A0A3B3TNP2_9TELE Loading...

Small integral membrane protein 12

AlphaFold DB , UniProt , Accession A0A3B3TNP2, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 91 aa.

						>A0A3B3TNP2_9TELE|A0A3B3TNP2
MWPVVWTAMRTYAPYVTFPVAFVVGAVGYHLEWFIRGTPKPREEEKSILELREERKLQEQVGTDGTQVLSLKEKLEFTPKAALNRNRSEKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71	Confident	84.5	Confident	189 Å²	189	113.6 Å²	113.6	93%	0.931	57%	0.569	S	S	*	*				0	-48.1	0	-68.7	-88.6	90	0	0	112.2	V4 V5	M1-V4 WeakPolarHBondContact O-CB 3.35Å; M1-V4 PolarHBondContact O-N 2.73Å; M1-V5 PolarHBondContact O-N 3.02Å
2	W	81.8	Confident	84.8	Confident	205 Å²	205	116.7 Å²	116.7	78%	0.777	57%	0.571	S	S	*	*	H	α-helix	trans	-58.6	-42.8	178.7	-171.9	-109.2	0	0	0	116.2	V4 V5 W6	W2-V4 PolarHBondContact O-N 3.39Å; W2-V5 PolarHBondContact O-N 3.27Å; W2-W6 PolarHBondContact O-N 3.41Å
3	P	85.6	Confident	85.1	Confident	87 Å²	87	110.5 Å²	110.5	57%	0.565	55%	0.55	S	S	*	*	H	α-helix	trans	-64	-30.6	177.1	-23.4	35.4	0	0	0	113.2	W6 T7	P3-W6 PolarHBondContact O-N 3.47Å; P3-T7 PolarHBondContact O-N 3.49Å; P3-T7 PolarHBondContact O-OG1 3.07Å
4	V	85.9	Confident	85.5	Confident	91 Å²	91	107.9 Å²	107.9	55%	0.552	55%	0.545	S	S	*	.	H	α-helix	trans	-69.1	-41.6	179.5	180	0	0	0	0	110.8	M1 W2 W6 T7 A8	M1-V4 WeakPolarHBondContact O-CB 3.35Å; M1-V4 PolarHBondContact O-N 2.73Å; W2-V4 PolarHBondContact O-N 3.39Å; V4-W6 VanDerWaalsContact C-N 3.32Å; V4-W6 PolarHBondContact O-N 3.08Å; V4-T7 PolarHBondContact O-N 3.01Å; V4-A8 WeakPolarHBondContact O-CB 3.47Å; V4-A8 PolarHBondContact O-N 2.93Å
5	V	85.9	Confident	85.9	Confident	81 Å²	81	112.3 Å²	112.3	49%	0.491	55%	0.554	S	S	.	*	H	α-helix	trans	-62.7	-41.7	175.8	178.1	0	0	0	0	110.6	M1 W2 A8 M9	M1-V5 PolarHBondContact O-N 3.02Å; W2-V5 PolarHBondContact O-N 3.27Å; V5-A8 PolarHBondContact O-N 3.46Å; V5-M9 VanDerWaalsContact O-CB 3.31Å; V5-M9 WeakPolarHBondContact O-CB 3.27Å; V5-M9 PolarHBondContact O-N 3.34Å
6	W	87.4	Confident	86.2	Confident	122 Å²	122	111.3 Å²	111.3	46%	0.462	56%	0.556	S	S	.	*	H	α-helix	trans	-67.8	-40.6	179.2	-168	-119.5	0	0	0	113.1	W2 P3 V4 M9 R10	W2-W6 PolarHBondContact O-N 3.41Å; P3-W6 PolarHBondContact O-N 3.47Å; V4-W6 VanDerWaalsContact C-N 3.32Å; V4-W6 PolarHBondContact O-N 3.08Å; W6-M9 HydrophobicContact CE3-SD 4.23Å; W6-M9 HydrophobicContact CZ3-SD 4.03Å; W6-R10 VanDerWaalsContact CE2-CZ 3.49Å; W6-R10 VanDerWaalsContact NE1-NH2 3.16Å; W6-R10 PolarHBondContact O-N 2.96Å; W6-R10 VanDerWaalsContact O-N 3.13Å
7	T	86.4	Confident	86.6	Confident	86 Å²	86	109.8 Å²	109.8	53%	0.528	55%	0.554	S	S	.	*	H	α-helix	trans	-63.3	-49.4	173.5	-56.6	0	0	0	0	110.6	P3 V4 M9 R10 T11	P3-T7 PolarHBondContact O-N 3.49Å; P3-T7 PolarHBondContact O-OG1 3.07Å; V4-T7 PolarHBondContact O-N 3.01Å; T7-M9 VanDerWaalsContact C-N 3.34Å; T7-M9 PolarHBondContact O-N 2.85Å; T7-R10 PolarHBondContact O-N 3.32Å; T7-R10 VanDerWaalsContact O-N 3.16Å; T7-T11 PolarHBondContact O-N 3.32Å; T7-T11 PolarHBondContact O-OG1 3.23Å
8	A	85.4	Confident	87	Confident	39 Å²	39	112 Å²	112	32%	0.322	56%	0.56	S	S	.	*	H	α-helix	trans	-58.8	-44.6	178	0	0	0	0	0	112	V4 V5 R10 T11 Y12	V4-A8 WeakPolarHBondContact O-CB 3.47Å; V4-A8 PolarHBondContact O-N 2.93Å; V5-A8 PolarHBondContact O-N 3.46Å; A8-R10 VanDerWaalsContact C-N 3.31Å; A8-R10 PolarHBondContact O-N 3.26Å; A8-T11 PolarHBondContact O-N 3.13Å; A8-Y12 HydrophobicContact CB-CD2 4.3Å; A8-Y12 HydrophobicContact CB-CE2 4.49Å; A8-Y12 WeakPolarHBondContact O-CB 3.47Å; A8-Y12 WeakPolarHBondContact O-CD2 3.44Å; A8-Y12 PolarHBondContact O-N 3.25Å
9	M	87.1	Confident	87.5	Confident	110 Å²	110	109.4 Å²	109.4	54%	0.542	55%	0.552	S	S	.	*	H	α-helix	trans	-58.6	-42.2	177.4	-172.2	-179.7	-68.8	0	0	111.7	V5 W6 T7 A13	V5-M9 VanDerWaalsContact O-CB 3.31Å; V5-M9 WeakPolarHBondContact O-CB 3.27Å; V5-M9 PolarHBondContact O-N 3.34Å; W6-M9 HydrophobicContact CE3-SD 4.23Å; W6-M9 HydrophobicContact CZ3-SD 4.03Å; T7-M9 VanDerWaalsContact C-N 3.34Å; T7-M9 PolarHBondContact O-N 2.85Å; M9-A13 WeakPolarHBondContact O-CA 3.43Å; M9-A13 WeakPolarHBondContact O-CB 3.36Å; M9-A13 PolarHBondContact O-N 3.42Å
10	R	86.2	Confident	87.9	Confident	162 Å²	162	108.3 Å²	108.3	61%	0.611	55%	0.55	S	S	*	*	H	α-helix	trans	-69.8	-38.1	176.4	-76	179.3	171.1	158.1	-5.6	113.4	W6 T7 A8 P14	W6-R10 VanDerWaalsContact CE2-CZ 3.49Å; W6-R10 VanDerWaalsContact NE1-NH2 3.16Å; W6-R10 PolarHBondContact O-N 2.96Å; W6-R10 VanDerWaalsContact O-N 3.13Å; T7-R10 PolarHBondContact O-N 3.32Å; T7-R10 VanDerWaalsContact O-N 3.16Å; A8-R10 VanDerWaalsContact C-N 3.31Å; A8-R10 PolarHBondContact O-N 3.26Å; R10-P14 WeakPolarHBondContact O-CD 3.5Å
11	T	86.9	Confident	88.3	Confident	78 Å²	78	106.1 Å²	106.1	48%	0.479	55%	0.549	S	S	.	.	H	α-helix	trans	-67.9	-39.3	178.9	-50.1	0	0	0	0	111.5	T7 A8	T7-T11 PolarHBondContact O-N 3.32Å; T7-T11 PolarHBondContact O-OG1 3.23Å; A8-T11 PolarHBondContact O-N 3.13Å
12	Y	88.3	Confident	89.5	Confident	150 Å²	150	103.6 Å²	103.6	59%	0.588	53%	0.533	S	S	*	.	H	α-helix	trans	-94.9	-14.2	-177.1	-65.3	-67.3	0	0	0	114.3	A8 Y15 V16	A8-Y12 HydrophobicContact CB-CD2 4.3Å; A8-Y12 HydrophobicContact CB-CE2 4.49Å; A8-Y12 WeakPolarHBondContact O-CB 3.47Å; A8-Y12 WeakPolarHBondContact O-CD2 3.44Å; A8-Y12 PolarHBondContact O-N 3.25Å; Y12-Y15 HydrophobicContact CD1-CD2 4.35Å; Y12-Y15 PolarHBondContact O-N 2.7Å; Y12-Y15 VanDerWaalsContact O-N 3.07Å; Y12-V16 PolarHBondContact O-N 3.04Å
13	A	88.1	Confident	90.2	Very high	37 Å²	37	98 Å²	98	31%	0.306	52%	0.521	S	S	.	.	H	α-helix	trans	-50.4	-49.4	178.5	0	0	0	0	0	112.8	M9 Y15 V16 T17	M9-A13 WeakPolarHBondContact O-CA 3.43Å; M9-A13 WeakPolarHBondContact O-CB 3.36Å; M9-A13 PolarHBondContact O-N 3.42Å; A13-Y15 PolarHBondContact O-N 3.1Å; A13-V16 PolarHBondContact O-N 2.88Å; A13-T17 WeakPolarHBondContact O-CB 3.48Å; A13-T17 WeakPolarHBondContact O-CG2 3.32Å; A13-T17 PolarHBondContact O-N 3.33Å; A13-T17 PolarHBondContact O-OG1 2.91Å
14	P	90.7	Very high	90.8	Very high	73 Å²	73	98.4 Å²	98.4	47%	0.474	52%	0.522	S	S	.	.	H	α-helix	trans	-58.8	-35.4	-179.5	-24.4	34.8	0	0	0	113.4	R10 V16 F18	R10-P14 WeakPolarHBondContact O-CD 3.5Å; P14-V16 VanDerWaalsContact C-N 3.26Å; P14-V16 PolarHBondContact O-N 3.27Å; P14-F18 WeakPolarHBondContact O-CB 3.35Å; P14-F18 PolarHBondContact O-N 3.45Å; P14-F18 VanDerWaalsContact O-N 3.09Å
15	Y	91.9	Very high	91.2	Very high	175 Å²	175	96.1 Å²	96.1	69%	0.686	52%	0.517	S	S	*	.	H	α-helix	trans	-72.4	-19.9	-179	-62.8	-82.4	0	0	0	113.2	Y12 A13 P19	Y12-Y15 HydrophobicContact CD1-CD2 4.35Å; Y12-Y15 PolarHBondContact O-N 2.7Å; Y12-Y15 VanDerWaalsContact O-N 3.07Å; A13-Y15 PolarHBondContact O-N 3.1Å; Y15-P19 WeakPolarHBondContact O-CD 3.5Å; Y15-P19 WeakPolarHBondContact O-CG 3.42Å
16	V	91.1	Very high	91.7	Very high	95 Å²	95	94.1 Å²	94.1	58%	0.576	51%	0.508	S	S	*	.	H	α-helix	trans	-100.5	-43.8	177.8	-179.1	0	0	0	0	110.8	Y12 A13 P14 P19 V20	Y12-V16 PolarHBondContact O-N 3.04Å; A13-V16 PolarHBondContact O-N 2.88Å; P14-V16 VanDerWaalsContact C-N 3.26Å; P14-V16 PolarHBondContact O-N 3.27Å; V16-P19 WeakPolarHBondContact O-CD 3.42Å; V16-V20 WeakPolarHBondContact O-CB 3.26Å; V16-V20 WeakPolarHBondContact O-CG2 3.29Å; V16-V20 PolarHBondContact O-N 3.07Å
17	T	93.2	Very high	92	Very high	86 Å²	86	92.6 Å²	92.6	53%	0.528	51%	0.512	S	S	.	.	H	α-helix	trans	-70.2	-36.5	-176.8	58.8	0	0	0	0	111.9	A13 V20 A21	A13-T17 WeakPolarHBondContact O-CB 3.48Å; A13-T17 WeakPolarHBondContact O-CG2 3.32Å; A13-T17 PolarHBondContact O-N 3.33Å; A13-T17 PolarHBondContact O-OG1 2.91Å; T17-V20 PolarHBondContact O-N 3.06Å; T17-A21 WeakPolarHBondContact O-CB 3.47Å; T17-A21 PolarHBondContact O-N 3.3Å
18	F	93.7	Very high	92.3	Very high	150 Å²	150	90.1 Å²	90.1	66%	0.658	50%	0.504	S	S	*	.	H	α-helix	trans	-65.5	-51	-179.4	176.3	-96.9	0	0	0	112.8	P14 V20 A21 F22	P14-F18 WeakPolarHBondContact O-CB 3.35Å; P14-F18 PolarHBondContact O-N 3.45Å; P14-F18 VanDerWaalsContact O-N 3.09Å; F18-V20 VanDerWaalsContact C-N 3.31Å; F18-V20 PolarHBondContact O-N 3.4Å; F18-A21 PolarHBondContact O-N 3.38Å; F18-F22 WeakPolarHBondContact O-CB 3.4Å; F18-F22 PolarHBondContact O-N 3.41Å
19	P	95.3	Very high	92.5	Very high	63 Å²	63	95.3 Å²	95.3	41%	0.409	52%	0.517	S	S	.	.	H	α-helix	trans	-60.1	-40.5	175.4	-25.1	35.1	0	0	0	112.8	Y15 V16 F22 V23	Y15-P19 WeakPolarHBondContact O-CD 3.5Å; Y15-P19 WeakPolarHBondContact O-CG 3.42Å; V16-P19 WeakPolarHBondContact O-CD 3.42Å; P19-F22 PolarHBondContact O-N 3.42Å; P19-V23 VanDerWaalsContact O-CG2 3.32Å; P19-V23 WeakPolarHBondContact O-CG2 3.37Å; P19-V23 PolarHBondContact O-N 2.78Å
20	V	96.2	Very high	92.6	Very high	86 Å²	86	95.9 Å²	95.9	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-63.2	-48.1	177.7	171.9	0	0	0	0	110.7	V16 T17 F18 F22 V23 V24	V16-V20 WeakPolarHBondContact O-CB 3.26Å; V16-V20 WeakPolarHBondContact O-CG2 3.29Å; V16-V20 PolarHBondContact O-N 3.07Å; T17-V20 PolarHBondContact O-N 3.06Å; F18-V20 VanDerWaalsContact C-N 3.31Å; F18-V20 PolarHBondContact O-N 3.4Å; V20-F22 VanDerWaalsContact C-N 3.3Å; V20-F22 PolarHBondContact O-N 2.94Å; V20-V23 PolarHBondContact O-N 3.48Å; V20-V24 HydrophobicContact CG1-CG2 4.46Å; V20-V24 VanDerWaalsContact O-CG2 3.3Å; V20-V24 WeakPolarHBondContact O-CG2 3.45Å; V20-V24 PolarHBondContact O-N 3.41Å
21	A	95.8	Very high	92.7	Very high	63 Å²	63	93.2 Å²	93.2	52%	0.521	52%	0.515	S	S	.	.	H	α-helix	trans	-62.4	-38.6	177.7	0	0	0	0	0	111.9	T17 F18 V24 G25	T17-A21 WeakPolarHBondContact O-CB 3.47Å; T17-A21 PolarHBondContact O-N 3.3Å; F18-A21 PolarHBondContact O-N 3.38Å; A21-V24 PolarHBondContact O-N 3.37Å; A21-G25 PolarHBondContact O-N 2.84Å
22	F	96.7	Very high	92.5	Very high	137 Å²	137	93.8 Å²	93.8	60%	0.601	51%	0.512	S	S	*	.	H	α-helix	trans	-62.4	-46.8	175.8	-179.5	-97.7	0	0	0	111.9	F18 P19 V20 G25 A26	F18-F22 WeakPolarHBondContact O-CB 3.4Å; F18-F22 PolarHBondContact O-N 3.41Å; P19-F22 PolarHBondContact O-N 3.42Å; V20-F22 VanDerWaalsContact C-N 3.3Å; V20-F22 PolarHBondContact O-N 2.94Å; F22-G25 PolarHBondContact O-N 3.03Å; F22-A26 WeakPolarHBondContact O-CB 3.49Å; F22-A26 PolarHBondContact O-N 3.18Å
23	V	97.1	Very high	92.1	Very high	86 Å²	86	93 Å²	93	52%	0.521	51%	0.508	S	S	.	.	H	α-helix	trans	-63.1	-45.8	177.5	172.5	0	0	0	0	110.9	P19 V20 G25 A26 V27	P19-V23 VanDerWaalsContact O-CG2 3.32Å; P19-V23 WeakPolarHBondContact O-CG2 3.37Å; P19-V23 PolarHBondContact O-N 2.78Å; V20-V23 PolarHBondContact O-N 3.48Å; V23-G25 VanDerWaalsContact C-N 3.31Å; V23-G25 PolarHBondContact O-N 2.69Å; V23-A26 PolarHBondContact O-N 3.38Å; V23-V27 HydrophobicContact CG1-CG2 4.43Å; V23-V27 VanDerWaalsContact O-CG2 3.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.39Å; V23-V27 PolarHBondContact O-N 3.41Å
24	V	96.7	Very high	91.9	Very high	97 Å²	97	99.3 Å²	99.3	59%	0.588	53%	0.529	S	S	*	.	H	α-helix	trans	-61.3	-41.9	176.8	172.2	0	0	0	0	110.9	V20 A21 V27 G28	V20-V24 HydrophobicContact CG1-CG2 4.46Å; V20-V24 VanDerWaalsContact O-CG2 3.3Å; V20-V24 WeakPolarHBondContact O-CG2 3.45Å; V20-V24 PolarHBondContact O-N 3.41Å; A21-V24 PolarHBondContact O-N 3.37Å; V24-V27 PolarHBondContact O-N 3.44Å; V24-G28 PolarHBondContact O-N 2.96Å
25	G	95.3	Very high	91.5	Very high	43 Å²	43	102 Å²	102	44%	0.443	54%	0.538	S	S	.	.	H	α-helix	trans	-63.7	-43.5	176.1	0	0	0	0	0	112.6	A21 F22 V23 G28 Y29	A21-G25 PolarHBondContact O-N 2.84Å; F22-G25 PolarHBondContact O-N 3.03Å; V23-G25 VanDerWaalsContact C-N 3.31Å; V23-G25 PolarHBondContact O-N 2.69Å; G25-G28 PolarHBondContact O-N 3.27Å; G25-Y29 VanDerWaalsContact O-CB 3.32Å; G25-Y29 WeakPolarHBondContact O-CB 3.41Å; G25-Y29 PolarHBondContact O-N 3.38Å
26	A	95.3	Very high	90.6	Very high	38 Å²	38	101.8 Å²	101.8	31%	0.314	54%	0.536	S	S	.	.	H	α-helix	trans	-63.6	-46.1	176.8	0	0	0	0	0	111.7	F22 V23 Y29 H30	F22-A26 WeakPolarHBondContact O-CB 3.49Å; F22-A26 PolarHBondContact O-N 3.18Å; V23-A26 PolarHBondContact O-N 3.38Å; A26-Y29 PolarHBondContact O-N 3.45Å; A26-H30 PolarHBondContact O-CD2 3.17Å; A26-H30 PolarHBondContact O-N 2.91Å
27	V	95.6	Very high	89.7	Confident	90 Å²	90	98.9 Å²	98.9	55%	0.545	53%	0.526	S	S	.	.	H	α-helix	trans	-63.8	-43.6	176	174	0	0	0	0	110.8	V23 V24 Y29 H30 L31	V23-V27 HydrophobicContact CG1-CG2 4.43Å; V23-V27 VanDerWaalsContact O-CG2 3.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.39Å; V23-V27 PolarHBondContact O-N 3.41Å; V24-V27 PolarHBondContact O-N 3.44Å; V27-Y29 VanDerWaalsContact C-N 3.34Å; V27-Y29 PolarHBondContact O-N 2.81Å; V27-H30 PolarHBondContact O-N 3.46Å; V27-L31 WeakPolarHBondContact O-CB 3.49Å; V27-L31 PolarHBondContact O-N 3.02Å
28	G	92.4	Very high	88.5	Confident	35 Å²	35	100.5 Å²	100.5	36%	0.361	54%	0.536	S	S	.	.	H	α-helix	trans	-60.2	-42.8	176.2	0	0	0	0	0	112.2	V24 G25 L31 E32	V24-G28 PolarHBondContact O-N 2.96Å; G25-G28 PolarHBondContact O-N 3.27Å; G28-L31 PolarHBondContact O-N 3.14Å; G28-E32 WeakPolarHBondContact O-CB 3.44Å; G28-E32 PolarHBondContact O-N 3.29Å
29	Y	88.7	Confident	87	Confident	147 Å²	147	97 Å²	97	58%	0.576	53%	0.528	S	S	*	.	H	α-helix	trans	-62.1	-43.9	175.3	177.4	-101.1	0	0	0	111.9	G25 A26 V27 E32 W33	G25-Y29 VanDerWaalsContact O-CB 3.32Å; G25-Y29 WeakPolarHBondContact O-CB 3.41Å; G25-Y29 PolarHBondContact O-N 3.38Å; A26-Y29 PolarHBondContact O-N 3.45Å; V27-Y29 VanDerWaalsContact C-N 3.34Å; V27-Y29 PolarHBondContact O-N 2.81Å; Y29-E32 PolarHBondContact O-N 2.85Å; Y29-W33 VanDerWaalsContact O-CB 3.31Å; Y29-W33 WeakPolarHBondContact O-CB 3.22Å; Y29-W33 PolarHBondContact O-N 2.91Å
30	H	88.5	Confident	85.2	Confident	123 Å²	123	102.4 Å²	102.4	57%	0.569	55%	0.545	S	S	*	.	H	α-helix	trans	-66.1	-38.9	175.8	-78.7	-64.1	0	0	0	112.7	A26 V27 W33 F34	A26-H30 PolarHBondContact O-CD2 3.17Å; A26-H30 PolarHBondContact O-N 2.91Å; V27-H30 PolarHBondContact O-N 3.46Å; H30-W33 PolarHBondContact O-N 2.94Å; H30-F34 WeakPolarHBondContact O-CB 3.44Å; H30-F34 PolarHBondContact O-N 3.35Å
31	L	88.9	Confident	83.4	Confident	105 Å²	105	101.2 Å²	101.2	55%	0.55	54%	0.539	S	S	.	.	H	α-helix	trans	-68.2	-42.4	176.3	-162.4	99.3	0	0	0	111.4	V27 G28 W33 F34 I35	V27-L31 WeakPolarHBondContact O-CB 3.49Å; V27-L31 PolarHBondContact O-N 3.02Å; G28-L31 PolarHBondContact O-N 3.14Å; L31-W33 VanDerWaalsContact C-N 3.3Å; L31-W33 PolarHBondContact O-N 3.39Å; L31-F34 PolarHBondContact O-N 2.92Å; L31-I35 HydrophobicContact CD2-CD1 3.75Å; L31-I35 HydrophobicContact CG-CD1 3.95Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.46Å; L31-I35 PolarHBondContact O-N 2.94Å
32	E	83.9	Confident	81.5	Confident	91 Å²	91	108.8 Å²	108.8	43%	0.425	55%	0.554	S	S	.	*	H	α-helix	trans	-59.6	-43.2	173.7	-178.9	-179	172.7	0	0	110.5	G28 Y29 I35 R36	G28-E32 WeakPolarHBondContact O-CB 3.44Å; G28-E32 PolarHBondContact O-N 3.29Å; Y29-E32 PolarHBondContact O-N 2.85Å; E32-I35 PolarHBondContact O-N 2.99Å; E32-R36 WeakPolarHBondContact O-CB 3.18Å; E32-R36 PolarHBondContact O-N 2.99Å; E32-R36 IonicContact OE1-CZ 3.52Å; E32-R36 IonicContact OE1-NE 3.81Å; E32-R36 IonicContact OE1-NH1 2.69Å; E32-R36 IonicContact OE1-NH2 3.09Å; E32-R36 PolarHBondContact OE1-NH2 3.27Å
33	W	79.8	Confident	79.5	Confident	133 Å²	133	110.6 Å²	110.6	50%	0.504	56%	0.564	S	S	.	*	H	α-helix	trans	-64.4	-40	175.4	-170.5	80.8	0	0	0	112.2	Y29 H30 L31 G37	Y29-W33 VanDerWaalsContact O-CB 3.31Å; Y29-W33 WeakPolarHBondContact O-CB 3.22Å; Y29-W33 PolarHBondContact O-N 2.91Å; H30-W33 PolarHBondContact O-N 2.94Å; L31-W33 VanDerWaalsContact C-N 3.3Å; L31-W33 PolarHBondContact O-N 3.39Å; W33-G37 PolarHBondContact O-N 2.96Å
34	F	83.3	Confident	77.5	Confident	170 Å²	170	113.6 Å²	113.6	75%	0.746	57%	0.573	S	S	*	*	H	α-helix	trans	-65.3	-41.4	176.2	-173.2	-100.2	0	0	0	112.6	H30 L31	H30-F34 WeakPolarHBondContact O-CB 3.44Å; H30-F34 PolarHBondContact O-N 3.35Å; L31-F34 PolarHBondContact O-N 2.92Å
35	I	82.7	Confident	75.8	Confident	129 Å²	129	116.2 Å²	116.2	66%	0.662	58%	0.579	S	S	*	*	H	α-helix	trans	-78.5	-40	-178.9	-65	167.2	0	0	0	111.7	L31 E32 G37	L31-I35 HydrophobicContact CD2-CD1 3.75Å; L31-I35 HydrophobicContact CG-CD1 3.95Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.46Å; L31-I35 PolarHBondContact O-N 2.94Å; E32-I35 PolarHBondContact O-N 2.99Å; I35-G37 PolarHBondContact O-N 3.38Å
36	R	73.4	Confident	74.7	Confident	171 Å²	171	118.6 Å²	118.6	65%	0.645	58%	0.577	S	S	*	*	H	α-helix	trans	-69.4	-17.5	-179	-169.4	172.8	-58.7	-128	-6.5	112.4	E32	E32-R36 WeakPolarHBondContact O-CB 3.18Å; E32-R36 PolarHBondContact O-N 2.99Å; E32-R36 IonicContact OE1-CZ 3.52Å; E32-R36 IonicContact OE1-NE 3.81Å; E32-R36 IonicContact OE1-NH1 2.69Å; E32-R36 IonicContact OE1-NH2 3.09Å; E32-R36 PolarHBondContact OE1-NH2 3.27Å
37	G	71.1	Confident	74	Confident	34 Å²	34	119.4 Å²	119.4	35%	0.351	58%	0.58	S	S	.	*			trans	67.9	177.2	-169.9	0	0	0	0	0	111.1	W33 I35 P39	W33-G37 PolarHBondContact O-N 2.96Å; I35-G37 PolarHBondContact O-N 3.38Å; G37-P39 WeakPolarHBondContact O-CD 3.31Å
38	T	67.4	Low	73.3	Confident	120 Å²	120	120.6 Å²	120.6	74%	0.736	58%	0.582	S	S	*	*	S	Bend	trans	-52.2	113.4	173.8	41.4	0	0	0	0	108.6	K40	T38-K40 PolarHBondContact O-N 3.19Å; T38-K40 VanDerWaalsContact O-N 3.1Å
39	P	62.9	Low	73	Confident	77 Å²	77	124.2 Å²	124.2	50%	0.5	59%	0.593	S	S	.	*	P	Polyproline II helix	trans	-55.4	127.1	170.8	23.4	-30.5	0	0	0	105.6	G37 P41	G37-P39 WeakPolarHBondContact O-CD 3.31Å; P39-P41 WeakPolarHBondContact O-CD 3.31Å
40	K	57.8	Low	72.7	Confident	176 Å²	176	122.2 Å²	122.2	77%	0.765	59%	0.589	S	S	*	*	P	Polyproline II helix	trans	-49.2	122.2	169.5	-84.3	-175.7	175.3	180	0	105.9	T38 R42	T38-K40 PolarHBondContact O-N 3.19Å; T38-K40 VanDerWaalsContact O-N 3.1Å; K40-R42 PolarHBondContact O-N 3.02Å
41	P	58.8	Low	72.6	Confident	61 Å²	61	119.9 Å²	119.9	40%	0.396	58%	0.58	S	S	.	*	P	Polyproline II helix	trans	-54.5	122.3	-179.6	20.8	-29.9	0	0	0	106.2	P39 E43 E44	P39-P41 WeakPolarHBondContact O-CD 3.31Å; P41-E43 HydrophobicContact CB-CB 4.22Å; P41-E43 HydrophobicContact CB-CG 4.39Å; P41-E43 PolarHBondContact O-N 3.35Å; P41-E44 HydrophobicContact CG-CG 4.26Å; P41-E44 PolarHBondContact O-N 2.92Å
42	R	55.2	Low	72.5	Confident	221 Å²	221	121.4 Å²	121.4	83%	0.834	58%	0.578	S	S	*	*	G	3₁₀ helix	trans	-56.8	-14.2	175.9	-132	177.9	-173.6	160.5	0.4	111.6	K40 E44 E45	K40-R42 PolarHBondContact O-N 3.02Å; R42-E44 PolarHBondContact O-N 3.29Å; R42-E45 PolarHBondContact O-N 3.1Å
43	E	54.1	Low	72.6	Confident	176 Å²	176	122.8 Å²	122.8	82%	0.822	59%	0.585	S	S	*	*	G	3₁₀ helix	trans	-61	-22.9	172.2	-54.9	-176.1	164.9	0	0	113.7	P41	P41-E43 HydrophobicContact CB-CB 4.22Å; P41-E43 HydrophobicContact CB-CG 4.39Å; P41-E43 PolarHBondContact O-N 3.35Å
44	E	56.1	Low	73	Confident	149 Å²	149	119.8 Å²	119.8	70%	0.696	58%	0.576	S	S	*	*	G	3₁₀ helix	trans	-86.4	-16.6	176.5	-71.2	-176.9	-173.6	0	0	113.5	P41 R42 K46	P41-E44 HydrophobicContact CG-CG 4.26Å; P41-E44 PolarHBondContact O-N 2.92Å; R42-E44 PolarHBondContact O-N 3.29Å; E44-K46 PolarHBondContact O-N 3.28Å
45	E	61.5	Low	73.2	Confident	152 Å²	152	118.2 Å²	118.2	71%	0.71	57%	0.566	S	S	*	*	S	Bend	trans	-82.9	71.9	172.1	-67.9	-174.1	-179.7	0	0	108.5	R42 S47	R42-E45 PolarHBondContact O-N 3.1Å; E45-S47 PolarHBondContact O-N 2.88Å
46	K	71.4	Confident	73.4	Confident	93 Å²	93	118.1 Å²	118.1	40%	0.404	56%	0.56	S	S	.	*			trans	-41.5	127.9	171.1	-75.3	179.7	175.1	175.3	0	108.9	E44 E50 L51 E54	E44-K46 PolarHBondContact O-N 3.28Å; K46-E50 WeakPolarHBondContact CA-OE2 3.32Å; K46-E50 HydrophobicContact CB-CB 4.34Å; K46-L51 HydrophobicContact CB-CD1 4.45Å; K46-L51 HydrophobicContact CB-CD2 3.82Å; K46-L51 HydrophobicContact CB-CG 3.76Å; K46-L51 HydrophobicContact CD-CD2 3.89Å; K46-E54 WeakPolarHBondContact CD-OE2 3.01Å; K46-E54 IonicContact NZ-OE1 2.58Å; K46-E54 PolarHBondContact NZ-OE1 3.27Å; K46-E54 IonicContact NZ-OE2 2.78Å; K46-E54 PolarHBondContact NZ-OE2 3.43Å
47	S	79.6	Confident	73.9	Confident	55 Å²	55	115.1 Å²	115.1	39%	0.385	56%	0.556	S	S	.	*			trans	-54.9	148.1	177.9	170.1	0	0	0	0	109.5	E45 L49 E50 L51	E45-S47 PolarHBondContact O-N 2.88Å; S47-L49 PolarHBondContact O-N 3.21Å; S47-L49 PolarHBondContact OG-N 2.81Å; S47-E50 PolarHBondContact N-OE2 3.31Å; S47-E50 WeakPolarHBondContact O-CA 3.22Å; S47-E50 WeakPolarHBondContact O-CB 3.42Å; S47-E50 PolarHBondContact O-N 3.47Å; S47-L51 PolarHBondContact O-N 2.91Å
48	I	81.3	Confident	74.7	Confident	114 Å²	114	119.5 Å²	119.5	59%	0.585	57%	0.568	S	S	*	*	H	α-helix	trans	-54	-30.1	175.9	-62.2	172.4	0	0	0	110.9	R52	I48-R52 WeakPolarHBondContact O-CD 3.4Å; I48-R52 WeakPolarHBondContact O-CG 3.31Å; I48-R52 PolarHBondContact O-N 3.46Å; I48-R52 VanDerWaalsContact O-N 3.17Å
49	L	85.8	Confident	75.3	Confident	111 Å²	111	120.7 Å²	120.7	58%	0.581	57%	0.565	S	S	*	*	H	α-helix	trans	-68.2	-48.5	173.9	-66.8	176.3	0	0	0	111.9	S47 L51 R52 E53	S47-L49 PolarHBondContact O-N 3.21Å; S47-L49 PolarHBondContact OG-N 2.81Å; L49-L51 VanDerWaalsContact C-N 3.31Å; L49-L51 PolarHBondContact O-N 3.41Å; L49-R52 WeakPolarHBondContact O-CB 3.32Å; L49-R52 PolarHBondContact O-N 3.12Å; L49-E53 WeakPolarHBondContact O-CG 3.14Å; L49-E53 PolarHBondContact O-N 2.81Å
50	E	83.1	Confident	76	Confident	106 Å²	106	123.1 Å²	123.1	50%	0.495	57%	0.57	S	S	.	*	H	α-helix	trans	-60.3	-41.3	177.4	-66.4	169	175.4	0	0	111.3	K46 S47 R52 E53 E54	K46-E50 WeakPolarHBondContact CA-OE2 3.32Å; K46-E50 HydrophobicContact CB-CB 4.34Å; S47-E50 PolarHBondContact N-OE2 3.31Å; S47-E50 WeakPolarHBondContact O-CA 3.22Å; S47-E50 WeakPolarHBondContact O-CB 3.42Å; S47-E50 PolarHBondContact O-N 3.47Å; E50-R52 VanDerWaalsContact C-N 3.28Å; E50-R52 PolarHBondContact O-N 3Å; E50-E53 PolarHBondContact O-N 2.85Å; E50-E54 WeakPolarHBondContact O-CB 3.2Å; E50-E54 PolarHBondContact O-N 3.38Å
51	L	85.8	Confident	76.9	Confident	74 Å²	74	120.6 Å²	120.6	39%	0.387	57%	0.568	S	S	.	*	H	α-helix	trans	-65.5	-27.5	174.5	-70.9	173	0	0	0	113.6	K46 S47 L49 R55	K46-L51 HydrophobicContact CB-CD1 4.45Å; K46-L51 HydrophobicContact CB-CD2 3.82Å; K46-L51 HydrophobicContact CB-CG 3.76Å; K46-L51 HydrophobicContact CD-CD2 3.89Å; S47-L51 PolarHBondContact O-N 2.91Å; L49-L51 VanDerWaalsContact C-N 3.31Å; L49-L51 PolarHBondContact O-N 3.41Å; L51-R55 WeakPolarHBondContact O-CG 3.2Å; L51-R55 PolarHBondContact O-N 2.77Å; L51-R55 PolarHBondContact O-NE 2.88Å; L51-R55 VanDerWaalsContact O-NE 3.14Å
52	R	86.6	Confident	77.5	Confident	137 Å²	137	121.6 Å²	121.6	52%	0.517	59%	0.59	S	S	.	*	H	α-helix	trans	-78.4	-41.3	174.8	-75.3	168.3	-173.2	-166.7	3.8	110.7	I48 L49 E50 R55 K56	I48-R52 WeakPolarHBondContact O-CD 3.4Å; I48-R52 WeakPolarHBondContact O-CG 3.31Å; I48-R52 PolarHBondContact O-N 3.46Å; I48-R52 VanDerWaalsContact O-N 3.17Å; L49-R52 WeakPolarHBondContact O-CB 3.32Å; L49-R52 PolarHBondContact O-N 3.12Å; E50-R52 VanDerWaalsContact C-N 3.28Å; E50-R52 PolarHBondContact O-N 3Å; R52-R55 PolarHBondContact O-N 2.58Å; R52-K56 WeakPolarHBondContact O-CG 3.3Å; R52-K56 PolarHBondContact O-N 3.29Å
53	E	87	Confident	78.3	Confident	120 Å²	120	116 Å²	116	56%	0.561	58%	0.58	S	S	*	*	H	α-helix	trans	-65.6	-42.1	177	-71.7	179.9	178	0	0	111.3	L49 E50 R55 K56 L57	L49-E53 WeakPolarHBondContact O-CG 3.14Å; L49-E53 PolarHBondContact O-N 2.81Å; E50-E53 PolarHBondContact O-N 2.85Å; E53-R55 VanDerWaalsContact C-N 3.33Å; E53-R55 PolarHBondContact O-N 3.43Å; E53-K56 WeakPolarHBondContact O-CB 3.36Å; E53-K56 PolarHBondContact O-N 3.35Å; E53-L57 WeakPolarHBondContact O-CB 3.45Å; E53-L57 WeakPolarHBondContact O-CG 3.5Å; E53-L57 PolarHBondContact O-N 2.82Å
54	E	88.8	Confident	79.1	Confident	69 Å²	69	111.8 Å²	111.8	32%	0.322	56%	0.564	S	S	.	*	H	α-helix	trans	-61.7	-39.7	175.4	-171.3	171.1	-154.3	0	0	112.1	K46 E50 L57 Q58	K46-E54 WeakPolarHBondContact CD-OE2 3.01Å; K46-E54 IonicContact NZ-OE1 2.58Å; K46-E54 PolarHBondContact NZ-OE1 3.27Å; K46-E54 IonicContact NZ-OE2 2.78Å; K46-E54 PolarHBondContact NZ-OE2 3.43Å; E50-E54 WeakPolarHBondContact O-CB 3.2Å; E50-E54 PolarHBondContact O-N 3.38Å; E54-L57 PolarHBondContact O-N 3.47Å; E54-Q58 WeakPolarHBondContact O-CB 3.2Å; E54-Q58 WeakPolarHBondContact O-CG 3.46Å; E54-Q58 PolarHBondContact O-N 3.5Å
55	R	87.6	Confident	79.6	Confident	138 Å²	138	108 Å²	108	52%	0.521	57%	0.565	S	S	.	*	H	α-helix	trans	-63.7	-44.5	172.5	-80.1	-176.1	-72.4	167.8	-6.1	112.5	L51 R52 E53 L57 Q58 E59	L51-R55 WeakPolarHBondContact O-CG 3.2Å; L51-R55 PolarHBondContact O-N 2.77Å; L51-R55 PolarHBondContact O-NE 2.88Å; L51-R55 VanDerWaalsContact O-NE 3.14Å; R52-R55 PolarHBondContact O-N 2.58Å; E53-R55 VanDerWaalsContact C-N 3.33Å; E53-R55 PolarHBondContact O-N 3.43Å; R55-L57 VanDerWaalsContact C-N 3.3Å; R55-L57 PolarHBondContact O-N 2.92Å; R55-Q58 PolarHBondContact O-N 2.85Å; R55-E59 WeakPolarHBondContact O-CG 3.12Å; R55-E59 PolarHBondContact O-N 2.94Å
56	K	85.4	Confident	79.8	Confident	127 Å²	127	106.1 Å²	106.1	55%	0.552	56%	0.564	S	S	*	*	H	α-helix	trans	-62.3	-38.9	175.5	-72.8	178.1	179.2	-176.5	0	112.1	R52 E53 E59 Q60	R52-K56 WeakPolarHBondContact O-CG 3.3Å; R52-K56 PolarHBondContact O-N 3.29Å; E53-K56 WeakPolarHBondContact O-CB 3.36Å; E53-K56 PolarHBondContact O-N 3.35Å; K56-E59 PolarHBondContact O-N 3.47Å; K56-Q60 WeakPolarHBondContact O-CB 3.35Å; K56-Q60 VanDerWaalsContact O-CG 3.26Å; K56-Q60 WeakPolarHBondContact O-CG 3.49Å; K56-Q60 PolarHBondContact O-N 3.42Å
57	L	85.4	Confident	79.5	Confident	107 Å²	107	109.3 Å²	109.3	56%	0.56	58%	0.58	S	S	*	*	H	α-helix	trans	-63.8	-47.3	175	-80.9	158.2	0	0	0	110.4	E53 E54 R55 E59 Q60 V61	E53-L57 WeakPolarHBondContact O-CB 3.45Å; E53-L57 WeakPolarHBondContact O-CG 3.5Å; E53-L57 PolarHBondContact O-N 2.82Å; E54-L57 PolarHBondContact O-N 3.47Å; R55-L57 VanDerWaalsContact C-N 3.3Å; R55-L57 PolarHBondContact O-N 2.92Å; L57-E59 VanDerWaalsContact C-N 3.33Å; L57-E59 PolarHBondContact O-N 3.31Å; L57-Q60 CarbonylContact O-C 3.56Å; L57-Q60 PolarHBondContact O-N 2.82Å; L57-V61 VanDerWaalsContact O-CG2 3.27Å; L57-V61 WeakPolarHBondContact O-CG2 3.02Å; L57-V61 PolarHBondContact O-N 2.97Å
58	Q	87.1	Confident	78.8	Confident	127 Å²	127	112.3 Å²	112.3	59%	0.593	60%	0.596	S	S	*	*	H	α-helix	trans	-60.2	-39.8	176.2	-75.9	178.4	-0.7	0	0	113	E54 R55 Q60 V61	E54-Q58 WeakPolarHBondContact O-CB 3.2Å; E54-Q58 WeakPolarHBondContact O-CG 3.46Å; E54-Q58 PolarHBondContact O-N 3.5Å; R55-Q58 PolarHBondContact O-N 2.85Å; Q58-Q60 VanDerWaalsContact C-N 3.28Å; Q58-Q60 PolarHBondContact O-N 3.3Å; Q58-V61 PolarHBondContact O-N 3.35Å
59	E	80.6	Confident	78	Confident	144 Å²	144	111.9 Å²	111.9	67%	0.673	59%	0.594	S	S	*	*	H	α-helix	trans	-66.2	-30.2	174.5	-71.4	169.8	-172.3	0	0	112.6	R55 K56 L57 T63	R55-E59 WeakPolarHBondContact O-CG 3.12Å; R55-E59 PolarHBondContact O-N 2.94Å; K56-E59 PolarHBondContact O-N 3.47Å; L57-E59 VanDerWaalsContact C-N 3.33Å; L57-E59 PolarHBondContact O-N 3.31Å; E59-T63 PolarHBondContact O-OG1 3.38Å
60	Q	76.6	Confident	77	Confident	129 Å²	129	110 Å²	110	60%	0.603	59%	0.59	S	S	*	*	H	α-helix	trans	-81.9	-22.6	176.1	-72.9	172.9	29.4	0	0	113.2	K56 L57 Q58 G62 T63	K56-Q60 WeakPolarHBondContact O-CB 3.35Å; K56-Q60 VanDerWaalsContact O-CG 3.26Å; K56-Q60 WeakPolarHBondContact O-CG 3.49Å; K56-Q60 PolarHBondContact O-N 3.42Å; L57-Q60 CarbonylContact O-C 3.56Å; L57-Q60 PolarHBondContact O-N 2.82Å; Q58-Q60 VanDerWaalsContact C-N 3.28Å; Q58-Q60 PolarHBondContact O-N 3.3Å; Q60-G62 PolarHBondContact O-N 2.87Å; Q60-T63 PolarHBondContact O-N 3.31Å; Q60-T63 VanDerWaalsContact O-N 3.08Å
61	V	77.4	Confident	76.1	Confident	122 Å²	122	111.6 Å²	111.6	74%	0.739	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	95.9	174.2	172.9	0	0	0	0	108.6	L57 Q58	L57-V61 VanDerWaalsContact O-CG2 3.27Å; L57-V61 WeakPolarHBondContact O-CG2 3.02Å; L57-V61 PolarHBondContact O-N 2.97Å; Q58-V61 PolarHBondContact O-N 3.35Å
62	G	71	Confident	74.9	Confident	83 Å²	83	116.1 Å²	116.1	86%	0.856	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	119.9	-8.1	-178.5	0	0	0	0	0	114.3	Q60	Q60-G62 PolarHBondContact O-N 2.87Å
63	T	71.9	Confident	73.7	Confident	102 Å²	102	114.3 Å²	114.3	63%	0.626	62%	0.615	S	S	*	*			trans	-94.3	118.5	170.5	-48.7	0	0	0	0	109	E59 Q60 G65	E59-T63 PolarHBondContact O-OG1 3.38Å; Q60-T63 PolarHBondContact O-N 3.31Å; Q60-T63 VanDerWaalsContact O-N 3.08Å; T63-G65 PolarHBondContact O-N 2.84Å; T63-G65 VanDerWaalsContact O-N 3.13Å
64	D	70.6	Confident	72.4	Confident	89 Å²	89	114 Å²	114	48%	0.476	61%	0.612	S	S	.	*			trans	-73.9	103.1	178.5	-164.7	-10.1	0	0	0	110	T66 Q67	D64-T66 VanDerWaalsContact CG-OG1 3.31Å; D64-T66 PolarHBondContact O-N 3.48Å; D64-T66 PolarHBondContact OD1-N 2.82Å; D64-T66 PolarHBondContact OD1-OG1 3.07Å; D64-T66 PolarHBondContact OD2-OG1 3.37Å; D64-Q67 HydrophobicContact CB-CG 4.18Å; D64-Q67 PolarHBondContact O-N 3.33Å
65	G	66.4	Low	71	Confident	69 Å²	69	117 Å²	117	71%	0.711	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	-5.2	-177.9	0	0	0	0	0	114.6	T63	T63-G65 PolarHBondContact O-N 2.84Å; T63-G65 VanDerWaalsContact O-N 3.13Å
66	T	66.4	Low	69.7	Low	112 Å²	112	118.2 Å²	118.2	69%	0.687	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.1	-13.2	175.5	66.2	0	0	0	0	113.3	D64 V68	D64-T66 VanDerWaalsContact CG-OG1 3.31Å; D64-T66 PolarHBondContact O-N 3.48Å; D64-T66 PolarHBondContact OD1-N 2.82Å; D64-T66 PolarHBondContact OD1-OG1 3.07Å; D64-T66 PolarHBondContact OD2-OG1 3.37Å; T66-V68 PolarHBondContact O-N 3.38Å
67	Q	64.4	Low	68.4	Low	160 Å²	160	120.2 Å²	120.2	75%	0.748	65%	0.65	S	S	*	*			trans	-84.3	57.5	174	-66.2	-173.5	9.2	0	0	111.6	D64	D64-Q67 HydrophobicContact CB-CG 4.18Å; D64-Q67 PolarHBondContact O-N 3.33Å
68	V	65.5	Low	67.4	Low	119 Å²	119	119.4 Å²	119.4	72%	0.721	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-90.9	127.6	167.8	-86.9	0	0	0	0	109	T66 S70	T66-V68 PolarHBondContact O-N 3.38Å; V68-S70 PolarHBondContact O-N 3.21Å
69	L	64.6	Low	66.3	Low	105 Å²	105	118.7 Å²	118.7	55%	0.55	66%	0.657	S	S	.	*	P	Polyproline II helix	trans	-50.6	131	169.9	-68	173.1	0	0	0	108.8	L71	L69-L71 PolarHBondContact O-N 3.07Å
70	S	63.9	Low	65.6	Low	71 Å²	71	120.7 Å²	120.7	50%	0.497	66%	0.663	S	S	.	*	P	Polyproline II helix	trans	-52.3	130.1	-178.2	177.6	0	0	0	0	109.5	V68 K72 E73 K74	V68-S70 PolarHBondContact O-N 3.21Å; S70-K72 PolarHBondContact O-N 3.09Å; S70-K72 WeakPolarHBondContact OG-CB 3.36Å; S70-K72 PolarHBondContact OG-N 3.21Å; S70-E73 WeakPolarHBondContact O-CB 3.16Å; S70-E73 PolarHBondContact O-N 2.93Å; S70-K74 PolarHBondContact O-N 3.16Å
71	L	64.7	Low	65.2	Low	139 Å²	139	117.4 Å²	117.4	73%	0.728	66%	0.658	S	S	*	*	H	α-helix	trans	-56.1	-20.9	177.5	-68.2	172.4	0	0	0	112.3	L69 L75	L69-L71 PolarHBondContact O-N 3.07Å; L71-L75 PolarHBondContact O-N 2.82Å
72	K	60.8	Low	64.4	Low	169 Å²	169	115.9 Å²	115.9	74%	0.735	66%	0.658	S	S	*	*	H	α-helix	trans	-66.2	-39.2	173	-127.3	172	-177.8	-76.7	0	112.5	S70 L75	S70-K72 PolarHBondContact O-N 3.09Å; S70-K72 WeakPolarHBondContact OG-CB 3.36Å; S70-K72 PolarHBondContact OG-N 3.21Å; K72-L75 WeakPolarHBondContact O-CB 3.41Å; K72-L75 PolarHBondContact O-N 2.88Å
73	E	62.5	Low	63.9	Low	99 Å²	99	119.3 Å²	119.3	46%	0.463	66%	0.656	S	S	.	*	H	α-helix	trans	-73.4	-38.4	178.8	-167	177.3	-172.5	0	0	111	S70 L75 E76 F77	S70-E73 WeakPolarHBondContact O-CB 3.16Å; S70-E73 PolarHBondContact O-N 2.93Å; E73-L75 VanDerWaalsContact C-N 3.25Å; E73-L75 PolarHBondContact O-N 3.36Å; E73-E76 PolarHBondContact O-N 3.13Å; E73-F77 WeakPolarHBondContact O-CD2 3.31Å
74	K	59.2	Low	63.4	Low	113 Å²	113	118.4 Å²	118.4	49%	0.491	65%	0.647	S	S	.	*	H	α-helix	trans	-68	-21.8	173.5	-73.1	-169.4	-178.4	-71.9	0	113.9	S70 E76 F77 T78	S70-K74 PolarHBondContact O-N 3.16Å; K74-E76 VanDerWaalsContact C-N 3.3Å; K74-F77 PolarHBondContact O-N 2.91Å; K74-T78 WeakPolarHBondContact O-CB 3.33Å; K74-T78 PolarHBondContact O-N 3.39Å; K74-T78 VanDerWaalsContact O-N 3.1Å; K74-T78 PolarHBondContact O-OG1 2.88Å
75	L	59	Low	63	Low	134 Å²	134	124.8 Å²	124.8	70%	0.702	66%	0.664	S	S	*	*	H	α-helix	trans	-71.4	-25.5	177.7	-123.3	133.5	0	0	0	112.5	L71 K72 E73	L71-L75 PolarHBondContact O-N 2.82Å; K72-L75 WeakPolarHBondContact O-CB 3.41Å; K72-L75 PolarHBondContact O-N 2.88Å; E73-L75 VanDerWaalsContact C-N 3.25Å; E73-L75 PolarHBondContact O-N 3.36Å
76	E	60.4	Low	62.9	Low	162 Å²	162	128.8 Å²	128.8	76%	0.757	67%	0.67	S	S	*	*	H	α-helix	trans	-75.2	-31.8	175.3	-65	-175.9	170.7	0	0	112	E73 K74	E73-E76 PolarHBondContact O-N 3.13Å; K74-E76 VanDerWaalsContact C-N 3.3Å
77	F	58.4	Low	62.7	Low	169 Å²	169	132.8 Å²	132.8	74%	0.741	67%	0.672	S	S	*	*	H	α-helix	trans	-99.4	-7.1	-176.1	-71.3	-80.7	0	0	0	115	E73 K74	E73-F77 WeakPolarHBondContact O-CD2 3.31Å; K74-F77 PolarHBondContact O-N 2.91Å
78	T	62.8	Low	62.6	Low	90 Å²	90	129.8 Å²	129.8	55%	0.552	67%	0.669	S	S	*	*	S	Bend	trans	-95.3	129.1	177.4	-51	0	0	0	0	110	K74 K80	K74-T78 WeakPolarHBondContact O-CB 3.33Å; K74-T78 PolarHBondContact O-N 3.39Å; K74-T78 VanDerWaalsContact O-N 3.1Å; K74-T78 PolarHBondContact O-OG1 2.88Å; T78-K80 PolarHBondContact O-N 2.89Å
79	P	64.1	Low	62.3	Low	113 Å²	113	133.1 Å²	133.1	73%	0.734	68%	0.676	S	S	*	*			trans	-57.5	132.2	174.2	23.2	-32	0	0	0	109.6	A81	P79-A81 PolarHBondContact O-N 2.93Å
80	K	65.9	Low	61.9	Low	186 Å²	186	137.5 Å²	137.5	81%	0.809	69%	0.691	S	S	*	*			trans	-46.2	114.1	-177.6	-73	-175.3	178.6	-178	0	109.4	T78 A82	T78-K80 PolarHBondContact O-N 2.89Å; K80-A82 PolarHBondContact O-N 3.19Å
81	A	68.3	Low	60.8	Low	59 Å²	59	143 Å²	143	49%	0.488	73%	0.73	S	S	.	*			trans	-51.6	140.7	179.3	0	0	0	0	0	110.2	P79 L83 N84	P79-A81 PolarHBondContact O-N 2.93Å; A81-L83 PolarHBondContact O-N 3.48Å; A81-N84 PolarHBondContact O-N 3.41Å
82	A	62.3	Low	60.6	Low	90 Å²	90	143.3 Å²	143.3	74%	0.744	73%	0.73	S	S	*	*	G	3₁₀ helix	trans	-53.1	-24.2	-176.9	0	0	0	0	0	113.6	K80 N84 R85	K80-A82 PolarHBondContact O-N 3.19Å; A82-N84 VanDerWaalsContact C-N 3.33Å; A82-N84 PolarHBondContact O-N 3.46Å; A82-R85 VanDerWaalsContact O-CB 3.29Å; A82-R85 WeakPolarHBondContact O-CB 3.48Å; A82-R85 PolarHBondContact O-N 3.36Å
83	L	58.7	Low	60.6	Low	155 Å²	155	141.9 Å²	141.9	81%	0.812	73%	0.73	S	S	*	*	G	3₁₀ helix	trans	-63.6	-31.6	174.5	-170.4	65	0	0	0	113.8	A81 R85	A81-L83 PolarHBondContact O-N 3.48Å; L83-R85 PolarHBondContact O-N 3.42Å
84	N	61.4	Low	60.5	Low	83 Å²	83	144.3 Å²	144.3	44%	0.444	74%	0.744	S	S	.	*	G	3₁₀ helix	trans	-76.5	-9.4	178.3	-75.3	-50.3	0	0	0	113.4	A81 A82 N86	A81-N84 PolarHBondContact O-N 3.41Å; A82-N84 VanDerWaalsContact C-N 3.33Å; A82-N84 PolarHBondContact O-N 3.46Å; N84-N86 VanDerWaalsContact C-N 3.27Å; N84-N86 PolarHBondContact O-N 3.29Å
85	R	62.8	Low	60.5	Low	223 Å²	223	146.1 Å²	146.1	84%	0.842	76%	0.759	S	S	*	*	G	3₁₀ helix	trans	-69	-25.1	179.2	-170	174.5	172.5	174.9	-2.2	113.1	A82 L83	A82-R85 VanDerWaalsContact O-CB 3.29Å; A82-R85 WeakPolarHBondContact O-CB 3.48Å; A82-R85 PolarHBondContact O-N 3.36Å; L83-R85 PolarHBondContact O-N 3.42Å
86	N	63.6	Low	60.6	Low	153 Å²	153	146.9 Å²	146.9	82%	0.818	76%	0.763	S	S	*	*	G	3₁₀ helix	trans	-103.5	2.8	-177.9	-78.2	-17.4	0	0	0	114	N84 S88	N84-N86 VanDerWaalsContact C-N 3.27Å; N84-N86 PolarHBondContact O-N 3.29Å; N86-S88 PolarHBondContact O-N 2.97Å
87	R	62.8	Low	60.7	Low	197 Å²	197	145.9 Å²	145.9	74%	0.743	76%	0.763	S	S	*	*			trans	-83.9	113.9	178.7	-150.1	174	-169.8	150.1	1.6	107.8	E89	R87-E89 PolarHBondContact O-N 2.95Å
88	S	62.8	Low	60.8	Low	97 Å²	97	144.2 Å²	144.2	68%	0.678	77%	0.765	S	S	*	*			trans	-63	129.9	172.9	54.6	0	0	0	0	109.3	N86 K90	N86-S88 PolarHBondContact O-N 2.97Å; S88-K90 PolarHBondContact O-N 3.24Å
89	E	59.5	Low	60.7	Low	188 Å²	188	148.4 Å²	148.4	88%	0.879	78%	0.781	S	S	*	*			trans	-62.3	108.8	168.5	-67.4	-174.6	168.3	0	0	106.9	R87 S91	R87-E89 PolarHBondContact O-N 2.95Å; E89-S91 PolarHBondContact O-N 3.28Å
90	K	55.7	Low	60.4	Low	198 Å²	198	151.3 Å²	151.3	86%	0.861	79%	0.785	S	S	*	*			trans	-73	125.2	168.7	-84.9	-173.8	174.8	-174.7	0	107.5	S88	S88-K90 PolarHBondContact O-N 3.24Å
91	S	40.8	Very low	59.9	Low	187 Å²	187	148.2 Å²	148.2	100%	1.308	78%	0.783	S	S	*	*			trans	-52.1	0	169.4	-176.3	0	0	0	0	113.3	E89	E89-S91 PolarHBondContact O-N 3.28Å

Retrieved 91 of 91 residues in 91.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).