A0A3B3U0Q4_9TELE Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A3B3U0Q4, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 70 aa.

						>A0A3B3U0Q4_9TELE|A0A3B3U0Q4
MSNNMAKIADARKTVEQLKLEVNIERMMISKAAAELMSYCESHAKEDPLVTPVASSENPFREKKLFCVIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.6	Low	83.2	Confident	225 Å²	225	108 Å²	108	100%	1.108	61%	0.608	S	S	*	*				0	-20.5	0	-66.5	-173.8	-176.7	0	0	114.2	N3	M1-N3 PolarHBondContact O-N 3.35Å
2	S	61.8	Low	84.4	Confident	104 Å²	104	113.4 Å²	113.4	73%	0.727	61%	0.612	S	S	*	*	H	α-helix	trans	-60.1	-39.1	179.2	179.2	0	0	0	0	115.5	N4 M5	S2-N4 VanDerWaalsContact C-N 3.29Å; S2-N4 PolarHBondContact O-N 3.43Å; S2-M5 PolarHBondContact O-N 3.48Å
3	N	74.4	Confident	85.4	Confident	122 Å²	122	116.9 Å²	116.9	65%	0.652	62%	0.618	S	S	*	*	H	α-helix	trans	-65.1	-21.6	-175.8	-98.1	1.9	0	0	0	116.1	M1 K7	M1-N3 PolarHBondContact O-N 3.35Å; N3-K7 WeakPolarHBondContact O-CG 3.35Å; N3-K7 PolarHBondContact O-N 3.16Å
4	N	81.6	Confident	86.2	Confident	109 Å²	109	114.2 Å²	114.2	58%	0.583	61%	0.608	S	S	*	*	H	α-helix	trans	-78.7	-33.5	-179.4	-80.8	3.7	0	0	0	112	S2 K7 I8	S2-N4 VanDerWaalsContact C-N 3.29Å; S2-N4 PolarHBondContact O-N 3.43Å; N4-K7 PolarHBondContact O-N 3.36Å; N4-I8 WeakPolarHBondContact O-CD1 3.47Å; N4-I8 WeakPolarHBondContact O-CG1 2.86Å; N4-I8 PolarHBondContact O-N 2.79Å
5	M	83.4	Confident	87	Confident	142 Å²	142	111.3 Å²	111.3	70%	0.7	60%	0.596	S	S	*	*	H	α-helix	trans	-70	-39.1	179.2	-68	-62.5	-100.4	0	0	111.8	S2 I8 A9	S2-M5 PolarHBondContact O-N 3.48Å; M5-I8 PolarHBondContact O-N 2.72Å; M5-I8 HydrophobicContact SD-CD1 4.44Å; M5-A9 PolarHBondContact O-N 3.03Å
6	A	88.1	Confident	87.7	Confident	52 Å²	52	110.8 Å²	110.8	43%	0.43	59%	0.589	S	S	.	*	H	α-helix	trans	-61.1	-48.2	173.7	0	0	0	0	0	111.6	I8 A9 D10	A6-I8 VanDerWaalsContact C-N 3.31Å; A6-I8 PolarHBondContact O-N 3.29Å; A6-A9 WeakPolarHBondContact O-CB 3.42Å; A6-A9 PolarHBondContact O-N 3.27Å; A6-A9 VanDerWaalsContact O-N 3.13Å; A6-D10 PolarHBondContact O-N 3.43Å
7	K	93.2	Very high	88.3	Confident	139 Å²	139	109.9 Å²	109.9	60%	0.604	58%	0.581	S	S	*	*	H	α-helix	trans	-60	-38.1	176.4	-74.5	178.9	175.7	-174.6	0	113.3	N3 N4 A11	N3-K7 WeakPolarHBondContact O-CG 3.35Å; N3-K7 PolarHBondContact O-N 3.16Å; N4-K7 PolarHBondContact O-N 3.36Å; K7-A11 WeakPolarHBondContact O-CB 3.48Å; K7-A11 PolarHBondContact O-N 3.06Å
8	I	93.7	Very high	88.9	Confident	83 Å²	83	109.1 Å²	109.1	43%	0.426	58%	0.576	S	S	.	*	H	α-helix	trans	-67.2	-41.2	176.6	-70.3	163.3	0	0	0	110.7	N4 M5 A6 A11 R12	N4-I8 WeakPolarHBondContact O-CD1 3.47Å; N4-I8 WeakPolarHBondContact O-CG1 2.86Å; N4-I8 PolarHBondContact O-N 2.79Å; M5-I8 PolarHBondContact O-N 2.72Å; M5-I8 HydrophobicContact SD-CD1 4.44Å; A6-I8 VanDerWaalsContact C-N 3.31Å; A6-I8 PolarHBondContact O-N 3.29Å; I8-A11 PolarHBondContact O-N 3.37Å; I8-R12 VanDerWaalsContact O-CG 3.28Å; I8-R12 WeakPolarHBondContact O-CG 3.34Å; I8-R12 PolarHBondContact O-N 3.26Å
9	A	94.4	Very high	89.3	Confident	57 Å²	57	109 Å²	109	47%	0.471	57%	0.57	S	S	.	*	H	α-helix	trans	-63.9	-43.9	177.2	0	0	0	0	0	111.6	M5 A6 R12 K13	M5-A9 PolarHBondContact O-N 3.03Å; A6-A9 WeakPolarHBondContact O-CB 3.42Å; A6-A9 PolarHBondContact O-N 3.27Å; A6-A9 VanDerWaalsContact O-N 3.13Å; A9-R12 PolarHBondContact O-N 2.99Å; A9-K13 PolarHBondContact O-N 3.42Å
10	D	95.9	Very high	89.8	Confident	101 Å²	101	109.6 Å²	109.6	54%	0.54	57%	0.573	S	S	.	*	H	α-helix	trans	-62.5	-46.8	176.2	-69	-24.6	0	0	0	111.5	A6 R12 K13 T14	A6-D10 PolarHBondContact O-N 3.43Å; D10-R12 VanDerWaalsContact C-N 3.29Å; D10-R12 PolarHBondContact O-N 3.34Å; D10-K13 WeakPolarHBondContact O-CB 3.45Å; D10-K13 PolarHBondContact O-N 3.43Å; D10-K13 VanDerWaalsContact O-N 3.1Å; D10-T14 PolarHBondContact O-N 3.02Å; D10-T14 PolarHBondContact O-OG1 3.32Å
11	A	96.5	Very high	90.1	Very high	54 Å²	54	108.1 Å²	108.1	45%	0.446	56%	0.564	S	S	.	*	H	α-helix	trans	-59.7	-40.1	177.7	0	0	0	0	0	112	K7 I8 T14 V15	K7-A11 WeakPolarHBondContact O-CB 3.48Å; K7-A11 PolarHBondContact O-N 3.06Å; I8-A11 PolarHBondContact O-N 3.37Å; A11-T14 PolarHBondContact O-N 3.49Å; A11-V15 WeakPolarHBondContact O-CG2 3.5Å; A11-V15 PolarHBondContact O-N 3.25Å
12	R	97	Very high	92.2	Very high	173 Å²	173	102 Å²	102	65%	0.653	54%	0.539	S	S	*	.	H	α-helix	trans	-62.8	-45.5	174.2	-74	173.2	-176.2	-84.6	0.2	111.3	I8 A9 D10 T14 V15 E16	I8-R12 VanDerWaalsContact O-CG 3.28Å; I8-R12 WeakPolarHBondContact O-CG 3.34Å; I8-R12 PolarHBondContact O-N 3.26Å; A9-R12 PolarHBondContact O-N 2.99Å; D10-R12 VanDerWaalsContact C-N 3.29Å; D10-R12 PolarHBondContact O-N 3.34Å; R12-T14 VanDerWaalsContact C-N 3.31Å; R12-T14 PolarHBondContact O-N 3.32Å; R12-V15 PolarHBondContact O-N 3.49Å; R12-E16 WeakPolarHBondContact O-CG 3.43Å; R12-E16 PolarHBondContact O-N 2.98Å
13	K	97.3	Very high	93.9	Very high	159 Å²	159	103.4 Å²	103.4	69%	0.691	54%	0.538	S	S	*	.	H	α-helix	trans	-58.5	-43.7	176.6	-174.2	-177	176.8	-175.6	0	111.5	A9 D10 E16 Q17	A9-K13 PolarHBondContact O-N 3.42Å; D10-K13 WeakPolarHBondContact O-CB 3.45Å; D10-K13 PolarHBondContact O-N 3.43Å; D10-K13 VanDerWaalsContact O-N 3.1Å; K13-E16 PolarHBondContact O-N 3.02Å; K13-Q17 PolarHBondContact O-N 3.27Å
14	T	97.5	Very high	95	Very high	79 Å²	79	102.4 Å²	102.4	49%	0.485	53%	0.532	S	S	.	.	H	α-helix	trans	-62.2	-43	175.4	-58.1	0	0	0	0	112	D10 A11 R12 E16 Q17 L18	D10-T14 PolarHBondContact O-N 3.02Å; D10-T14 PolarHBondContact O-OG1 3.32Å; A11-T14 PolarHBondContact O-N 3.49Å; R12-T14 VanDerWaalsContact C-N 3.31Å; R12-T14 PolarHBondContact O-N 3.32Å; T14-E16 PolarHBondContact O-N 3.35Å; T14-Q17 WeakPolarHBondContact O-CB 3.35Å; T14-Q17 PolarHBondContact O-N 2.95Å; T14-L18 HydrophobicContact CG2-CD1 4.08Å; T14-L18 HydrophobicContact CG2-CG 4.41Å; T14-L18 WeakPolarHBondContact O-CG 3.46Å; T14-L18 PolarHBondContact O-N 3.01Å
15	V	98.1	Very high	95.7	Very high	71 Å²	71	106.1 Å²	106.1	43%	0.43	55%	0.546	S	S	.	.	H	α-helix	trans	-62.6	-43.4	177.6	167.6	0	0	0	0	111.4	A11 R12 Q17 L18 K19	A11-V15 WeakPolarHBondContact O-CG2 3.5Å; A11-V15 PolarHBondContact O-N 3.25Å; R12-V15 PolarHBondContact O-N 3.49Å; V15-Q17 VanDerWaalsContact C-N 3.31Å; V15-Q17 PolarHBondContact O-N 3.46Å; V15-L18 PolarHBondContact O-N 2.96Å; V15-K19 HydrophobicContact CG1-CD 4.36Å; V15-K19 WeakPolarHBondContact O-CG 3.28Å; V15-K19 PolarHBondContact O-N 2.98Å
16	E	97.9	Very high	96.4	Very high	103 Å²	103	107.9 Å²	107.9	48%	0.481	55%	0.545	S	S	.	.	H	α-helix	trans	-63.1	-38.5	176.2	-64.8	-47.6	127.2	0	0	111.9	R12 K13 T14 K19 L20	R12-E16 WeakPolarHBondContact O-CG 3.43Å; R12-E16 PolarHBondContact O-N 2.98Å; K13-E16 PolarHBondContact O-N 3.02Å; T14-E16 PolarHBondContact O-N 3.35Å; E16-K19 PolarHBondContact O-N 3.1Å; E16-K19 IonicContact OE1-NZ 3.57Å; E16-K19 PolarHBondContact OE1-NZ 3.41Å; E16-K19 IonicContact OE2-NZ 3.88Å; E16-L20 WeakPolarHBondContact O-CG 3.19Å; E16-L20 PolarHBondContact O-N 3.38Å
17	Q	98.1	Very high	96.8	Very high	96 Å²	96	110.1 Å²	110.1	45%	0.449	55%	0.547	S	S	.	.	H	α-helix	trans	-61.4	-48.3	173.6	-178.1	62.6	21.7	0	0	112.1	K13 T14 V15 K19 L20 E21	K13-Q17 PolarHBondContact O-N 3.27Å; T14-Q17 WeakPolarHBondContact O-CB 3.35Å; T14-Q17 PolarHBondContact O-N 2.95Å; V15-Q17 VanDerWaalsContact C-N 3.31Å; V15-Q17 PolarHBondContact O-N 3.46Å; Q17-K19 VanDerWaalsContact C-N 3.29Å; Q17-K19 PolarHBondContact O-N 2.98Å; Q17-L20 WeakPolarHBondContact O-CB 3.37Å; Q17-L20 PolarHBondContact O-N 3.01Å; Q17-E21 HydrophobicContact CG-CG 4.47Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.39Å; Q17-E21 PolarHBondContact NE2-OE1 3.33Å; Q17-E21 PolarHBondContact O-N 3.33Å
18	L	98.2	Very high	97	Very high	95 Å²	95	110 Å²	110	50%	0.497	55%	0.551	S	S	.	*	H	α-helix	trans	-63.5	-35	-179.3	-68.9	171.7	0	0	0	112.3	T14 V15 L20 E21 V22	T14-L18 HydrophobicContact CG2-CD1 4.08Å; T14-L18 HydrophobicContact CG2-CG 4.41Å; T14-L18 WeakPolarHBondContact O-CG 3.46Å; T14-L18 PolarHBondContact O-N 3.01Å; V15-L18 PolarHBondContact O-N 2.96Å; L18-L20 VanDerWaalsContact C-N 3.26Å; L18-L20 PolarHBondContact O-N 3.39Å; L18-E21 PolarHBondContact O-N 3.18Å; L18-V22 PolarHBondContact O-N 3.49Å
19	K	97.9	Very high	97.2	Very high	107 Å²	107	113.1 Å²	113.1	47%	0.465	57%	0.566	S	S	.	*	H	α-helix	trans	-63.4	-31.2	173.1	-74	172.7	-177.8	170.5	0	112.6	V15 E16 Q17 V22 N23	V15-K19 HydrophobicContact CG1-CD 4.36Å; V15-K19 WeakPolarHBondContact O-CG 3.28Å; V15-K19 PolarHBondContact O-N 2.98Å; E16-K19 PolarHBondContact O-N 3.1Å; E16-K19 IonicContact OE1-NZ 3.57Å; E16-K19 PolarHBondContact OE1-NZ 3.41Å; E16-K19 IonicContact OE2-NZ 3.88Å; Q17-K19 VanDerWaalsContact C-N 3.29Å; Q17-K19 PolarHBondContact O-N 2.98Å; K19-V22 WeakPolarHBondContact O-CG1 3.27Å; K19-N23 PolarHBondContact O-ND2 2.87Å
20	L	97.5	Very high	97.4	Very high	120 Å²	120	114.3 Å²	114.3	63%	0.628	57%	0.571	S	S	*	*	H	α-helix	trans	-75.4	-46.4	173.2	-64.4	172.3	0	0	0	110.4	E16 Q17 L18 V22 N23	E16-L20 WeakPolarHBondContact O-CG 3.19Å; E16-L20 PolarHBondContact O-N 3.38Å; Q17-L20 WeakPolarHBondContact O-CB 3.37Å; Q17-L20 PolarHBondContact O-N 3.01Å; L18-L20 VanDerWaalsContact C-N 3.26Å; L18-L20 PolarHBondContact O-N 3.39Å; L20-V22 VanDerWaalsContact C-N 3.33Å; L20-V22 PolarHBondContact O-N 3.1Å; L20-N23 PolarHBondContact O-N 3.17Å; L20-N23 VanDerWaalsContact O-N 3.16Å
21	E	97.3	Very high	97.5	Very high	79 Å²	79	114.8 Å²	114.8	37%	0.369	57%	0.569	S	S	.	*	H	α-helix	trans	-65.3	-30.8	-176	-71.6	176.7	-172	0	0	114.4	Q17 L18 N23 I24 R26	Q17-E21 HydrophobicContact CG-CG 4.47Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.39Å; Q17-E21 PolarHBondContact NE2-OE1 3.33Å; Q17-E21 PolarHBondContact O-N 3.33Å; L18-E21 PolarHBondContact O-N 3.18Å; E21-N23 PolarHBondContact O-N 3.36Å; E21-I24 HydrophobicContact CB-CD1 4.32Å; E21-I24 HydrophobicContact CG-CD1 4.28Å; E21-I24 WeakPolarHBondContact O-CB 3.35Å; E21-I24 PolarHBondContact O-N 3.36Å; E21-R26 PolarHBondContact O-NH2 2.77Å
22	V	97.3	Very high	97.6	Very high	96 Å²	96	113.9 Å²	113.9	58%	0.582	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.3	-30.3	177.2	75.6	0	0	0	0	112	L18 K19 L20 I24	L18-V22 PolarHBondContact O-N 3.49Å; K19-V22 WeakPolarHBondContact O-CG1 3.27Å; L20-V22 VanDerWaalsContact C-N 3.33Å; L20-V22 PolarHBondContact O-N 3.1Å; V22-I24 VanDerWaalsContact C-N 3.3Å; V22-I24 PolarHBondContact O-N 2.91Å
23	N	96.9	Very high	97.7	Very high	135 Å²	135	108.1 Å²	108.1	72%	0.722	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.3	2.3	-178.6	-68.4	-57.5	0	0	0	113.3	K19 L20 E21 E25	K19-N23 PolarHBondContact O-ND2 2.87Å; L20-N23 PolarHBondContact O-N 3.17Å; L20-N23 VanDerWaalsContact O-N 3.16Å; E21-N23 PolarHBondContact O-N 3.36Å; N23-E25 PolarHBondContact O-N 2.96Å
24	I	97.2	Very high	97.7	Very high	101 Å²	101	103 Å²	103	52%	0.518	54%	0.538	S	S	.	.	S	Bend	trans	-71.4	121.4	173.4	-61.3	173.9	0	0	0	108.8	E21 V22 R26	E21-I24 HydrophobicContact CB-CD1 4.32Å; E21-I24 HydrophobicContact CG-CD1 4.28Å; E21-I24 WeakPolarHBondContact O-CB 3.35Å; E21-I24 PolarHBondContact O-N 3.36Å; V22-I24 VanDerWaalsContact C-N 3.3Å; V22-I24 PolarHBondContact O-N 2.91Å; I24-R26 PolarHBondContact O-N 3.42Å; I24-R26 PolarHBondContact O-NH1 3Å
25	E	97.2	Very high	97.8	Very high	187 Å²	187	103.9 Å²	103.9	87%	0.874	54%	0.536	S	S	*	.	P	Polyproline II helix	trans	-66.8	127	172.5	-169.9	176.1	-172.7	0	0	110	N23	N23-E25 PolarHBondContact O-N 2.96Å
26	R	96.8	Very high	97.8	Very high	179 Å²	179	106.2 Å²	106.2	68%	0.675	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-102.7	138.9	-178	-65.8	176.6	-177.8	71.7	3.7	110.1	E21 I24	E21-R26 PolarHBondContact O-NH2 2.77Å; I24-R26 PolarHBondContact O-N 3.42Å; I24-R26 PolarHBondContact O-NH1 3Å
27	M	96.8	Very high	97.8	Very high	98 Å²	98	106.6 Å²	106.6	48%	0.483	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-76.5	149.5	168.9	-173.9	-173	-73.2	0	0	110.7	I29 K31 A32	M27-I29 PolarHBondContact O-N 2.9Å; M27-K31 HydrophobicContact CE-CD 4.4Å; M27-K31 HydrophobicContact CG-CB 4.14Å; M27-K31 HydrophobicContact CG-CD 4.03Å; M27-K31 HydrophobicContact CG-CG 4.27Å; M27-K31 HydrophobicContact SD-CB 4.12Å; M27-K31 HydrophobicContact SD-CD 3.95Å; M27-K31 HydrophobicContact SD-CG 3.84Å; M27-A32 HydrophobicContact SD-CB 3.88Å
28	M	98.1	Very high	97.8	Very high	137 Å²	137	105.3 Å²	105.3	68%	0.675	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-58.5	131.3	168.3	-68.5	-64.9	-75.1	0	0	111.2	S30 K31 A32	M28-S30 PolarHBondContact O-N 2.95Å; M28-K31 HydrophobicContact CB-CB 4.25Å; M28-K31 WeakPolarHBondContact O-CB 3.47Å; M28-K31 PolarHBondContact O-N 3.13Å; M28-A32 PolarHBondContact O-N 3.19Å
29	I	98.1	Very high	97.8	Very high	148 Å²	148	107.7 Å²	107.7	76%	0.759	55%	0.554	S	S	*	*	H	α-helix	trans	-59.1	-38	179.5	-61.6	175.4	0	0	0	111.1	M27 K31 A32 A33	M27-I29 PolarHBondContact O-N 2.9Å; I29-K31 VanDerWaalsContact C-N 3.29Å; I29-K31 PolarHBondContact O-N 3.01Å; I29-A32 PolarHBondContact O-N 2.97Å; I29-A33 VanDerWaalsContact O-CB 3.27Å; I29-A33 WeakPolarHBondContact O-CB 3.33Å; I29-A33 PolarHBondContact O-N 3.35Å
30	S	98.3	Very high	97.8	Very high	82 Å²	82	106.4 Å²	106.4	57%	0.573	56%	0.558	S	S	*	*	H	α-helix	trans	-60	-38.6	176.5	52.6	0	0	0	0	112.8	M28 A34	M28-S30 PolarHBondContact O-N 2.95Å; S30-A34 WeakPolarHBondContact O-CB 3.41Å; S30-A34 PolarHBondContact O-N 3.4Å; S30-A34 VanDerWaalsContact O-N 3.1Å
31	K	98.3	Very high	97.8	Very high	112 Å²	112	106.6 Å²	106.6	49%	0.487	56%	0.556	S	S	.	*	H	α-helix	trans	-70.1	-49.4	176.9	-178.8	177.4	171.1	179	0	110.9	M27 M28 I29 A33 A34 E35	M27-K31 HydrophobicContact CE-CD 4.4Å; M27-K31 HydrophobicContact CG-CB 4.14Å; M27-K31 HydrophobicContact CG-CD 4.03Å; M27-K31 HydrophobicContact CG-CG 4.27Å; M27-K31 HydrophobicContact SD-CB 4.12Å; M27-K31 HydrophobicContact SD-CD 3.95Å; M27-K31 HydrophobicContact SD-CG 3.84Å; M28-K31 HydrophobicContact CB-CB 4.25Å; M28-K31 WeakPolarHBondContact O-CB 3.47Å; M28-K31 PolarHBondContact O-N 3.13Å; I29-K31 VanDerWaalsContact C-N 3.29Å; I29-K31 PolarHBondContact O-N 3.01Å; K31-A33 VanDerWaalsContact C-N 3.29Å; K31-A33 PolarHBondContact O-N 3.03Å; K31-A34 PolarHBondContact O-N 3.34Å; K31-E35 WeakPolarHBondContact CE-OE1 3.3Å; K31-E35 IonicContact NZ-OE1 2.72Å; K31-E35 WeakPolarHBondContact O-CG 3.34Å; K31-E35 PolarHBondContact O-N 2.89Å
32	A	98.3	Very high	97.7	Very high	35 Å²	35	106.2 Å²	106.2	29%	0.289	56%	0.562	S	S	.	*	H	α-helix	trans	-58.7	-42.4	178.5	0	0	0	0	0	111.7	M27 M28 I29 E35 L36	M27-A32 HydrophobicContact SD-CB 3.88Å; M28-A32 PolarHBondContact O-N 3.19Å; I29-A32 PolarHBondContact O-N 2.97Å; A32-E35 PolarHBondContact O-N 3.23Å; A32-L36 VanDerWaalsContact O-CG 3.3Å; A32-L36 WeakPolarHBondContact O-CG 3.33Å; A32-L36 PolarHBondContact O-N 3.33Å
33	A	98.4	Very high	97.7	Very high	52 Å²	52	105.1 Å²	105.1	43%	0.43	55%	0.55	S	S	.	*	H	α-helix	trans	-64.4	-41.9	176.9	0	0	0	0	0	112.4	I29 K31 L36 M37	I29-A33 VanDerWaalsContact O-CB 3.27Å; I29-A33 WeakPolarHBondContact O-CB 3.33Å; I29-A33 PolarHBondContact O-N 3.35Å; K31-A33 VanDerWaalsContact C-N 3.29Å; K31-A33 PolarHBondContact O-N 3.03Å; A33-L36 PolarHBondContact O-N 3.48Å; A33-M37 WeakPolarHBondContact O-CB 3.48Å; A33-M37 PolarHBondContact O-N 3.43Å
34	A	98.4	Very high	97.7	Very high	51 Å²	51	100.2 Å²	100.2	42%	0.421	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-41.3	177	0	0	0	0	0	112.2	S30 K31 M37 S38	S30-A34 WeakPolarHBondContact O-CB 3.41Å; S30-A34 PolarHBondContact O-N 3.4Å; S30-A34 VanDerWaalsContact O-N 3.1Å; K31-A34 PolarHBondContact O-N 3.34Å; A34-M37 PolarHBondContact O-N 3.44Å; A34-S38 WeakPolarHBondContact O-CB 3.49Å; A34-S38 PolarHBondContact O-N 3.45Å
35	E	98.2	Very high	97.5	Very high	97 Å²	97	103.8 Å²	103.8	45%	0.453	54%	0.54	S	S	.	.	H	α-helix	trans	-64.2	-44.5	176.3	-72.5	176.4	-175.9	0	0	111.7	K31 A32 S38 Y39	K31-E35 WeakPolarHBondContact CE-OE1 3.3Å; K31-E35 IonicContact NZ-OE1 2.72Å; K31-E35 WeakPolarHBondContact O-CG 3.34Å; K31-E35 PolarHBondContact O-N 2.89Å; A32-E35 PolarHBondContact O-N 3.23Å; E35-S38 PolarHBondContact O-N 3.04Å; E35-Y39 WeakPolarHBondContact O-CB 3.35Å; E35-Y39 PolarHBondContact O-N 3.01Å
36	L	98.4	Very high	97.3	Very high	120 Å²	120	102 Å²	102	63%	0.628	53%	0.531	S	S	*	.	H	α-helix	trans	-61.4	-45	175.5	-72.7	172.7	0	0	0	111.9	A32 A33 Y39 C40	A32-L36 VanDerWaalsContact O-CG 3.3Å; A32-L36 WeakPolarHBondContact O-CG 3.33Å; A32-L36 PolarHBondContact O-N 3.33Å; A33-L36 PolarHBondContact O-N 3.48Å; L36-Y39 PolarHBondContact O-N 3.19Å; L36-C40 PolarHBondContact O-N 3.34Å; L36-C40 PolarHBondContact O-SG 2.93Å; L36-C40 VanDerWaalsContact O-SG 3.34Å
37	M	98	Very high	97.3	Very high	111 Å²	111	96.5 Å²	96.5	55%	0.547	52%	0.515	S	S	.	.	H	α-helix	trans	-61.9	-48.1	177.8	-173	176.7	78.4	0	0	111.1	A33 A34 Y39 C40 E41	A33-M37 WeakPolarHBondContact O-CB 3.48Å; A33-M37 PolarHBondContact O-N 3.43Å; A34-M37 PolarHBondContact O-N 3.44Å; M37-Y39 VanDerWaalsContact C-N 3.28Å; M37-Y39 PolarHBondContact O-N 2.95Å; M37-C40 PolarHBondContact O-N 3.35Å; M37-E41 HydrophobicContact CG-CG 4.45Å; M37-E41 WeakPolarHBondContact O-CB 3.37Å; M37-E41 WeakPolarHBondContact O-CG 3.42Å; M37-E41 PolarHBondContact O-N 3.31Å
38	S	98.3	Very high	97.1	Very high	70 Å²	70	95.3 Å²	95.3	49%	0.49	52%	0.515	S	S	.	.	H	α-helix	trans	-60	-39.5	178.2	-178	0	0	0	0	112	A34 E35 S42	A34-S38 WeakPolarHBondContact O-CB 3.49Å; A34-S38 PolarHBondContact O-N 3.45Å; E35-S38 PolarHBondContact O-N 3.04Å; S38-S42 WeakPolarHBondContact O-CB 3.44Å; S38-S42 PolarHBondContact O-N 3.42Å; S38-S42 PolarHBondContact O-OG 3.34Å
39	Y	98.3	Very high	96.9	Very high	144 Å²	144	96.6 Å²	96.6	57%	0.565	52%	0.524	S	S	*	.	H	α-helix	trans	-65.1	-46.6	177.2	178.7	-94.5	0	0	0	111.6	E35 L36 M37 S42 H43	E35-Y39 WeakPolarHBondContact O-CB 3.35Å; E35-Y39 PolarHBondContact O-N 3.01Å; L36-Y39 PolarHBondContact O-N 3.19Å; M37-Y39 VanDerWaalsContact C-N 3.28Å; M37-Y39 PolarHBondContact O-N 2.95Å; Y39-S42 PolarHBondContact O-N 3.26Å; Y39-S42 PolarHBondContact O-OG 3.45Å; Y39-S42 VanDerWaalsContact O-OG 3.05Å; Y39-H43 AromaticContact CD2-CE1 3.49Å; Y39-H43 VanDerWaalsContact CD2-CE1 3.49Å; Y39-H43 WeakPolarHBondContact CD2-CE1 3.22Å; Y39-H43 AromaticContact CD2-ND1 3.64Å; Y39-H43 AromaticContact CE2-CE1 3.22Å; Y39-H43 WeakPolarHBondContact CE2-CE1 3.49Å; Y39-H43 AromaticContact CE2-ND1 3.54Å; Y39-H43 AromaticContact CE2-NE2 3.91Å; Y39-H43 AromaticContact CZ-CE1 3.86Å; Y39-H43 AromaticContact CZ-ND1 3.83Å; Y39-H43 PolarHBondContact O-N 3.46Å; Y39-H43 PolarHBondContact O-ND1 3.46Å
40	C	97.9	Very high	96.7	Very high	81 Å²	81	93.9 Å²	93.9	55%	0.547	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-45.3	177.2	-69.6	0	0	0	0	111.4	L36 M37 S42 H43 A44	L36-C40 PolarHBondContact O-N 3.34Å; L36-C40 PolarHBondContact O-SG 2.93Å; L36-C40 VanDerWaalsContact O-SG 3.34Å; M37-C40 PolarHBondContact O-N 3.35Å; C40-S42 PolarHBondContact O-N 3.05Å; C40-H43 PolarHBondContact O-N 2.85Å; C40-A44 VanDerWaalsContact O-CB 3.28Å; C40-A44 WeakPolarHBondContact O-CB 3.28Å; C40-A44 PolarHBondContact O-N 3.32Å
41	E	96.4	Very high	96.4	Very high	124 Å²	124	92.9 Å²	92.9	58%	0.579	50%	0.504	S	S	*	.	H	α-helix	trans	-63	-40	-179.8	-73.9	175.7	173.9	0	0	112.7	M37 H43	M37-E41 HydrophobicContact CG-CG 4.45Å; M37-E41 WeakPolarHBondContact O-CB 3.37Å; M37-E41 WeakPolarHBondContact O-CG 3.42Å; M37-E41 PolarHBondContact O-N 3.31Å; E41-H43 VanDerWaalsContact C-N 3.32Å; E41-H43 PolarHBondContact O-N 2.8Å
42	S	97.2	Very high	96	Very high	71 Å²	71	92.9 Å²	92.9	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-68.8	-30.5	179.9	69.8	0	0	0	0	112.9	S38 Y39 C40	S38-S42 WeakPolarHBondContact O-CB 3.44Å; S38-S42 PolarHBondContact O-N 3.42Å; S38-S42 PolarHBondContact O-OG 3.34Å; Y39-S42 PolarHBondContact O-N 3.26Å; Y39-S42 PolarHBondContact O-OG 3.45Å; Y39-S42 VanDerWaalsContact O-OG 3.05Å; C40-S42 PolarHBondContact O-N 3.05Å
43	H	96.8	Very high	95.6	Very high	73 Å²	73	94.2 Å²	94.2	34%	0.338	52%	0.52	S	S	.	.	H	α-helix	trans	-101.7	-9.1	-177.5	-61.2	86.4	0	0	0	113.8	Y39 C40 E41 K45 E46 D47	Y39-H43 AromaticContact CD2-CE1 3.49Å; Y39-H43 VanDerWaalsContact CD2-CE1 3.49Å; Y39-H43 WeakPolarHBondContact CD2-CE1 3.22Å; Y39-H43 AromaticContact CD2-ND1 3.64Å; Y39-H43 AromaticContact CE2-CE1 3.22Å; Y39-H43 WeakPolarHBondContact CE2-CE1 3.49Å; Y39-H43 AromaticContact CE2-ND1 3.54Å; Y39-H43 AromaticContact CE2-NE2 3.91Å; Y39-H43 AromaticContact CZ-CE1 3.86Å; Y39-H43 AromaticContact CZ-ND1 3.83Å; Y39-H43 PolarHBondContact O-N 3.46Å; Y39-H43 PolarHBondContact O-ND1 3.46Å; C40-H43 PolarHBondContact O-N 2.85Å; E41-H43 VanDerWaalsContact C-N 3.32Å; E41-H43 PolarHBondContact O-N 2.8Å; H43-K45 PolarHBondContact O-N 3.08Å; H43-K45 VanDerWaalsContact O-N 3.08Å; H43-E46 PolarHBondContact O-N 3.18Å; H43-D47 PolarHBondContact O-N 2.93Å
44	A	95.6	Very high	95.3	Very high	31 Å²	31	94.2 Å²	94.2	26%	0.256	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.2	-29.5	-176.8	0	0	0	0	0	113.9	C40 E46 V50 T51	C40-A44 VanDerWaalsContact O-CB 3.28Å; C40-A44 WeakPolarHBondContact O-CB 3.28Å; C40-A44 PolarHBondContact O-N 3.32Å; A44-E46 VanDerWaalsContact C-N 3.34Å; A44-V50 HydrophobicContact CB-CG1 4.34Å; A44-T51 PolarHBondContact O-OG1 2.84Å
45	K	93.3	Very high	94.7	Very high	177 Å²	177	95 Å²	95	77%	0.77	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75	-25.3	177.7	-65.2	-176.7	-177.1	175.8	0	113.3	H43	H43-K45 PolarHBondContact O-N 3.08Å; H43-K45 VanDerWaalsContact O-N 3.08Å
46	E	93.7	Very high	94.2	Very high	148 Å²	148	95 Å²	95	69%	0.692	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.5	-17	-178.4	-62.5	178.6	-174.6	0	0	111.8	H43 A44 P48	H43-E46 PolarHBondContact O-N 3.18Å; A44-E46 VanDerWaalsContact C-N 3.34Å; E46-P48 WeakPolarHBondContact O-CD 3.32Å
47	D	95.8	Very high	93.7	Very high	64 Å²	64	95.7 Å²	95.7	34%	0.342	53%	0.533	S	S	.	.			trans	-75.6	110.7	174.7	-173.1	-30.2	0	0	0	110.6	H43 L49 V50 T51	H43-D47 PolarHBondContact O-N 2.93Å; D47-L49 PolarHBondContact O-N 2.83Å; D47-L49 WeakPolarHBondContact OD1-CA 3.4Å; D47-L49 VanDerWaalsContact OD1-CB 3.32Å; D47-L49 WeakPolarHBondContact OD1-CB 3.16Å; D47-L49 PolarHBondContact OD1-N 2.84Å; D47-V50 HydrophobicContact CB-CB 4.06Å; D47-V50 HydrophobicContact CB-CG2 4.05Å; D47-V50 PolarHBondContact O-N 3.34Å; D47-V50 PolarHBondContact OD1-N 3.2Å; D47-T51 PolarHBondContact O-N 3.24Å
48	P	93.6	Very high	93.4	Very high	73 Å²	73	93.4 Å²	93.4	47%	0.474	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.9	-16.7	-177.8	-21.7	36.6	0	0	0	114.4	E46 T51 V53	E46-P48 WeakPolarHBondContact O-CD 3.32Å; P48-T51 CarbonylContact C-O 3.57Å; P48-T51 WeakPolarHBondContact CA-O 3.47Å; P48-V53 HydrophobicContact CB-CG1 3.83Å; P48-V53 HydrophobicContact CB-CG2 4.36Å; P48-V53 HydrophobicContact CG-CG1 4.23Å
49	L	93.6	Very high	93	Very high	164 Å²	164	95.1 Å²	95.1	86%	0.859	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87	-28.6	178.6	-58	179.6	0	0	0	111.7	D47	D47-L49 PolarHBondContact O-N 2.83Å; D47-L49 WeakPolarHBondContact OD1-CA 3.4Å; D47-L49 VanDerWaalsContact OD1-CB 3.32Å; D47-L49 WeakPolarHBondContact OD1-CB 3.16Å; D47-L49 PolarHBondContact OD1-N 2.84Å
50	V	94.3	Very high	92.6	Very high	91 Å²	91	96.9 Å²	96.9	55%	0.552	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.4	-47	175.2	178.8	0	0	0	0	110.6	A44 D47	A44-V50 HydrophobicContact CB-CG1 4.34Å; D47-V50 HydrophobicContact CB-CB 4.06Å; D47-V50 HydrophobicContact CB-CG2 4.05Å; D47-V50 PolarHBondContact O-N 3.34Å; D47-V50 PolarHBondContact OD1-N 3.2Å
51	T	92.4	Very high	92	Very high	61 Å²	61	99.5 Å²	99.5	37%	0.374	54%	0.542	S	S	.	.	S	Bend	trans	-111.7	101.3	176.3	-55.8	0	0	0	0	108.8	A44 D47 P48 V53	A44-T51 PolarHBondContact O-OG1 2.84Å; D47-T51 PolarHBondContact O-N 3.24Å; P48-T51 CarbonylContact C-O 3.57Å; P48-T51 WeakPolarHBondContact CA-O 3.47Å; T51-V53 PolarHBondContact O-N 3.18Å
52	P	89.6	Confident	91.3	Very high	112 Å²	112	102 Å²	102	73%	0.727	55%	0.554	S	S	*	*	P	Polyproline II helix	trans	-57.9	127.3	-176.7	-25.7	34.5	0	0	0	112.2
53	V	90.4	Very high	90.2	Very high	63 Å²	63	106.6 Å²	106.6	38%	0.382	57%	0.565	S	S	.	*	P	Polyproline II helix	trans	-77.6	161.6	175.4	-63.8	0	0	0	0	111.6	P48 T51 E57 N58	P48-V53 HydrophobicContact CB-CG1 3.83Å; P48-V53 HydrophobicContact CB-CG2 4.36Å; P48-V53 HydrophobicContact CG-CG1 4.23Å; T51-V53 PolarHBondContact O-N 3.18Å; V53-E57 HydrophobicContact CB-CB 4.4Å; V53-E57 HydrophobicContact CG2-CB 4.47Å; V53-N58 HydrophobicContact CG2-CB 4.25Å
54	A	90.6	Very high	88.8	Confident	53 Å²	53	112 Å²	112	44%	0.438	59%	0.587	S	S	.	*	P	Polyproline II helix	trans	-60.2	146.9	176.4	0	0	0	0	0	110.8	S56 E57 N58	A54-S56 PolarHBondContact O-N 3.49Å; A54-S56 VanDerWaalsContact O-N 3.08Å; A54-E57 HydrophobicContact CB-CG 4.43Å; A54-E57 PolarHBondContact O-N 3.08Å; A54-N58 PolarHBondContact O-N 2.92Å; A54-N58 VanDerWaalsContact O-N 3.14Å
55	S	86.3	Confident	87.2	Confident	68 Å²	68	117.6 Å²	117.6	48%	0.476	61%	0.612	S	S	.	*	T	Hydrogen-bonded Turn	trans	-57.5	-30.2	-179.3	-55.7	0	0	0	0	113.2	E57 N58 R61	S55-E57 VanDerWaalsContact C-N 3.3Å; S55-E57 PolarHBondContact O-N 3.14Å; S55-N58 PolarHBondContact O-N 2.87Å; S55-R61 VanDerWaalsContact O-CB 3.24Å; S55-R61 WeakPolarHBondContact O-CB 3.4Å; S55-R61 WeakPolarHBondContact O-CD 3.32Å; S55-R61 WeakPolarHBondContact O-CG 3.44Å
56	S	87.9	Confident	85.4	Confident	95 Å²	95	118.3 Å²	118.3	66%	0.664	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.4	-28.8	175.4	45.6	0	0	0	0	114.1	A54	A54-S56 PolarHBondContact O-N 3.49Å; A54-S56 VanDerWaalsContact O-N 3.08Å
57	E	88.9	Confident	83.5	Confident	135 Å²	135	116.3 Å²	116.3	63%	0.631	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.8	-21.4	-179.6	-61.7	175.5	146.3	0	0	111.4	V53 A54 S55 P59	V53-E57 HydrophobicContact CB-CB 4.4Å; V53-E57 HydrophobicContact CG2-CB 4.47Å; A54-E57 HydrophobicContact CB-CG 4.43Å; A54-E57 PolarHBondContact O-N 3.08Å; S55-E57 VanDerWaalsContact C-N 3.3Å; S55-E57 PolarHBondContact O-N 3.14Å; E57-P59 WeakPolarHBondContact O-CD 3.35Å
58	N	91.3	Very high	81.8	Confident	63 Å²	63	119 Å²	119	34%	0.337	64%	0.635	S	S	.	*			trans	-72	112.1	176.1	-176.1	-5.4	0	0	0	110.8	V53 A54 S55 F60 R61	V53-N58 HydrophobicContact CG2-CB 4.25Å; A54-N58 PolarHBondContact O-N 2.92Å; A54-N58 VanDerWaalsContact O-N 3.14Å; S55-N58 PolarHBondContact O-N 2.87Å; N58-F60 PolarHBondContact O-N 3.48Å; N58-F60 VanDerWaalsContact O-N 3.15Å; N58-F60 WeakPolarHBondContact OD1-CA 3.2Å; N58-F60 WeakPolarHBondContact OD1-CB 3.14Å; N58-F60 PolarHBondContact OD1-N 2.97Å; N58-R61 HydrophobicContact CB-CB 4.47Å; N58-R61 WeakPolarHBondContact O-CB 3.24Å; N58-R61 PolarHBondContact O-N 3.06Å
59	P	89.9	Confident	80	Confident	106 Å²	106	123 Å²	123	69%	0.688	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.2	-19.5	178.6	27.7	-34.4	0	0	0	113.2	E57	E57-P59 WeakPolarHBondContact O-CD 3.35Å
60	F	88.9	Confident	77.9	Confident	182 Å²	182	126.1 Å²	126.1	80%	0.798	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.8	11.2	177	-54.9	-77.5	0	0	0	113.5	N58	N58-F60 PolarHBondContact O-N 3.48Å; N58-F60 VanDerWaalsContact O-N 3.15Å; N58-F60 WeakPolarHBondContact OD1-CA 3.2Å; N58-F60 WeakPolarHBondContact OD1-CB 3.14Å; N58-F60 PolarHBondContact OD1-N 2.97Å
61	R	85.6	Confident	77.1	Confident	136 Å²	136	127.9 Å²	127.9	51%	0.513	67%	0.673	S	S	.	*	S	Bend	trans	-57.3	142.7	174.2	-169.8	-157	-168.8	154.2	-1.6	110.6	S55 N58 K63	S55-R61 VanDerWaalsContact O-CB 3.24Å; S55-R61 WeakPolarHBondContact O-CB 3.4Å; S55-R61 WeakPolarHBondContact O-CD 3.32Å; S55-R61 WeakPolarHBondContact O-CG 3.44Å; N58-R61 HydrophobicContact CB-CB 4.47Å; N58-R61 WeakPolarHBondContact O-CB 3.24Å; N58-R61 PolarHBondContact O-N 3.06Å; R61-K63 PolarHBondContact O-N 3.15Å
62	E	81.8	Confident	76.3	Confident	176 Å²	176	131.4 Å²	131.4	82%	0.822	69%	0.689	S	S	*	*			trans	-50.4	111.6	162.2	-70.7	-174.9	177	0	0	110.4	K64	E62-K64 PolarHBondContact O-N 3.46Å
63	K	74.7	Confident	75.6	Confident	167 Å²	167	132.5 Å²	132.5	73%	0.726	69%	0.687	S	S	*	*			trans	-76.3	120.2	165.6	-64.7	-177.7	-177.1	178.3	0	105.8	R61 L65	R61-K63 PolarHBondContact O-N 3.15Å; K63-L65 HydrophobicContact CB-CG 4.37Å; K63-L65 PolarHBondContact O-N 2.72Å
64	K	66.6	Low	74.7	Confident	187 Å²	187	136.6 Å²	136.6	81%	0.813	71%	0.705	S	S	*	*			trans	-64.2	82	161.1	-74.3	-167.6	177.4	-173.6	0	107.2	E62 F66	E62-K64 PolarHBondContact O-N 3.46Å; K64-F66 PolarHBondContact O-N 3.06Å
65	L	62.8	Low	73.7	Confident	148 Å²	148	141.8 Å²	141.8	78%	0.775	72%	0.721	S	S	*	*			trans	-65.4	104.4	165.2	-72.2	168	0	0	0	105	K63 C67	K63-L65 HydrophobicContact CB-CG 4.37Å; K63-L65 PolarHBondContact O-N 2.72Å; L65-C67 PolarHBondContact O-N 2.81Å
66	F	55.6	Low	72.9	Confident	193 Å²	193	146.7 Å²	146.7	85%	0.846	74%	0.738	S	S	*	*			trans	-66.7	79.8	163.7	-72.8	-87.4	0	0	0	107.3	K64 V68	K64-F66 PolarHBondContact O-N 3.06Å; F66-V68 VanDerWaalsContact C-N 3.33Å; F66-V68 PolarHBondContact O-N 3.15Å; F66-V68 VanDerWaalsContact O-N 3.15Å
67	C	52.4	Low	71.8	Confident	105 Å²	105	150.4 Å²	150.4	71%	0.709	74%	0.743	S	S	*	*			trans	-74.1	94.5	161.4	-171.9	0	0	0	0	106.6	L65	L65-C67 PolarHBondContact O-N 2.81Å
68	V	60.4	Low	70.5	Confident	122 Å²	122	151.6 Å²	151.6	74%	0.739	75%	0.752	S	S	*	*			trans	-79.3	110.9	153	-102.4	0	0	0	0	105.8	F66 L70	F66-V68 VanDerWaalsContact C-N 3.33Å; F66-V68 PolarHBondContact O-N 3.15Å; F66-V68 VanDerWaalsContact O-N 3.15Å; V68-L70 PolarHBondContact O-N 3.25Å
69	I	56	Low	68.8	Low	157 Å²	157	159 Å²	159	81%	0.805	79%	0.786	S	S	*	*			trans	-69.4	111.3	162	-58	177.1	0	0	0	105.2
70	L	50.3	Low	66.8	Low	229 Å²	229	163.8 Å²	163.8	100%	1.199	80%	0.795	S	S	*	*			trans	-83.2	0	167.6	-86	159.8	0	0	0	109.7	V68	V68-L70 PolarHBondContact O-N 3.25Å

Retrieved 70 of 70 residues in 13.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).