 Å²	111	80.5 Å²	80.5	44%	0.435	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	-10.6	-173.4	-63.7	-63	0	0	0	113.7	Y30 T48 E50 N58 D62	Y30-Y60 HydrophobicContact CD1-CD2 4.47Å; Y30-Y60 AromaticContact CE1-CD2 3.91Å; Y30-Y60 HydrophobicContact CE1-CD2 3.91Å; Y30-Y60 AromaticContact CE1-CE2 3.73Å; Y30-Y60 HydrophobicContact CE1-CE2 3.73Å; T48-Y60 PolarHBondContact O-N 2.82Å; E50-Y60 HydrophobicContact CB-CD2 4.22Å; E50-Y60 HydrophobicContact CB-CE2 3.59Å; E50-Y60 VanDerWaalsContact CD-OH 3.28Å; E50-Y60 HydrophobicContact CG-CE2 4.14Å; E50-Y60 PolarHBondContact OE1-OH 3.16Å; E50-Y60 PolarHBondContact OE2-OH 3.33Å; N58-Y60 HydrophobicContact CB-CE1 4.02Å; N58-Y60 HydrophobicContact CB-CE2 3.98Å; N58-Y60 PolarHBondContact ND2-OH 2.81Å; Y60-D62 PolarHBondContact O-N 3.12Å
61	G	95.6	Very high	96.5	Very high	33 Å²	33	84.6 Å²	84.6	34%	0.34	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	69.1	-121.1	-172	0	0	0	0	0	110.1	Q47 T48	Q47-G61 PolarHBondContact N-O 3.34Å; Q47-G61 VanDerWaalsContact N-O 3.15Å; T48-G61 WeakPolarHBondContact CB-O 3.46Å; T48-G61 PolarHBondContact N-O 2.71Å; T48-G61 PolarHBondContact OG1-O 3Å
62	D	95.8	Very high	96.3	Very high	123 Å²	123	87.9 Å²	87.9	66%	0.658	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.7	123.7	177.3	-58.1	-17.6	0	0	0	110	I45 E46 Y60	I45-D62 CarbonylContact O-C 3.59Å; I45-D62 WeakPolarHBondContact O-CA 3.38Å; E46-D62 WeakPolarHBondContact CG-OD1 3.19Å; Y60-D62 PolarHBondContact O-N 3.12Å
63	A	97.2	Very high	96.3	Very high	17 Å²	17	87 Å²	87	14%	0.14	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	145.7	-176	0	0	0	0	0	112	A44 I45 T48	A44-A63 WeakPolarHBondContact CA-O 3.48Å; I45-A63 HydrophobicContact CG2-CB 4.07Å; I45-A63 WeakPolarHBondContact CG2-O 3.35Å; I45-A63 PolarHBondContact N-O 3.19Å; I45-A63 PolarHBondContact O-N 3.37Å; T48-A63 HydrophobicContact CG2-CB 4.13Å
64	F	97.3	Very high	96.3	Very high	177 Å²	177	81.6 Å²	81.6	78%	0.776	41%	0.408	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	123.5	172.9	-67.2	-85.8	0	0	0	110.1	I43 A44	I43-F64 CarbonylContact O-C 3.48Å; I43-F64 VanDerWaalsContact O-CA 3.32Å; I43-F64 WeakPolarHBondContact O-CA 3.4Å; A44-F64 HydrophobicContact CB-CD1 3.95Å; A44-F64 HydrophobicContact CB-CE1 3.7Å; A44-F64 HydrophobicContact CB-CZ 4.45Å
65	L	97.4	Very high	96.4	Very high	15 Å²	15	81.8 Å²	81.8	8%	0.079	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	132.6	176.2	-54	176.3	0	0	0	109.7	V22 Y30 N42 I43 I45	V22-L65 HydrophobicContact CB-CD1 3.84Å; V22-L65 HydrophobicContact CG1-CD1 3.69Å; V22-L65 HydrophobicContact CG2-CD1 4.2Å; Y30-L65 HydrophobicContact CD1-CD2 4.12Å; Y30-L65 HydrophobicContact CD2-CD1 4.38Å; Y30-L65 HydrophobicContact CD2-CD2 4.06Å; Y30-L65 HydrophobicContact CE1-CD2 4.21Å; Y30-L65 HydrophobicContact CE2-CD2 4.2Å; Y30-L65 HydrophobicContact CG-CD1 4.15Å; Y30-L65 HydrophobicContact CG-CD2 4.02Å; N42-L65 WeakPolarHBondContact CA-O 3.4Å; I43-L65 HydrophobicContact CB-CB 4.27Å; I43-L65 PolarHBondContact N-O 2.88Å; I43-L65 PolarHBondContact O-N 3.36Å; I45-L65 HydrophobicContact CG2-CD1 4.19Å; I45-L65 HydrophobicContact CG2-CG 4.27Å
66	R	97.8	Very high	96	Very high	170 Å²	170	78.8 Å²	78.8	64%	0.642	39%	0.385	S	S	*	.			trans	-79.8	125	179.3	-159.7	-172.7	166.4	177	-2.4	110.4	N68 N69	R66-N68 VanDerWaalsContact C-N 3.33Å; R66-N68 WeakPolarHBondContact CB-OD1 3.23Å; R66-N68 WeakPolarHBondContact CD-OD1 3.47Å; R66-N68 WeakPolarHBondContact CG-OD1 3.3Å; R66-N68 PolarHBondContact NE-OD1 2.91Å; R66-N68 PolarHBondContact O-N 3.46Å; R66-N69 PolarHBondContact O-N 3.26Å
67	G	96.6	Very high	95	Very high	2 Å²	2	83.4 Å²	83.4	2%	0.021	40%	0.402	C	S	.	.	G	3₁₀ helix	trans	-65.7	-28.3	-169.1	0	0	0	0	0	115.9	Y40 M41 N42 N69 V70	Y40-G67 WeakPolarHBondContact O-CA 3.42Å; M41-G67 WeakPolarHBondContact O-CA 3.39Å; N42-G67 PolarHBondContact OD1-N 3.28Å; G67-N69 PolarHBondContact O-N 3.1Å; G67-N69 VanDerWaalsContact O-N 3.16Å; G67-V70 WeakPolarHBondContact O-CB 3.41Å; G67-V70 PolarHBondContact O-N 3.04Å; G67-V70 VanDerWaalsContact O-N 3.09Å
68	N	97.4	Very high	93.3	Very high	89 Å²	89	88.3 Å²	88.3	48%	0.476	42%	0.417	S	S	.	.	G	3₁₀ helix	trans	-63.5	-19.9	174.2	71.6	-41.8	0	0	0	113.6	N25 R66	N25-N68 PolarHBondContact ND2-O 3.17Å; R66-N68 VanDerWaalsContact C-N 3.33Å; R66-N68 WeakPolarHBondContact CB-OD1 3.23Å; R66-N68 WeakPolarHBondContact CD-OD1 3.47Å; R66-N68 WeakPolarHBondContact CG-OD1 3.3Å; R66-N68 PolarHBondContact NE-OD1 2.91Å; R66-N68 PolarHBondContact O-N 3.46Å
69	N	97.2	Very high	91.4	Very high	72 Å²	72	95.3 Å²	95.3	39%	0.385	44%	0.444	S	S	.	.	G	3₁₀ helix	trans	-97.7	-4.2	178.7	-66.6	-32.5	0	0	0	112.6	L24 N25 R66 G67	L24-N69 CarbonylContact C-O 3.6Å; L24-N69 WeakPolarHBondContact CA-O 3.25Å; N25-N69 PolarHBondContact N-O 3.37Å; R66-N69 PolarHBondContact O-N 3.26Å; G67-N69 PolarHBondContact O-N 3.1Å; G67-N69 VanDerWaalsContact O-N 3.16Å
70	V	97.4	Very high	89.1	Confident	11 Å²	11	98.4 Å²	98.4	7%	0.067	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	125.3	-178.6	176.2	0	0	0	0	109.4	V22 L24 I43 G67 I73	V22-V70 HydrophobicContact CG1-CG1 4Å; V22-V70 HydrophobicContact CG1-CG2 4.07Å; L24-V70 HydrophobicContact CD2-CG2 4.26Å; I43-V70 HydrophobicContact CD1-CG1 4.45Å; I43-V70 HydrophobicContact CD1-CG2 3.89Å; G67-V70 WeakPolarHBondContact O-CB 3.41Å; G67-V70 PolarHBondContact O-N 3.04Å; G67-V70 VanDerWaalsContact O-N 3.09Å; V70-I73 HydrophobicContact CG1-CG1 4.03Å
71	L	97.6	Very high	88.8	Confident	100 Å²	100	97.8 Å²	97.8	52%	0.524	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	-49.4	173.2	179.4	61.5	0	0	0	110.9	K23	K23-L71 HydrophobicContact CD-CD2 4.2Å; K23-L71 HydrophobicContact CG-CD2 4.34Å; K23-L71 WeakPolarHBondContact O-CB 3.45Å; K23-L71 PolarHBondContact O-N 3.16Å
72	Y	95.5	Very high	88.4	Confident	103 Å²	103	101.2 Å²	101.2	40%	0.404	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.5	162.7	173.7	71.1	-106.6	0	0	0	112.3	V22 K23	V22-Y72 WeakPolarHBondContact CA-O 3.46Å; K23-Y72 HydrophobicContact CB-CD1 3.86Å; K23-Y72 HydrophobicContact CB-CD2 4.36Å; K23-Y72 HydrophobicContact CB-CE1 3.51Å; K23-Y72 HydrophobicContact CB-CE2 4.02Å; K23-Y72 HydrophobicContact CB-CG 4.27Å; K23-Y72 HydrophobicContact CD-CD1 4.23Å; K23-Y72 HydrophobicContact CD-CE1 3.37Å; K23-Y72 HydrophobicContact CG-CE1 4.02Å; K23-Y72 PolarHBondContact N-O 3.03Å; K23-Y72 PolarHBondContact O-N 3.38Å
73	I	95	Very high	88	Confident	28 Å²	28	99.9 Å²	99.9	14%	0.144	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	133.9	169.2	-50.7	170.9	0	0	0	107.9	I15 V20 V22 I43 V70	I15-I73 HydrophobicContact CD1-CG2 3.91Å; V20-I73 HydrophobicContact CB-CG2 4.22Å; V20-I73 HydrophobicContact CG1-CG2 4.26Å; V22-I73 HydrophobicContact CG1-CG1 4.5Å; V22-I73 HydrophobicContact CG2-CG1 4.45Å; V22-I73 HydrophobicContact CG2-CG2 4.35Å; I43-I73 HydrophobicContact CD1-CD1 3.6Å; I43-I73 HydrophobicContact CD1-CG1 3.98Å; I43-I73 HydrophobicContact CG1-CD1 4.27Å; V70-I73 HydrophobicContact CG1-CG1 4.03Å
74	S	94.1	Very high	87.5	Confident	43 Å²	43	104.8 Å²	104.8	30%	0.301	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	141.4	176	67.7	0	0	0	0	111	V20 V21 Q76	V20-S74 CarbonylContact C-O 3.46Å; V20-S74 WeakPolarHBondContact CA-O 3.38Å; V20-S74 WeakPolarHBondContact CB-O 3.31Å; V21-S74 PolarHBondContact N-O 3.27Å; V21-S74 PolarHBondContact O-N 2.69Å; S74-Q76 PolarHBondContact O-N 3.39Å
75	T	93	Very high	86.9	Confident	53 Å²	53	100.3 Å²	100.3	33%	0.325	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.1	128.9	172.7	53.7	0	0	0	0	109.8	I15 K77	I15-T75 HydrophobicContact CB-CG2 4.21Å; I15-T75 HydrophobicContact CG2-CG2 3.45Å; I15-T75 VanDerWaalsContact CG2-CG2 3.45Å; T75-K77 PolarHBondContact O-N 2.89Å
76	Q	86.4	Confident	86.2	Confident	89 Å²	89	106 Å²	106	42%	0.416	50%	0.502	S	S	.	.			trans	-75.9	108	173.1	-169.3	177.8	11.9	0	0	108.5	P19 V21 S74 R78	P19-Q76 HydrophobicContact CB-CB 4.02Å; P19-Q76 PolarHBondContact O-N 2.79Å; V21-Q76 HydrophobicContact CG2-CB 4.32Å; V21-Q76 HydrophobicContact CG2-CG 4.5Å; S74-Q76 PolarHBondContact O-N 3.39Å; Q76-R78 PolarHBondContact O-N 2.96Å
77	K	77.8	Confident	85.4	Confident	179 Å²	179	101.4 Å²	101.4	78%	0.778	49%	0.492	S	S	*	.			trans	-69.9	130.6	172.6	-68.4	-175.2	178.9	-179.6	0	108.6	T75 K79	T75-K77 PolarHBondContact O-N 2.89Å; K77-K79 PolarHBondContact O-N 3.01Å
78	R	60.4	Low	84.5	Confident	234 Å²	234	109.1 Å²	109.1	88%	0.883	53%	0.528	S	S	*	.			trans	-58.9	122.4	162.6	-80.7	175.5	85.1	167.4	4.2	106.8	Q76 V80	Q76-R78 PolarHBondContact O-N 2.96Å; R78-V80 PolarHBondContact O-N 3.33Å; R78-V80 VanDerWaalsContact O-N 3.12Å
79	K	56.8	Low	83.4	Confident	210 Å²	210	110.8 Å²	110.8	91%	0.913	53%	0.533	S	S	*	.			trans	-64.3	110.3	160.3	-75.9	-174.7	175.7	-177.5	0	105.6	K77	K77-K79 PolarHBondContact O-N 3.01Å
80	V	49.6	Very low	82.2	Confident	207 Å²	207	114.3 Å²	114.3	100%	1.255	55%	0.546	S	S	*	.			trans	-75.8	0	162.6	-176.1	0	0	0	0	106.9	R78	R78-V80 PolarHBondContact O-N 3.33Å; R78-V80 VanDerWaalsContact O-N 3.12Å

Retrieved 80 of 80 residues in 120.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).