A0A3B3UKF6_9TELE Loading...

PDZ domain-containing protein 11

AlphaFold DB , UniProt , Accession A0A3B3UKF6, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 142 aa.

						>A0A3B3UKF6_9TELE|A0A3B3UKF6
MDQKIPYDDYQLPVVFLPSYENPPAWIPPQERVHHPDYNNELTQFLPRTIVLKKPPGAQLGFNIRGGKASQLGIFISKVVPDSDAHRAGLQEGDQVLSVNDVDFQDIEHSRAVEILKTAREIVMKVRFFPYNYQRQKERTVH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.9	Very low	56.4	Low	234 Å²	234	157.7 Å²	157.7	100%	1.153	76%	0.761	S	S	*	*				0	85	0	-76.1	-174.4	-128.9	0	0	106.3	Q3	M1-Q3 PolarHBondContact O-N 3.24Å
2	D	46	Very low	56.8	Low	164 Å²	164	156.3 Å²	156.3	88%	0.877	76%	0.759	S	S	*	*			trans	-86.6	103.6	177.8	-67.5	-49.8	0	0	0	108.3	K4	D2-K4 PolarHBondContact O-N 3.11Å; D2-K4 VanDerWaalsContact O-N 3.08Å
3	Q	52.7	Low	57.1	Low	188 Å²	188	153.5 Å²	153.5	88%	0.879	76%	0.761	S	S	*	*			trans	-72.4	98.8	172.4	-72.7	-178.2	-12.6	0	0	108	M1 I5	M1-Q3 PolarHBondContact O-N 3.24Å; Q3-I5 PolarHBondContact O-N 2.81Å
4	K	58.4	Low	57.8	Low	202 Å²	202	147.4 Å²	147.4	88%	0.878	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-66.3	118.5	168.3	-90.7	-178.7	172.6	177.7	0	108.7	D2	D2-K4 PolarHBondContact O-N 3.11Å; D2-K4 VanDerWaalsContact O-N 3.08Å
5	I	59.6	Low	58.4	Low	104 Å²	104	145.4 Å²	145.4	53%	0.533	73%	0.734	S	S	.	*	P	Polyproline II helix	trans	-67.7	133.9	172.4	-46.8	173.3	0	0	0	108	Q3 D9	Q3-I5 PolarHBondContact O-N 2.81Å; I5-D9 HydrophobicContact CG2-CB 4.27Å
6	P	61.8	Low	59.2	Low	84 Å²	84	145.9 Å²	145.9	55%	0.545	73%	0.73	S	S	.	*	P	Polyproline II helix	trans	-56.6	146.6	176.4	-24	34.2	0	0	0	112.7	D8 D9	P6-D8 PolarHBondContact O-N 2.83Å; P6-D8 VanDerWaalsContact O-N 3.1Å; P6-D9 PolarHBondContact O-N 2.83Å
7	Y	56.8	Low	59.8	Low	174 Å²	174	146 Å²	146	68%	0.682	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-60.1	-22.4	-172.1	-172.2	-97.8	0	0	0	114.2	D9	Y7-D9 PolarHBondContact O-N 2.91Å
8	D	61.1	Low	60.4	Low	147 Å²	147	144.3 Å²	144.3	79%	0.786	73%	0.734	S	S	*	*	G	3₁₀ helix	trans	-82.4	-9.3	-172.2	-62.9	-30.4	0	0	0	114.4	P6	P6-D8 PolarHBondContact O-N 2.83Å; P6-D8 VanDerWaalsContact O-N 3.1Å
9	D	61.6	Low	61.1	Low	120 Å²	120	142.5 Å²	142.5	64%	0.642	74%	0.736	S	S	*	*	G	3₁₀ helix	trans	-94.6	1.7	-175	-79.4	-25.6	0	0	0	114.8	I5 P6 Y7 Q11	I5-D9 HydrophobicContact CG2-CB 4.27Å; P6-D9 PolarHBondContact O-N 2.83Å; Y7-D9 PolarHBondContact O-N 2.91Å; D9-Q11 PolarHBondContact O-N 2.85Å
10	Y	61.7	Low	61.9	Low	122 Å²	122	144.6 Å²	144.6	48%	0.478	74%	0.735	S	S	.	*			trans	-83.2	102.4	179.5	-64.9	-83.5	0	0	0	111.7	L12 V14	Y10-L12 PolarHBondContact O-N 2.82Å; Y10-V14 VanDerWaalsContact CB-CG2 3.48Å; Y10-V14 HydrophobicContact CD1-CG2 3.91Å; Y10-V14 HydrophobicContact CD2-CG2 4.26Å; Y10-V14 HydrophobicContact CG-CG2 3.62Å
11	Q	62.3	Low	62.7	Low	196 Å²	196	146 Å²	146	92%	0.916	74%	0.739	S	S	*	*			trans	-74	5.4	179.2	-72.6	-178.3	-9.5	0	0	115.6	D9	D9-Q11 PolarHBondContact O-N 2.85Å
12	L	62.1	Low	64.8	Low	141 Å²	141	141.2 Å²	141.2	74%	0.738	72%	0.718	S	S	*	*	S	Bend	trans	-127.8	146.2	174.6	-70.7	168.5	0	0	0	108.8	Y10 V14	Y10-L12 PolarHBondContact O-N 2.82Å; L12-V14 PolarHBondContact O-N 2.84Å
13	P	60.6	Low	66.4	Low	120 Å²	120	137.7 Å²	137.7	78%	0.779	70%	0.704	S	S	*	*			trans	-58.7	109.6	174.9	23.5	-31.1	0	0	0	108.9	V15	P13-V15 PolarHBondContact O-N 3.45Å
14	V	66.7	Low	67.6	Low	67 Å²	67	134.2 Å²	134.2	41%	0.406	70%	0.698	S	S	.	*			trans	-72.1	98	179.8	-176.2	0	0	0	0	107.6	Y10 L12 F16	Y10-V14 VanDerWaalsContact CB-CG2 3.48Å; Y10-V14 HydrophobicContact CD1-CG2 3.91Å; Y10-V14 HydrophobicContact CD2-CG2 4.26Å; Y10-V14 HydrophobicContact CG-CG2 3.62Å; L12-V14 PolarHBondContact O-N 2.84Å; V14-F16 HydrophobicContact CB-CE2 4.3Å; V14-F16 HydrophobicContact CG1-CD2 4.25Å; V14-F16 HydrophobicContact CG1-CE1 4.11Å; V14-F16 HydrophobicContact CG1-CE2 3.78Å; V14-F16 HydrophobicContact CG1-CZ 3.7Å; V14-F16 PolarHBondContact O-N 2.93Å
15	V	67.1	Low	68.8	Low	118 Å²	118	128.3 Å²	128.3	72%	0.715	69%	0.687	S	S	*	*			trans	-81.1	107.2	172.2	-178.1	0	0	0	0	107.7	P13 L17	P13-V15 PolarHBondContact O-N 3.45Å; V15-L17 PolarHBondContact O-N 3.49Å
16	F	71.1	Confident	69.9	Low	154 Å²	154	132.1 Å²	132.1	68%	0.675	69%	0.694	S	S	*	*			trans	-73.6	110.3	170.2	-67.2	-82.9	0	0	0	108.8	V14	V14-F16 HydrophobicContact CB-CE2 4.3Å; V14-F16 HydrophobicContact CG1-CD2 4.25Å; V14-F16 HydrophobicContact CG1-CE1 4.11Å; V14-F16 HydrophobicContact CG1-CE2 3.78Å; V14-F16 HydrophobicContact CG1-CZ 3.7Å; V14-F16 PolarHBondContact O-N 2.93Å
17	L	69.7	Low	70.9	Confident	147 Å²	147	129.1 Å²	129.1	77%	0.77	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-64.2	145.3	166.1	-65.3	177	0	0	0	108.8	V15	V15-L17 PolarHBondContact O-N 3.49Å
18	P	69.3	Low	72.5	Confident	116 Å²	116	122.3 Å²	122.3	75%	0.753	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-56.6	150	170	26.1	-33.4	0	0	0	109.6	Y20	P18-Y20 PolarHBondContact O-N 3.39Å
19	S	75.3	Confident	73.6	Confident	110 Å²	110	118.5 Å²	118.5	77%	0.769	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-51.9	133.5	173.3	-57.9	0	0	0	0	109.8	E21	S19-E21 PolarHBondContact O-N 2.91Å; S19-E21 VanDerWaalsContact O-N 3.1Å
20	Y	76.8	Confident	74.8	Confident	184 Å²	184	119.9 Å²	119.9	72%	0.722	64%	0.636	S	S	*	*			trans	-61.8	116	176.4	179.2	-98.7	0	0	0	109.7	P18 N22	P18-Y20 PolarHBondContact O-N 3.39Å; Y20-N22 WeakPolarHBondContact CE1-OD1 3.33Å
21	E	78.1	Confident	75.9	Confident	174 Å²	174	119.7 Å²	119.7	81%	0.813	64%	0.64	S	S	*	*	P	Polyproline II helix	trans	-87.8	126	169.5	-70.4	-176.4	177.2	0	0	108.6	S19	S19-E21 PolarHBondContact O-N 2.91Å; S19-E21 VanDerWaalsContact O-N 3.1Å
22	N	83.2	Confident	77	Confident	133 Å²	133	113.8 Å²	113.8	71%	0.711	61%	0.609	S	S	*	*	P	Polyproline II helix	trans	-59.8	136.6	173.6	-72.6	-51.1	0	0	0	109.2	Y20	Y20-N22 WeakPolarHBondContact CE1-OD1 3.33Å
23	P	79.4	Confident	77.7	Confident	90 Å²	90	112.3 Å²	112.3	58%	0.584	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-59.3	147.3	175.5	26.1	-33.8	0	0	0	109.6
24	P	77.1	Confident	78.4	Confident	116 Å²	116	114.7 Å²	114.7	75%	0.753	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-54.4	144.9	174.4	22.1	-31.8	0	0	0	110.2	W26	P24-W26 PolarHBondContact O-N 2.9Å
25	A	82.8	Confident	78.8	Confident	78 Å²	78	113.8 Å²	113.8	65%	0.645	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-56.9	140.2	-177.9	0	0	0	0	0	110.9	I27	A25-I27 PolarHBondContact O-N 3.36Å
26	W	83.4	Confident	79.2	Confident	184 Å²	184	112.6 Å²	112.6	70%	0.697	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-68	125.1	173.4	-179.1	88.9	0	0	0	109.5	P24 P28	P24-W26 PolarHBondContact O-N 2.9Å; W26-P28 HydrophobicContact CE3-CG 4.32Å; W26-P28 HydrophobicContact CH2-CB 4.07Å; W26-P28 HydrophobicContact CH2-CG 4.27Å; W26-P28 HydrophobicContact CZ3-CB 4Å; W26-P28 HydrophobicContact CZ3-CG 3.69Å
27	I	83.6	Confident	79.2	Confident	20 Å²	20	111.3 Å²	111.3	10%	0.103	59%	0.592	C	S	.	*			trans	-107.5	129.5	-179.8	-68.1	156.1	0	0	0	108.7	A25 E31 R32 H35 Y38	A25-I27 PolarHBondContact O-N 3.36Å; I27-E31 HydrophobicContact CG2-CB 3.9Å; I27-R32 HydrophobicContact CB-CG 4.37Å; I27-R32 HydrophobicContact CG2-CG 3.89Å; I27-R32 VanDerWaalsContact O-CZ 3.26Å; I27-R32 PolarHBondContact O-NE 3.19Å; I27-R32 PolarHBondContact O-NH2 2.89Å; I27-H35 WeakPolarHBondContact CD1-CE1 3.42Å; I27-H35 WeakPolarHBondContact CD1-NE2 3.17Å; I27-H35 HydrophobicContact CG2-CB 4.45Å; I27-Y38 HydrophobicContact CB-CE2 3.9Å; I27-Y38 HydrophobicContact CD1-CD2 4.06Å; I27-Y38 HydrophobicContact CD1-CE2 3.48Å; I27-Y38 VanDerWaalsContact CD1-CE2 3.48Å; I27-Y38 HydrophobicContact CG1-CE2 4.22Å; I27-Y38 HydrophobicContact CG2-CE2 4.47Å
28	P	88.9	Confident	79.1	Confident	31 Å²	31	108.4 Å²	108.4	20%	0.201	57%	0.572	C	S	.	*			trans	-58.4	142.8	178	-22.2	30	0	0	0	112.8	W26 Q30 E31 R32	W26-P28 HydrophobicContact CE3-CG 4.32Å; W26-P28 HydrophobicContact CH2-CB 4.07Å; W26-P28 HydrophobicContact CH2-CG 4.27Å; W26-P28 HydrophobicContact CZ3-CB 4Å; W26-P28 HydrophobicContact CZ3-CG 3.69Å; P28-Q30 PolarHBondContact O-N 3.32Å; P28-Q30 VanDerWaalsContact O-N 3.08Å; P28-E31 PolarHBondContact O-N 3.1Å; P28-R32 WeakPolarHBondContact O-CG 3.42Å; P28-R32 PolarHBondContact O-N 2.8Å; P28-R32 VanDerWaalsContact O-N 3.12Å
29	P	84.6	Confident	79	Confident	67 Å²	67	106.2 Å²	106.2	44%	0.435	55%	0.554	S	S	.	*	H	α-helix	trans	-53.5	-32.8	-178.8	-27.2	34.7	0	0	0	115.1	E31 R32	P29-E31 VanDerWaalsContact C-N 3.32Å; P29-R32 PolarHBondContact O-N 3.04Å
30	Q	87.6	Confident	78.8	Confident	149 Å²	149	108.2 Å²	108.2	70%	0.696	56%	0.556	S	S	*	*	H	α-helix	trans	-67.2	-33.4	178.2	-57.2	84.5	-2.6	0	0	112.2	P28	P28-Q30 PolarHBondContact O-N 3.32Å; P28-Q30 VanDerWaalsContact O-N 3.08Å
31	E	84.8	Confident	78.5	Confident	118 Å²	118	104.9 Å²	104.9	55%	0.551	55%	0.547	S	S	*	.	H	α-helix	trans	-84.9	-25.6	-179.4	-67.4	174.5	-156.7	0	0	111.8	I27 P28 P29 V33 H34 H35	I27-E31 HydrophobicContact CG2-CB 3.9Å; P28-E31 PolarHBondContact O-N 3.1Å; P29-E31 VanDerWaalsContact C-N 3.32Å; E31-V33 VanDerWaalsContact C-N 3.27Å; E31-V33 PolarHBondContact O-N 3.09Å; E31-H34 PolarHBondContact O-N 2.74Å; E31-H35 WeakPolarHBondContact O-CB 3.32Å; E31-H35 PolarHBondContact O-N 2.84Å; E31-H35 VanDerWaalsContact O-N 3.09Å
32	R	84.4	Confident	78.2	Confident	72 Å²	72	101.9 Å²	101.9	27%	0.272	54%	0.536	S	S	.	.	H	α-helix	trans	-57	-37.1	179.4	-70.3	178.5	-160.9	165.2	4.2	113.6	I27 P28 P29 H34 H35 Y38	I27-R32 HydrophobicContact CB-CG 4.37Å; I27-R32 HydrophobicContact CG2-CG 3.89Å; I27-R32 VanDerWaalsContact O-CZ 3.26Å; I27-R32 PolarHBondContact O-NE 3.19Å; I27-R32 PolarHBondContact O-NH2 2.89Å; P28-R32 WeakPolarHBondContact O-CG 3.42Å; P28-R32 PolarHBondContact O-N 2.8Å; P28-R32 VanDerWaalsContact O-N 3.12Å; P29-R32 PolarHBondContact O-N 3.04Å; R32-H34 PolarHBondContact O-N 3.48Å; R32-H34 VanDerWaalsContact O-N 3.12Å; R32-H35 PolarHBondContact O-N 3.19Å; R32-Y38 HydrophobicContact CB-CD1 4.08Å; R32-Y38 HydrophobicContact CB-CG 3.88Å; R32-Y38 HydrophobicContact CG-CD1 3.63Å; R32-Y38 HydrophobicContact CG-CD2 4.04Å; R32-Y38 HydrophobicContact CG-CE1 3.93Å; R32-Y38 HydrophobicContact CG-CE2 4.36Å; R32-Y38 HydrophobicContact CG-CG 3.67Å; R32-Y38 VanDerWaalsContact O-CB 3.3Å; R32-Y38 WeakPolarHBondContact O-CB 3.46Å
33	V	76.6	Confident	77.9	Confident	111 Å²	111	99.9 Å²	99.9	67%	0.673	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.4	-30.1	-176.6	-179.8	0	0	0	0	111.9	E31	E31-V33 VanDerWaalsContact C-N 3.27Å; E31-V33 PolarHBondContact O-N 3.09Å
34	H	75.5	Confident	77.7	Confident	169 Å²	169	99.9 Å²	99.9	78%	0.782	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-110.2	1.5	178.6	-56	-58.2	0	0	0	112.8	E31 R32	E31-H34 PolarHBondContact O-N 2.74Å; R32-H34 PolarHBondContact O-N 3.48Å; R32-H34 VanDerWaalsContact O-N 3.12Å
35	H	76.3	Confident	77.9	Confident	49 Å²	49	97.9 Å²	97.9	23%	0.227	50%	0.5	C	S	.	.			trans	-81.1	130.7	-177	-164.2	-80.9	0	0	0	110.2	I27 E31 R32 D37 Y38 N39	I27-H35 WeakPolarHBondContact CD1-CE1 3.42Å; I27-H35 WeakPolarHBondContact CD1-NE2 3.17Å; I27-H35 HydrophobicContact CG2-CB 4.45Å; E31-H35 WeakPolarHBondContact O-CB 3.32Å; E31-H35 PolarHBondContact O-N 2.84Å; E31-H35 VanDerWaalsContact O-N 3.09Å; R32-H35 PolarHBondContact O-N 3.19Å; H35-D37 VanDerWaalsContact C-N 3.27Å; H35-D37 IonicContact CE1-OD2 2.69Å; H35-D37 PolarHBondContact CE1-OD2 3.19Å; H35-D37 VanDerWaalsContact CE1-OD2 3.26Å; H35-D37 WeakPolarHBondContact ND1-CB 3.37Å; H35-D37 PolarHBondContact ND1-N 3.11Å; H35-D37 VanDerWaalsContact ND1-N 3.15Å; H35-D37 IonicContact ND1-OD2 3.73Å; H35-D37 PolarHBondContact O-N 3.3Å; H35-Y38 HydrophobicContact CB-CD2 4.06Å; H35-Y38 AromaticContact CG-CD2 4Å; H35-Y38 AromaticContact ND1-CD2 3.72Å; H35-Y38 CarbonylContact O-C 3.49Å; H35-Y38 PolarHBondContact O-N 3.22Å; H35-N39 PolarHBondContact O-N 2.84Å; H35-N39 VanDerWaalsContact O-N 3.13Å
36	P	74.4	Confident	78.2	Confident	93 Å²	93	99 Å²	99	60%	0.604	50%	0.495	S	S	*	.	G	3₁₀ helix	trans	-56.4	-40	-178.1	20.8	-32.6	0	0	0	112.7	Y38 N39	P36-Y38 VanDerWaalsContact C-N 3.26Å; P36-Y38 PolarHBondContact O-N 2.88Å; P36-N39 PolarHBondContact O-N 3.35Å
37	D	71.4	Confident	78.6	Confident	126 Å²	126	94 Å²	94	67%	0.674	49%	0.486	S	S	*	.	G	3₁₀ helix	trans	-74.6	-11.3	179.6	-55.8	-18.9	0	0	0	114.4	H35	H35-D37 VanDerWaalsContact C-N 3.27Å; H35-D37 IonicContact CE1-OD2 2.69Å; H35-D37 PolarHBondContact CE1-OD2 3.19Å; H35-D37 VanDerWaalsContact CE1-OD2 3.26Å; H35-D37 WeakPolarHBondContact ND1-CB 3.37Å; H35-D37 PolarHBondContact ND1-N 3.11Å; H35-D37 VanDerWaalsContact ND1-N 3.15Å; H35-D37 IonicContact ND1-OD2 3.73Å; H35-D37 PolarHBondContact O-N 3.3Å
38	Y	67.7	Low	79.1	Confident	86 Å²	86	96.3 Å²	96.3	34%	0.337	49%	0.494	S	S	.	.	G	3₁₀ helix	trans	-117.7	16.7	178.7	-69.2	-97.3	0	0	0	111.9	I27 R32 H35 P36 N40	I27-Y38 HydrophobicContact CB-CE2 3.9Å; I27-Y38 HydrophobicContact CD1-CD2 4.06Å; I27-Y38 HydrophobicContact CD1-CE2 3.48Å; I27-Y38 VanDerWaalsContact CD1-CE2 3.48Å; I27-Y38 HydrophobicContact CG1-CE2 4.22Å; I27-Y38 HydrophobicContact CG2-CE2 4.47Å; R32-Y38 HydrophobicContact CB-CD1 4.08Å; R32-Y38 HydrophobicContact CB-CG 3.88Å; R32-Y38 HydrophobicContact CG-CD1 3.63Å; R32-Y38 HydrophobicContact CG-CD2 4.04Å; R32-Y38 HydrophobicContact CG-CE1 3.93Å; R32-Y38 HydrophobicContact CG-CE2 4.36Å; R32-Y38 HydrophobicContact CG-CG 3.67Å; R32-Y38 VanDerWaalsContact O-CB 3.3Å; R32-Y38 WeakPolarHBondContact O-CB 3.46Å; H35-Y38 HydrophobicContact CB-CD2 4.06Å; H35-Y38 AromaticContact CG-CD2 4Å; H35-Y38 AromaticContact ND1-CD2 3.72Å; H35-Y38 CarbonylContact O-C 3.49Å; H35-Y38 PolarHBondContact O-N 3.22Å; P36-Y38 VanDerWaalsContact C-N 3.26Å; P36-Y38 PolarHBondContact O-N 2.88Å; Y38-N40 PolarHBondContact O-N 3.23Å
39	N	67.8	Low	79.3	Confident	70 Å²	70	98.8 Å²	98.8	37%	0.374	51%	0.509	S	S	.	.			trans	-65.1	130.4	167.7	100	30.2	0	0	0	107.6	H35 P36 E41	H35-N39 PolarHBondContact O-N 2.84Å; H35-N39 VanDerWaalsContact O-N 3.13Å; P36-N39 PolarHBondContact O-N 3.35Å; N39-E41 PolarHBondContact O-N 2.84Å; N39-E41 WeakPolarHBondContact OD1-CA 3.42Å; N39-E41 VanDerWaalsContact OD1-CB 3.26Å; N39-E41 WeakPolarHBondContact OD1-CB 3.47Å; N39-E41 PolarHBondContact OD1-N 2.75Å
40	N	69.8	Low	79.8	Confident	152 Å²	152	95.9 Å²	95.9	81%	0.813	49%	0.489	S	S	*	.			trans	-85.7	13.9	172.7	-72.4	-39.4	0	0	0	111.4	Y38 L42	Y38-N40 PolarHBondContact O-N 3.23Å; N40-L42 PolarHBondContact O-N 2.8Å
41	E	70.8	Confident	80.1	Confident	114 Å²	114	92.2 Å²	92.2	53%	0.533	48%	0.477	S	S	.	.			trans	-78.1	68.9	-179.8	-64.6	-63.6	157.3	0	0	109.7	N39 T43	N39-E41 PolarHBondContact O-N 2.84Å; N39-E41 WeakPolarHBondContact OD1-CA 3.42Å; N39-E41 VanDerWaalsContact OD1-CB 3.26Å; N39-E41 WeakPolarHBondContact OD1-CB 3.47Å; N39-E41 PolarHBondContact OD1-N 2.75Å; E41-T43 PolarHBondContact O-N 2.96Å; E41-T43 PolarHBondContact OE2-OG1 2.9Å
42	L	73.3	Confident	80.4	Confident	111 Å²	111	86.9 Å²	86.9	58%	0.581	45%	0.452	S	S	*	.	G	3₁₀ helix	trans	-70.3	-7.7	175.7	-62.2	177.7	0	0	0	112.5	N40 Q44 F45 L46	N40-L42 PolarHBondContact O-N 2.8Å; L42-Q44 PolarHBondContact O-N 2.98Å; L42-F45 HydrophobicContact CD2-CD2 4.13Å; L42-F45 WeakPolarHBondContact O-CA 3.48Å; L42-F45 PolarHBondContact O-N 2.83Å; L42-L46 PolarHBondContact O-N 2.85Å
43	T	76.8	Confident	80.6	Confident	92 Å²	92	90.5 Å²	90.5	56%	0.564	47%	0.47	S	S	*	.	G	3₁₀ helix	trans	-51.8	-36.7	178.8	51.5	0	0	0	0	112.1	E41 F45 L46	E41-T43 PolarHBondContact O-N 2.96Å; E41-T43 PolarHBondContact OE2-OG1 2.9Å; T43-F45 PolarHBondContact O-N 3.31Å; T43-L46 PolarHBondContact O-N 3.06Å
44	Q	75.1	Confident	80.9	Confident	89 Å²	89	88.2 Å²	88.2	42%	0.416	45%	0.451	S	S	.	.	G	3₁₀ helix	trans	-65.4	-25	177	70.9	-179.4	29.3	0	0	114	L42 F128	L42-Q44 PolarHBondContact O-N 2.98Å; Q44-F128 WeakPolarHBondContact O-CB 3.44Å
45	F	80.4	Confident	80.9	Confident	75 Å²	75	82.5 Å²	82.5	33%	0.329	43%	0.429	S	S	.	.	G	3₁₀ helix	trans	-97.3	-5.8	179.1	-56.3	-69.2	0	0	0	112.9	L42 T43 R127 F128	L42-F45 HydrophobicContact CD2-CD2 4.13Å; L42-F45 WeakPolarHBondContact O-CA 3.48Å; L42-F45 PolarHBondContact O-N 2.83Å; T43-F45 PolarHBondContact O-N 3.31Å; F45-R127 VanDerWaalsContact O-CG 3.25Å; F45-R127 WeakPolarHBondContact O-CG 3.38Å; F45-F128 HydrophobicContact CD1-CD1 4.18Å; F45-F128 HydrophobicContact CE1-CD1 4.1Å; F45-F128 HydrophobicContact CE1-CE1 4.38Å
46	L	88.1	Confident	80.8	Confident	100 Å²	100	86.7 Å²	86.7	52%	0.524	46%	0.46	S	S	.	.	S	Bend	trans	-72	149.3	174.4	-64.5	-178.5	0	0	0	110.4	L42 T43 R48	L42-L46 PolarHBondContact O-N 2.85Å; T43-L46 PolarHBondContact O-N 3.06Å; L46-R48 PolarHBondContact O-N 3.42Å
47	P	92.6	Very high	80.7	Confident	81 Å²	81	86.5 Å²	86.5	53%	0.526	48%	0.476	S	S	.	.			trans	-57.5	131.2	170.6	-24.2	34.8	0	0	0	111.2	L97 V126	P47-L97 HydrophobicContact CB-CD1 4.04Å; P47-L97 HydrophobicContact CG-CD1 4.1Å; P47-V126 CarbonylContact C-O 3.38Å; P47-V126 VanDerWaalsContact CA-O 3.27Å; P47-V126 WeakPolarHBondContact CA-O 3.43Å
48	R	93.6	Very high	80.8	Confident	67 Å²	67	82.3 Å²	82.3	25%	0.253	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	152.5	175.3	63.1	180	-178.6	-95.8	-2.6	110.8	L46 G89 D94 K125 V126	L46-R48 PolarHBondContact O-N 3.42Å; R48-G89 PolarHBondContact NH2-O 3.4Å; R48-D94 IonicContact CZ-OD1 3.86Å; R48-D94 IonicContact CZ-OD2 2.82Å; R48-D94 IonicContact NH1-OD1 2.62Å; R48-D94 IonicContact NH2-OD1 3.26Å; R48-D94 PolarHBondContact NH2-OD1 2.83Å; R48-D94 IonicContact NH2-OD2 3.85Å; R48-D94 PolarHBondContact NH2-OD2 3.07Å; R48-K125 CarbonylContact O-C 3.5Å; R48-K125 WeakPolarHBondContact O-CA 3.24Å; R48-V126 HydrophobicContact CG-CG2 3.67Å; R48-V126 PolarHBondContact N-O 2.62Å; R48-V126 PolarHBondContact O-N 3.48Å
49	T	94.8	Very high	81.5	Confident	84 Å²	84	86.7 Å²	86.7	52%	0.515	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	129.2	176.4	-62.4	0	0	0	0	109.9	V51 V123 M124	T49-V51 HydrophobicContact CG2-CG2 4.39Å; T49-V123 HydrophobicContact CG2-CG1 3.76Å; T49-M124 CarbonylContact C-O 3.5Å; T49-M124 WeakPolarHBondContact CA-O 3.17Å
50	I	94.1	Very high	82.3	Confident	5 Å²	5	84.9 Å²	84.9	3%	0.026	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	131.6	175.3	-65.5	-170.2	0	0	0	108.2	L52 A88 L90 M124 V126	I50-L52 HydrophobicContact CG2-CD2 3.82Å; I50-L52 HydrophobicContact CG2-CG 3.97Å; I50-A88 HydrophobicContact CG2-CB 3.74Å; I50-L90 HydrophobicContact CD1-CB 3.93Å; I50-L90 HydrophobicContact CD1-CD1 3.7Å; I50-L90 HydrophobicContact CD1-CG 4.46Å; I50-M124 HydrophobicContact CB-CG 3.92Å; I50-M124 HydrophobicContact CG2-CG 4.39Å; I50-M124 PolarHBondContact N-O 3.15Å; I50-M124 PolarHBondContact O-N 2.95Å; I50-V126 HydrophobicContact CD1-CG2 3.7Å; I50-V126 HydrophobicContact CG1-CG2 3.97Å
51	V	93.4	Very high	83.2	Confident	73 Å²	73	78.1 Å²	78.1	44%	0.442	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	119.6	177.8	-176.8	0	0	0	0	108.5	T49 E121 I122 V123	T49-V51 HydrophobicContact CG2-CG2 4.39Å; V51-E121 HydrophobicContact CG1-CG 4.36Å; V51-I122 CarbonylContact C-O 3.2Å; V51-I122 WeakPolarHBondContact CA-O 3.1Å; V51-V123 HydrophobicContact CG1-CG2 4.27Å; V51-V123 HydrophobicContact CG2-CG1 4.33Å; V51-V123 HydrophobicContact CG2-CG2 4.23Å
52	L	91.9	Very high	84.3	Confident	6 Å²	6	73.6 Å²	73.6	3%	0.031	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	132.7	177.2	-54	177.6	0	0	0	109.6	I50 F62 A85 A88 E121 I122 M124	I50-L52 HydrophobicContact CG2-CD2 3.82Å; I50-L52 HydrophobicContact CG2-CG 3.97Å; L52-F62 HydrophobicContact CD1-CD1 4.26Å; L52-F62 HydrophobicContact CD1-CE1 3.61Å; L52-F62 HydrophobicContact CD1-CZ 4.49Å; L52-A85 HydrophobicContact CD1-CB 4.2Å; L52-A85 HydrophobicContact CD2-CB 4.39Å; L52-A88 HydrophobicContact CD2-CB 3.49Å; L52-A88 VanDerWaalsContact CD2-CB 3.49Å; L52-E121 WeakPolarHBondContact O-CA 3.34Å; L52-I122 HydrophobicContact CB-CB 4.3Å; L52-I122 PolarHBondContact N-O 3.02Å; L52-I122 PolarHBondContact O-N 3.46Å; L52-M124 HydrophobicContact CD1-CE 3.8Å
53	K	88.4	Confident	85.2	Confident	148 Å²	148	72.7 Å²	72.7	64%	0.643	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.8	118.7	171.2	-66.6	-176.7	179.5	-179.1	0	107.7	P55 E121	K53-P55 VanDerWaalsContact O-CD 3.23Å; K53-P55 WeakPolarHBondContact O-CD 3.4Å; K53-E121 WeakPolarHBondContact CE-OE1 3.37Å; K53-E121 HydrophobicContact CG-CG 4.49Å
54	K	81.9	Confident	86	Confident	62 Å²	62	69.7 Å²	69.7	27%	0.27	39%	0.393	S	S	.	.			trans	-79.4	114.2	179.7	-176.3	177	178.1	169	0	109.3	L60 K117 A119 R120	K54-L60 HydrophobicContact CB-CD2 4.07Å; K54-L60 HydrophobicContact CD-CD2 3.99Å; K54-L60 HydrophobicContact CG-CD2 3.97Å; K54-K117 PolarHBondContact NZ-O 3.24Å; K54-A119 WeakPolarHBondContact CD-O 3.38Å; K54-R120 VanDerWaalsContact CB-O 3.32Å; K54-R120 WeakPolarHBondContact CB-O 3.39Å; K54-R120 PolarHBondContact N-O 3.34Å
55	P	76.8	Confident	86.7	Confident	49 Å²	49	67.3 Å²	67.3	32%	0.318	38%	0.38	S	S	.	.			trans	-66.2	147.1	173.1	-8.7	21.8	0	0	0	110.5	K53 G57 A58	K53-P55 VanDerWaalsContact O-CD 3.23Å; K53-P55 WeakPolarHBondContact O-CD 3.4Å; P55-G57 PolarHBondContact O-N 3.01Å; P55-A58 HydrophobicContact CB-CB 3.69Å; P55-A58 HydrophobicContact CG-CB 3.66Å; P55-A58 PolarHBondContact O-N 3.46Å; P55-A58 VanDerWaalsContact O-N 3.11Å
56	P	74.9	Confident	87.1	Confident	137 Å²	137	64.6 Å²	64.6	89%	0.89	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	122.8	174.9	-21.7	31.8	0	0	0	111	A58	P56-A58 VanDerWaalsContact C-N 3.27Å; P56-A58 PolarHBondContact O-N 3.04Å
57	G	71.3	Confident	87	Confident	90 Å²	90	59.9 Å²	59.9	93%	0.928	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.6	-1.9	179.1	0	0	0	0	0	115.9	P55	P55-G57 PolarHBondContact O-N 3.01Å
58	A	74.5	Confident	86.6	Confident	37 Å²	37	61.7 Å²	61.7	31%	0.306	35%	0.348	S	S	.	.			trans	-93.6	151.9	179.2	0	0	0	0	0	112.8	P55 P56	P55-A58 HydrophobicContact CB-CB 3.69Å; P55-A58 HydrophobicContact CG-CB 3.66Å; P55-A58 PolarHBondContact O-N 3.46Å; P55-A58 VanDerWaalsContact O-N 3.11Å; P56-A58 VanDerWaalsContact C-N 3.27Å; P56-A58 PolarHBondContact O-N 3.04Å
59	Q	81.4	Confident	85.9	Confident	178 Å²	178	63 Å²	63	83%	0.832	37%	0.373	S	S	*	.			trans	-79	154.6	171.2	-62.8	-179.6	3	0	0	110.1	G61	Q59-G61 PolarHBondContact O-N 3.37Å
60	L	83.8	Confident	84.9	Confident	33 Å²	33	61 Å²	61	17%	0.173	36%	0.363	C	S	.	.			trans	-69.2	-15.1	179.9	-64.7	175.8	0	0	0	113.7	K54 F62 L116 I122	K54-L60 HydrophobicContact CB-CD2 4.07Å; K54-L60 HydrophobicContact CD-CD2 3.99Å; K54-L60 HydrophobicContact CG-CD2 3.97Å; L60-F62 HydrophobicContact CB-CD1 3.83Å; L60-F62 HydrophobicContact CB-CE1 3.53Å; L60-F62 HydrophobicContact CB-CZ 4.23Å; L60-F62 HydrophobicContact CD1-CE1 4.03Å; L60-F62 HydrophobicContact CD1-CZ 3.95Å; L60-F62 HydrophobicContact CG-CE1 4.32Å; L60-F62 WeakPolarHBondContact O-CD1 3.37Å; L60-L116 HydrophobicContact CD1-CB 4.04Å; L60-I122 HydrophobicContact CD1-CD1 3.73Å; L60-I122 HydrophobicContact CD2-CD1 3.52Å; L60-I122 HydrophobicContact CG-CD1 4.28Å
61	G	89.6	Confident	84.1	Confident	10 Å²	10	68.7 Å²	68.7	10%	0.103	40%	0.398	C	S	.	.	S	Bend	trans	77	18.2	177.9	0	0	0	0	0	114.4	Q59 V80 S83	Q59-G61 PolarHBondContact O-N 3.37Å; G61-V80 WeakPolarHBondContact O-CB 3.32Å; G61-V80 WeakPolarHBondContact O-CG2 3.43Å; G61-V80 PolarHBondContact O-N 3.42Å; G61-S83 PolarHBondContact O-OG 3.41Å
62	F	93.6	Very high	83.4	Confident	19 Å²	19	67.3 Å²	67.3	8%	0.083	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.7	159.2	172	66.5	-89.6	0	0	0	111.7	L52 L60 I64 I76 K78 V79 A85 L90 L116 M124	L52-F62 HydrophobicContact CD1-CD1 4.26Å; L52-F62 HydrophobicContact CD1-CE1 3.61Å; L52-F62 HydrophobicContact CD1-CZ 4.49Å; L60-F62 HydrophobicContact CB-CD1 3.83Å; L60-F62 HydrophobicContact CB-CE1 3.53Å; L60-F62 HydrophobicContact CB-CZ 4.23Å; L60-F62 HydrophobicContact CD1-CE1 4.03Å; L60-F62 HydrophobicContact CD1-CZ 3.95Å; L60-F62 HydrophobicContact CG-CE1 4.32Å; L60-F62 WeakPolarHBondContact O-CD1 3.37Å; F62-I64 HydrophobicContact CD2-CG2 3.84Å; F62-I64 HydrophobicContact CE2-CG2 3.58Å; F62-I76 HydrophobicContact CB-CG2 4.39Å; F62-I76 HydrophobicContact CD2-CD1 3.75Å; F62-I76 HydrophobicContact CE2-CD1 3.95Å; F62-K78 CarbonylContact C-O 3.6Å; F62-K78 WeakPolarHBondContact CA-O 3.3Å; F62-K78 WeakPolarHBondContact CB-O 3.48Å; F62-V79 HydrophobicContact CB-CG2 4.22Å; F62-A85 HydrophobicContact CB-CB 4.38Å; F62-A85 HydrophobicContact CD1-CB 3.72Å; F62-A85 HydrophobicContact CG-CB 4.48Å; F62-L90 HydrophobicContact CB-CD2 3.83Å; F62-L90 HydrophobicContact CD1-CD2 3.68Å; F62-L90 HydrophobicContact CD2-CD2 4.04Å; F62-L90 HydrophobicContact CE1-CD2 4.2Å; F62-L90 HydrophobicContact CG-CD2 3.58Å; F62-L116 HydrophobicContact CE2-CD1 4.34Å; F62-L116 HydrophobicContact CZ-CD2 4.31Å; F62-M124 HydrophobicContact CE1-CE 4.25Å; F62-M124 HydrophobicContact CZ-CE 3.85Å
63	N	92.8	Very high	83.2	Confident	92 Å²	92	67.4 Å²	67.4	49%	0.492	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	146.7	174.8	-69.2	-11.2	0	0	0	110	I76 S77 K78	N63-I76 WeakPolarHBondContact O-CA 3.43Å; N63-S77 WeakPolarHBondContact CB-OG 3.19Å; N63-S77 PolarHBondContact O-N 3.33Å; N63-S77 PolarHBondContact O-OG 3.36Å; N63-K78 HydrophobicContact CB-CB 4.23Å; N63-K78 PolarHBondContact N-O 2.86Å
64	I	92.4	Very high	83.4	Confident	29 Å²	29	60.4 Å²	60.4	15%	0.149	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	158	173.3	65.7	163.9	0	0	0	110.8	F62 I74 F75 I76 A112 V113 L116	F62-I64 HydrophobicContact CD2-CG2 3.84Å; F62-I64 HydrophobicContact CE2-CG2 3.58Å; I64-I74 HydrophobicContact CB-CG2 4.01Å; I64-I74 HydrophobicContact CD1-CG2 4.06Å; I64-I74 HydrophobicContact CG2-CG2 4.24Å; I64-F75 CarbonylContact C-O 3.48Å; I64-F75 VanDerWaalsContact CA-O 3.29Å; I64-F75 WeakPolarHBondContact CA-O 3.48Å; I64-I76 HydrophobicContact CG2-CD1 3.99Å; I64-A112 HydrophobicContact CD1-CB 4.12Å; I64-V113 HydrophobicContact CD1-CG2 3.85Å; I64-V113 HydrophobicContact CG1-CG2 4.35Å; I64-L116 HydrophobicContact CD1-CD1 3.91Å; I64-L116 HydrophobicContact CG2-CD1 4.13Å
65	R	90.3	Very high	83.9	Confident	38 Å²	38	57.6 Å²	57.6	14%	0.143	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.7	167.7	171.1	64.8	-178.8	179.9	137.9	8.9	110.7	F75 Y133 K137	R65-F75 HydrophobicContact CG-CB 4.42Å; R65-F75 PolarHBondContact N-O 3.17Å; R65-F75 PolarHBondContact O-N 3.47Å; R65-Y133 PolarHBondContact NH2-O 3.29Å; R65-K137 VanDerWaalsContact NH1-N 3.17Å; R65-K137 VanDerWaalsContact NH2-CG 3.34Å
66	G	89.1	Confident	84.7	Confident	18 Å²	18	55.2 Å²	55.2	19%	0.186	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	87.3	-154.6	-177.7	0	0	0	0	0	113.1	S70 H109	G66-S70 VanDerWaalsContact CA-OG 3.29Å; G66-S70 WeakPolarHBondContact CA-OG 3.36Å; G66-H109 WeakPolarHBondContact O-CB 3.19Å; G66-H109 PolarHBondContact O-ND1 3.03Å
67	G	85.9	Confident	85.5	Confident	1 Å²	1	50 Å²	50	1%	0.01	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	113.8	171.9	-171.7	0	0	0	0	0	110.9	A69 S70 L72 G73 I107	G67-A69 VanDerWaalsContact C-N 3.26Å; G67-A69 PolarHBondContact O-N 2.96Å; G67-S70 PolarHBondContact N-OG 2.95Å; G67-S70 PolarHBondContact O-N 3.36Å; G67-S70 PolarHBondContact O-OG 3.39Å; G67-L72 CarbonylContact C-O 3.6Å; G67-L72 WeakPolarHBondContact CA-O 3.25Å; G67-L72 PolarHBondContact N-O 2.96Å; G67-G73 PolarHBondContact N-O 2.98Å; G67-I107 WeakPolarHBondContact CA-O 3.34Å
68	K	84.9	Confident	86.5	Confident	119 Å²	119	51.7 Å²	51.7	52%	0.517	28%	0.282	S	S	.	.	G	3₁₀ helix	trans	-48.6	-41.8	-170.2	-167.3	177.5	-178.3	-179.1	0	114.7	S70 Q71 I107 E108	K68-S70 PolarHBondContact O-N 3.18Å; K68-Q71 PolarHBondContact O-N 3.29Å; K68-I107 PolarHBondContact N-O 2.99Å; K68-E108 WeakPolarHBondContact CD-OE1 3.36Å
69	A	78.6	Confident	87.4	Confident	94 Å²	94	51 Å²	51	78%	0.777	27%	0.274	S	S	*	.	G	3₁₀ helix	trans	-58.2	-28.8	177.3	0	0	0	0	0	114.3	G67 Q71	G67-A69 VanDerWaalsContact C-N 3.26Å; G67-A69 PolarHBondContact O-N 2.96Å; A69-Q71 VanDerWaalsContact C-N 3.31Å
70	S	74.1	Confident	88	Confident	42 Å²	42	45.8 Å²	45.8	29%	0.294	25%	0.254	S	S	.	.	G	3₁₀ helix	trans	-87.2	2.6	176.8	67.5	0	0	0	0	113.9	G66 G67 K68 L72	G66-S70 VanDerWaalsContact CA-OG 3.29Å; G66-S70 WeakPolarHBondContact CA-OG 3.36Å; G67-S70 PolarHBondContact N-OG 2.95Å; G67-S70 PolarHBondContact O-N 3.36Å; G67-S70 PolarHBondContact O-OG 3.39Å; K68-S70 PolarHBondContact O-N 3.18Å; S70-L72 WeakPolarHBondContact O-CG 3.23Å; S70-L72 PolarHBondContact O-N 3.34Å; S70-L72 VanDerWaalsContact O-N 3.1Å; S70-L72 PolarHBondContact OG-O 3.44Å
71	Q	77.4	Confident	88.4	Confident	167 Å²	167	48.6 Å²	48.6	78%	0.78	27%	0.274	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.8	25.1	-171.9	-60.1	176.8	-8.2	0	0	113.1	K68 A69	K68-Q71 PolarHBondContact O-N 3.29Å; A69-Q71 VanDerWaalsContact C-N 3.31Å
72	L	77.8	Confident	88.4	Confident	44 Å²	44	54.1 Å²	54.1	23%	0.23	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	145.2	-176	-67.4	168.1	0	0	0	107.5	G67 S70 Q136	G67-L72 CarbonylContact C-O 3.6Å; G67-L72 WeakPolarHBondContact CA-O 3.25Å; G67-L72 PolarHBondContact N-O 2.96Å; S70-L72 WeakPolarHBondContact O-CG 3.23Å; S70-L72 PolarHBondContact O-N 3.34Å; S70-L72 VanDerWaalsContact O-N 3.1Å; S70-L72 PolarHBondContact OG-O 3.44Å; L72-Q136 HydrophobicContact CD1-CB 3.77Å; L72-Q136 HydrophobicContact CD1-CG 3.58Å
73	G	87	Confident	88.2	Confident	9 Å²	9	53.9 Å²	53.9	9%	0.093	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.4	-178.9	178.1	0	0	0	0	0	113.5	G67 F75	G67-G73 PolarHBondContact N-O 2.98Å; G73-F75 WeakPolarHBondContact O-CD2 3.27Å
74	I	92.9	Very high	88.1	Confident	0 Å²	0	52.7 Å²	52.7	0%	0	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	127.2	174.8	-59.9	-67.9	0	0	0	109.8	I64 V96 F104 I107 A112	I64-I74 HydrophobicContact CB-CG2 4.01Å; I64-I74 HydrophobicContact CD1-CG2 4.06Å; I64-I74 HydrophobicContact CG2-CG2 4.24Å; I74-V96 HydrophobicContact CB-CB 4.31Å; I74-V96 HydrophobicContact CG2-CB 4.19Å; I74-V96 HydrophobicContact CG2-CG2 4.11Å; I74-V96 PolarHBondContact O-N 2.94Å; I74-F104 HydrophobicContact CB-CD1 4.37Å; I74-F104 HydrophobicContact CG1-CD1 4.18Å; I74-F104 HydrophobicContact CG2-CD1 4.44Å; I74-I107 HydrophobicContact CD1-CG2 4.16Å; I74-I107 HydrophobicContact CG1-CG2 3.6Å; I74-A112 HydrophobicContact CD1-CB 3.94Å; I74-A112 HydrophobicContact CG1-CB 4.17Å
75	F	92.7	Very high	88.1	Confident	3 Å²	3	51.3 Å²	51.3	1%	0.013	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	150.4	177.3	-69.1	-97.1	0	0	0	112.4	I64 R65 G73 S77 D94 Q95 F129 N132 Y133 Q136	I64-F75 CarbonylContact C-O 3.48Å; I64-F75 VanDerWaalsContact CA-O 3.29Å; I64-F75 WeakPolarHBondContact CA-O 3.48Å; R65-F75 HydrophobicContact CG-CB 4.42Å; R65-F75 PolarHBondContact N-O 3.17Å; R65-F75 PolarHBondContact O-N 3.47Å; G73-F75 WeakPolarHBondContact O-CD2 3.27Å; F75-S77 PolarHBondContact O-N 2.69Å; F75-D94 CarbonylContact C-O 3.57Å; F75-D94 WeakPolarHBondContact CA-O 3.47Å; F75-Q95 HydrophobicContact CD1-CB 3.83Å; F75-Q95 HydrophobicContact CD1-CG 4.24Å; F75-Q95 HydrophobicContact CE1-CB 3.55Å; F75-Q95 HydrophobicContact CE1-CG 3.83Å; F75-Q95 HydrophobicContact CE2-CG 4.26Å; F75-Q95 HydrophobicContact CZ-CB 4.08Å; F75-Q95 HydrophobicContact CZ-CG 3.82Å; F75-F129 HydrophobicContact CE1-CB 4.49Å; F75-N132 HydrophobicContact CE1-CB 4.13Å; F75-N132 HydrophobicContact CZ-CB 3.76Å; F75-Y133 HydrophobicContact CB-CD2 3.81Å; F75-Y133 HydrophobicContact CB-CE2 4.31Å; F75-Y133 HydrophobicContact CD1-CD2 4.18Å; F75-Y133 HydrophobicContact CG-CD2 4.23Å; F75-Q136 VanDerWaalsContact CD2-OE1 3.23Å
76	I	93.9	Very high	88.2	Confident	0 Å²	0	53.9 Å²	53.9	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	116.7	172.4	-53.7	-52.8	0	0	0	109.5	F62 N63 I64 V79 L90 G93 D94 V96 Y133	F62-I76 HydrophobicContact CB-CG2 4.39Å; F62-I76 HydrophobicContact CD2-CD1 3.75Å; F62-I76 HydrophobicContact CE2-CD1 3.95Å; N63-I76 WeakPolarHBondContact O-CA 3.43Å; I64-I76 HydrophobicContact CG2-CD1 3.99Å; I76-V79 HydrophobicContact CG2-CG2 3.51Å; I76-L90 HydrophobicContact CD1-CD1 4.27Å; I76-L90 HydrophobicContact CD1-CD2 4.01Å; I76-L90 HydrophobicContact CD1-CG 4.47Å; I76-L90 HydrophobicContact CG1-CD1 3.89Å; I76-L90 HydrophobicContact CG1-CD2 4.13Å; I76-L90 HydrophobicContact CG1-CG 4.07Å; I76-L90 HydrophobicContact CG2-CD2 4.2Å; I76-L90 HydrophobicContact CG2-CG 4.33Å; I76-G93 PolarHBondContact O-N 2.7Å; I76-G93 VanDerWaalsContact O-N 3.11Å; I76-D94 HydrophobicContact CB-CB 4.31Å; I76-D94 HydrophobicContact CG1-CB 3.85Å; I76-D94 PolarHBondContact N-O 3.33Å; I76-V96 HydrophobicContact CD1-CG2 3.73Å; I76-V96 HydrophobicContact CG1-CG2 4.34Å; I76-Y133 WeakPolarHBondContact O-CE2 3.48Å
77	S	91.7	Very high	88.3	Confident	27 Å²	27	60.7 Å²	60.7	19%	0.189	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	-29.4	-176.8	62.9	0	0	0	0	114.6	N63 F75 E92 Y133	N63-S77 WeakPolarHBondContact CB-OG 3.19Å; N63-S77 PolarHBondContact O-N 3.33Å; N63-S77 PolarHBondContact O-OG 3.36Å; F75-S77 PolarHBondContact O-N 2.69Å; S77-E92 VanDerWaalsContact O-CD 3.29Å; S77-E92 WeakPolarHBondContact O-CG 3.22Å; S77-Y133 VanDerWaalsContact CA-OH 3.24Å; S77-Y133 WeakPolarHBondContact CA-OH 3.25Å; S77-Y133 PolarHBondContact O-OH 3.25Å
78	K	92.3	Very high	88.5	Confident	125 Å²	125	62.6 Å²	62.6	54%	0.543	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.5	142.3	178.3	-172.3	172	-178.2	175.1	0	108.7	F62 N63	F62-K78 CarbonylContact C-O 3.6Å; F62-K78 WeakPolarHBondContact CA-O 3.3Å; F62-K78 WeakPolarHBondContact CB-O 3.48Å; N63-K78 HydrophobicContact CB-CB 4.23Å; N63-K78 PolarHBondContact N-O 2.86Å
79	V	94.1	Very high	88.8	Confident	24 Å²	24	58.7 Å²	58.7	15%	0.145	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	134.1	169.2	-175.6	0	0	0	0	107.8	F62 I76 A85 H86 L90	F62-V79 HydrophobicContact CB-CG2 4.22Å; I76-V79 HydrophobicContact CG2-CG2 3.51Å; V79-A85 HydrophobicContact CG1-CB 4.16Å; V79-H86 HydrophobicContact CG1-CB 3.94Å; V79-L90 HydrophobicContact CG2-CB 4.49Å; V79-L90 HydrophobicContact CG2-CD2 4.27Å; V79-L90 HydrophobicContact CG2-CG 4.24Å
80	V	93	Very high	89.6	Confident	68 Å²	68	54.3 Å²	54.3	41%	0.412	30%	0.295	S	S	.	.			trans	-76.4	125.4	177.8	178.8	0	0	0	0	107.8	G61 S83 H86	G61-V80 WeakPolarHBondContact O-CB 3.32Å; G61-V80 WeakPolarHBondContact O-CG2 3.43Å; G61-V80 PolarHBondContact O-N 3.42Å; V80-S83 VanDerWaalsContact O-CB 3.24Å; V80-S83 WeakPolarHBondContact O-CB 3.48Å; V80-S83 PolarHBondContact O-N 3.17Å; V80-S83 PolarHBondContact O-OG 3.13Å; V80-H86 WeakPolarHBondContact O-CB 3.41Å
81	P	91.8	Very high	90.5	Very high	92 Å²	92	56.3 Å²	56.3	60%	0.597	30%	0.3	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54	145.2	174.2	-25	34.5	0	0	0	111.2	S83	P81-S83 PolarHBondContact O-N 3.24Å
82	D	89.3	Confident	91.2	Very high	125 Å²	125	52.4 Å²	52.4	67%	0.668	28%	0.281	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.5	18.3	-179	-53.1	-38.9	0	0	0	115.8	H86 R87	D82-H86 PolarHBondContact N-ND1 3.34Å; D82-R87 PolarHBondContact O-NH1 3.18Å
83	S	90.7	Very high	91.8	Very high	15 Å²	15	50.4 Å²	50.4	11%	0.105	27%	0.271	C	S	.	.	S	Bend	trans	-79.1	165.6	167.7	66.3	0	0	0	0	111.8	G61 V80 P81 A85 H86 R87	G61-S83 PolarHBondContact O-OG 3.41Å; V80-S83 VanDerWaalsContact O-CB 3.24Å; V80-S83 WeakPolarHBondContact O-CB 3.48Å; V80-S83 PolarHBondContact O-N 3.17Å; V80-S83 PolarHBondContact O-OG 3.13Å; P81-S83 PolarHBondContact O-N 3.24Å; S83-A85 PolarHBondContact O-N 3.02Å; S83-H86 PolarHBondContact O-N 3.02Å; S83-H86 PolarHBondContact OG-N 3.24Å; S83-H86 VanDerWaalsContact OG-N 3.13Å; S83-R87 PolarHBondContact O-N 2.8Å
84	D	90	Very high	92.2	Very high	66 Å²	66	50 Å²	50	35%	0.353	27%	0.267	S	S	.	.	H	α-helix	trans	-59	-35.6	171.6	-66.8	-43.5	0	0	0	111.6	R87 A88	D84-R87 PolarHBondContact O-N 2.92Å; D84-R87 IonicContact OD1-CZ 3.96Å; D84-R87 IonicContact OD1-NE 2.74Å; D84-R87 IonicContact OD1-NH2 3.6Å; D84-R87 PolarHBondContact OD1-NH2 2.98Å; D84-A88 VanDerWaalsContact O-CB 3.25Å; D84-A88 WeakPolarHBondContact O-CB 3.26Å; D84-A88 PolarHBondContact O-N 2.79Å
85	A	92.4	Very high	92.2	Very high	0 Å²	0	50.8 Å²	50.8	0%	0	27%	0.271	C	S	.	.	H	α-helix	trans	-63.8	-43.8	174.8	0	0	0	0	0	112.6	L52 F62 V79 S83 A88 G89 L90	L52-A85 HydrophobicContact CD1-CB 4.2Å; L52-A85 HydrophobicContact CD2-CB 4.39Å; F62-A85 HydrophobicContact CB-CB 4.38Å; F62-A85 HydrophobicContact CD1-CB 3.72Å; F62-A85 HydrophobicContact CG-CB 4.48Å; V79-A85 HydrophobicContact CG1-CB 4.16Å; S83-A85 PolarHBondContact O-N 3.02Å; A85-A88 PolarHBondContact O-N 3.5Å; A85-G89 PolarHBondContact O-N 2.88Å; A85-L90 HydrophobicContact CB-CB 4.25Å; A85-L90 HydrophobicContact CB-CD2 3.95Å; A85-L90 WeakPolarHBondContact O-CB 3.44Å; A85-L90 PolarHBondContact O-N 3.37Å
86	H	91.8	Very high	92.3	Very high	93 Å²	93	50.8 Å²	50.8	43%	0.431	27%	0.27	S	S	.	.	H	α-helix	trans	-63	-47.7	175.9	-178.6	-131.3	0	0	0	111.6	V79 V80 D82 S83 A88 G89	V79-H86 HydrophobicContact CG1-CB 3.94Å; V80-H86 WeakPolarHBondContact O-CB 3.41Å; D82-H86 PolarHBondContact N-ND1 3.34Å; S83-H86 PolarHBondContact O-N 3.02Å; S83-H86 PolarHBondContact OG-N 3.24Å; S83-H86 VanDerWaalsContact OG-N 3.13Å; H86-A88 PolarHBondContact O-N 2.85Å; H86-G89 PolarHBondContact O-N 2.92Å
87	R	91.5	Very high	92.3	Very high	160 Å²	160	52 Å²	52	60%	0.604	28%	0.277	S	S	*	.	H	α-helix	trans	-62.5	-29.9	177.9	-74.8	-170.6	-72.7	-85.7	-3.3	113.2	D82 S83 D84 G89	D82-R87 PolarHBondContact O-NH1 3.18Å; S83-R87 PolarHBondContact O-N 2.8Å; D84-R87 PolarHBondContact O-N 2.92Å; D84-R87 IonicContact OD1-CZ 3.96Å; D84-R87 IonicContact OD1-NE 2.74Å; D84-R87 IonicContact OD1-NH2 3.6Å; D84-R87 PolarHBondContact OD1-NH2 2.98Å; R87-G89 PolarHBondContact O-N 2.82Å
88	A	91.2	Very high	92.5	Very high	41 Å²	41	51.9 Å²	51.9	34%	0.339	28%	0.276	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81	0.4	176.8	0	0	0	0	0	113.7	I50 L52 D84 A85 H86	I50-A88 HydrophobicContact CG2-CB 3.74Å; L52-A88 HydrophobicContact CD2-CB 3.49Å; L52-A88 VanDerWaalsContact CD2-CB 3.49Å; D84-A88 VanDerWaalsContact O-CB 3.25Å; D84-A88 WeakPolarHBondContact O-CB 3.26Å; D84-A88 PolarHBondContact O-N 2.79Å; A85-A88 PolarHBondContact O-N 3.5Å; H86-A88 PolarHBondContact O-N 2.85Å
89	G	91.2	Very high	92.6	Very high	37 Å²	37	46 Å²	46	38%	0.381	25%	0.25	S	S	.	.	T	Hydrogen-bonded Turn	trans	82.5	21.6	177.7	0	0	0	0	0	114.5	R48 A85 H86 R87	R48-G89 PolarHBondContact NH2-O 3.4Å; A85-G89 PolarHBondContact O-N 2.88Å; H86-G89 PolarHBondContact O-N 2.92Å; R87-G89 PolarHBondContact O-N 2.82Å
90	L	94.2	Very high	92.5	Very high	3 Å²	3	47.7 Å²	47.7	2%	0.016	26%	0.259	C	S	.	.			trans	-76.2	134.4	169.5	-164.8	73.5	0	0	0	109	I50 F62 I76 V79 A85 D94 M124 V126	I50-L90 HydrophobicContact CD1-CB 3.93Å; I50-L90 HydrophobicContact CD1-CD1 3.7Å; I50-L90 HydrophobicContact CD1-CG 4.46Å; F62-L90 HydrophobicContact CB-CD2 3.83Å; F62-L90 HydrophobicContact CD1-CD2 3.68Å; F62-L90 HydrophobicContact CD2-CD2 4.04Å; F62-L90 HydrophobicContact CE1-CD2 4.2Å; F62-L90 HydrophobicContact CG-CD2 3.58Å; I76-L90 HydrophobicContact CD1-CD1 4.27Å; I76-L90 HydrophobicContact CD1-CD2 4.01Å; I76-L90 HydrophobicContact CD1-CG 4.47Å; I76-L90 HydrophobicContact CG1-CD1 3.89Å; I76-L90 HydrophobicContact CG1-CD2 4.13Å; I76-L90 HydrophobicContact CG1-CG 4.07Å; I76-L90 HydrophobicContact CG2-CD2 4.2Å; I76-L90 HydrophobicContact CG2-CG 4.33Å; V79-L90 HydrophobicContact CG2-CB 4.49Å; V79-L90 HydrophobicContact CG2-CD2 4.27Å; V79-L90 HydrophobicContact CG2-CG 4.24Å; A85-L90 HydrophobicContact CB-CB 4.25Å; A85-L90 HydrophobicContact CB-CD2 3.95Å; A85-L90 WeakPolarHBondContact O-CB 3.44Å; A85-L90 PolarHBondContact O-N 3.37Å; L90-D94 HydrophobicContact CD1-CB 4.44Å; L90-M124 HydrophobicContact CD1-SD 4.03Å; L90-V126 HydrophobicContact CD1-CG1 4.05Å
91	Q	93.3	Very high	92.4	Very high	84 Å²	84	52.2 Å²	52.2	39%	0.393	28%	0.281	S	S	.	.			trans	-135.8	162.3	179.6	63.6	-176.7	74.5	0	0	112.4	D94 F128	Q91-D94 WeakPolarHBondContact CG-OD2 3.29Å; Q91-D94 PolarHBondContact N-OD2 2.88Å; Q91-D94 WeakPolarHBondContact O-CB 3.34Å; Q91-D94 PolarHBondContact O-N 3.03Å; Q91-F128 HydrophobicContact CG-CD2 4.08Å; Q91-F128 HydrophobicContact CG-CE2 4.39Å
92	E	92.9	Very high	92.4	Very high	85 Å²	85	50.8 Å²	50.8	40%	0.397	27%	0.27	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.8	136.9	172.6	-175.4	177.3	175	0	0	110.6	S77 Y133 K137	S77-E92 VanDerWaalsContact O-CD 3.29Å; S77-E92 WeakPolarHBondContact O-CG 3.22Å; E92-Y133 VanDerWaalsContact CD-OH 3.3Å; E92-Y133 HydrophobicContact CG-CE1 3.57Å; E92-Y133 HydrophobicContact CG-CE2 4.16Å; E92-Y133 VanDerWaalsContact CG-OH 3.3Å; E92-Y133 WeakPolarHBondContact CG-OH 3.4Å; E92-Y133 WeakPolarHBondContact OE1-CE1 3.34Å; E92-Y133 PolarHBondContact OE1-OH 3.36Å; E92-K137 WeakPolarHBondContact OE1-CE 3.49Å; E92-K137 IonicContact OE1-NZ 3.87Å; E92-K137 PolarHBondContact OE1-NZ 3.27Å
93	G	90.8	Very high	92.5	Very high	1 Å²	1	48.7 Å²	48.7	1%	0.01	26%	0.259	C	S	.	.	T	Hydrogen-bonded Turn	trans	89.2	-2	-175.6	0	0	0	0	0	114.7	I76 Q95 F129	I76-G93 PolarHBondContact O-N 2.7Å; I76-G93 VanDerWaalsContact O-N 3.11Å; G93-Q95 PolarHBondContact O-N 3.1Å; G93-F129 CarbonylContact O-C 3.51Å; G93-F129 PolarHBondContact O-N 3.09Å
94	D	93.9	Very high	92.7	Very high	0 Å²	0	48 Å²	48	0%	0	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.3	130.5	165.9	-75.4	-23.7	0	0	0	110.6	R48 F75 I76 L90 Q91 V126 R127 F128	R48-D94 IonicContact CZ-OD1 3.86Å; R48-D94 IonicContact CZ-OD2 2.82Å; R48-D94 IonicContact NH1-OD1 2.62Å; R48-D94 IonicContact NH2-OD1 3.26Å; R48-D94 PolarHBondContact NH2-OD1 2.83Å; R48-D94 IonicContact NH2-OD2 3.85Å; R48-D94 PolarHBondContact NH2-OD2 3.07Å; F75-D94 CarbonylContact C-O 3.57Å; F75-D94 WeakPolarHBondContact CA-O 3.47Å; I76-D94 HydrophobicContact CB-CB 4.31Å; I76-D94 HydrophobicContact CG1-CB 3.85Å; I76-D94 PolarHBondContact N-O 3.33Å; L90-D94 HydrophobicContact CD1-CB 4.44Å; Q91-D94 WeakPolarHBondContact CG-OD2 3.29Å; Q91-D94 PolarHBondContact N-OD2 2.88Å; Q91-D94 WeakPolarHBondContact O-CB 3.34Å; Q91-D94 PolarHBondContact O-N 3.03Å; D94-V126 HydrophobicContact CB-CB 4.27Å; D94-R127 WeakPolarHBondContact CA-O 3.45Å; D94-F128 VanDerWaalsContact OD1-CA 3.29Å; D94-F128 WeakPolarHBondContact OD1-CA 3.49Å; D94-F128 WeakPolarHBondContact OD1-CB 3.43Å
95	Q	93.7	Very high	92.6	Very high	18 Å²	18	49.5 Å²	49.5	8%	0.084	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	129.6	167.4	-171.3	-177.3	-1.8	0	0	109.2	F75 G93 L97 V126 R127	F75-Q95 HydrophobicContact CD1-CB 3.83Å; F75-Q95 HydrophobicContact CD1-CG 4.24Å; F75-Q95 HydrophobicContact CE1-CB 3.55Å; F75-Q95 HydrophobicContact CE1-CG 3.83Å; F75-Q95 HydrophobicContact CE2-CG 4.26Å; F75-Q95 HydrophobicContact CZ-CB 4.08Å; F75-Q95 HydrophobicContact CZ-CG 3.82Å; G93-Q95 PolarHBondContact O-N 3.1Å; Q95-L97 HydrophobicContact CG-CD2 4.26Å; Q95-V126 CarbonylContact O-C 3.46Å; Q95-V126 WeakPolarHBondContact O-CA 3.13Å; Q95-R127 PolarHBondContact N-O 3Å; Q95-R127 PolarHBondContact O-N 2.58Å
96	V	94.6	Very high	92.4	Very high	2 Å²	2	55.4 Å²	55.4	1%	0.012	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	119.5	173.6	-172.8	0	0	0	0	108.7	I74 I76 V99 F104 V126	I74-V96 HydrophobicContact CB-CB 4.31Å; I74-V96 HydrophobicContact CG2-CB 4.19Å; I74-V96 HydrophobicContact CG2-CG2 4.11Å; I74-V96 PolarHBondContact O-N 2.94Å; I76-V96 HydrophobicContact CD1-CG2 3.73Å; I76-V96 HydrophobicContact CG1-CG2 4.34Å; V96-V99 HydrophobicContact CG1-CG2 3.63Å; V96-F104 HydrophobicContact CB-CB 4.43Å; V96-F104 HydrophobicContact CB-CD1 4.36Å; V96-F104 HydrophobicContact CG1-CB 3.96Å; V96-F104 HydrophobicContact CG1-CD1 3.75Å; V96-F104 HydrophobicContact CG1-CG 3.98Å; V96-V126 HydrophobicContact CG2-CG1 4.36Å
97	L	94.1	Very high	92.3	Very high	27 Å²	27	51.8 Å²	51.8	14%	0.141	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	-41.3	179.7	-56.5	178.9	0	0	0	111.2	P47 Q95 D103 F104 Q105 K125 R127	P47-L97 HydrophobicContact CB-CD1 4.04Å; P47-L97 HydrophobicContact CG-CD1 4.1Å; Q95-L97 HydrophobicContact CG-CD2 4.26Å; L97-D103 VanDerWaalsContact O-OD1 3.08Å; L97-F104 PolarHBondContact O-N 3.26Å; L97-Q105 HydrophobicContact CD2-CG 4.41Å; L97-K125 HydrophobicContact CB-CB 4.42Å; L97-K125 WeakPolarHBondContact CB-O 3.45Å; L97-K125 PolarHBondContact N-O 3.26Å; L97-R127 HydrophobicContact CD1-CB 4.15Å
98	S	95.3	Very high	92.3	Very high	24 Å²	24	48.3 Å²	48.3	17%	0.168	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.1	156.7	176.4	51	0	0	0	0	111.4	V102 M124 K125	S98-V102 CarbonylContact C-O 3.52Å; S98-V102 WeakPolarHBondContact CA-O 3.48Å; S98-V102 WeakPolarHBondContact CB-O 3.34Å; S98-M124 CarbonylContact O-C 3.57Å; S98-M124 WeakPolarHBondContact O-CA 3.44Å; S98-M124 WeakPolarHBondContact O-CB 3Å; S98-K125 PolarHBondContact N-O 3.18Å; S98-K125 PolarHBondContact O-N 3.31Å; S98-K125 WeakPolarHBondContact OG-CB 3.46Å
99	V	95.1	Very high	92.3	Very high	0 Å²	0	50 Å²	50	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	124.6	174.2	-179.4	0	0	0	0	109.2	V96 D101 V102 F104 I115 L116 I122 V123 M124	V96-V99 HydrophobicContact CG1-CG2 3.63Å; V99-D101 PolarHBondContact O-N 3.08Å; V99-V102 PolarHBondContact N-O 3.12Å; V99-V102 WeakPolarHBondContact O-CB 3.26Å; V99-V102 PolarHBondContact O-N 3.22Å; V99-F104 HydrophobicContact CB-CD2 3.97Å; V99-F104 HydrophobicContact CB-CE1 4.3Å; V99-F104 HydrophobicContact CB-CE2 3.45Å; V99-F104 VanDerWaalsContact CB-CE2 3.45Å; V99-F104 HydrophobicContact CB-CZ 3.63Å; V99-F104 HydrophobicContact CG1-CZ 4.43Å; V99-F104 HydrophobicContact CG2-CD1 3.88Å; V99-F104 HydrophobicContact CG2-CD2 3.85Å; V99-F104 HydrophobicContact CG2-CE1 3.59Å; V99-F104 HydrophobicContact CG2-CE2 3.6Å; V99-F104 HydrophobicContact CG2-CG 4Å; V99-F104 HydrophobicContact CG2-CZ 3.45Å; V99-F104 VanDerWaalsContact CG2-CZ 3.45Å; V99-I115 HydrophobicContact CG1-CG2 4.35Å; V99-L116 HydrophobicContact CG1-CD2 4.11Å; V99-L116 HydrophobicContact CG2-CD2 4.11Å; V99-I122 HydrophobicContact CG1-CG2 3.65Å; V99-V123 CarbonylContact C-O 3.58Å; V99-V123 WeakPolarHBondContact CA-O 3.19Å; V99-M124 HydrophobicContact CG2-CB 3.91Å
100	N	92.3	Very high	92.3	Very high	60 Å²	60	52.4 Å²	52.4	32%	0.321	28%	0.276	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.4	48.3	179.7	-64.1	-15.1	0	0	0	111.9	V102 E121 V123	N100-V102 PolarHBondContact O-N 3.23Å; N100-V102 VanDerWaalsContact O-N 3.11Å; N100-E121 PolarHBondContact ND2-O 3.06Å; N100-E121 PolarHBondContact OD1-O 2.67Å; N100-V123 PolarHBondContact N-O 2.66Å; N100-V123 PolarHBondContact OD1-N 3.47Å
101	D	89.6	Confident	92.2	Very high	164 Å²	164	58.2 Å²	58.2	88%	0.877	30%	0.298	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.4	7	-177.9	-53.2	-52.7	0	0	0	116.2	V99	V99-D101 PolarHBondContact O-N 3.08Å
102	V	92.5	Very high	92.2	Very high	61 Å²	61	54.2 Å²	54.2	37%	0.37	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	132.1	169.4	-175.3	0	0	0	0	109.4	S98 V99 N100 F104 I107 I115	S98-V102 CarbonylContact C-O 3.52Å; S98-V102 WeakPolarHBondContact CA-O 3.48Å; S98-V102 WeakPolarHBondContact CB-O 3.34Å; V99-V102 PolarHBondContact N-O 3.12Å; V99-V102 WeakPolarHBondContact O-CB 3.26Å; V99-V102 PolarHBondContact O-N 3.22Å; N100-V102 PolarHBondContact O-N 3.23Å; N100-V102 VanDerWaalsContact O-N 3.11Å; V102-F104 HydrophobicContact CB-CD2 4.49Å; V102-F104 HydrophobicContact CB-CE2 4.17Å; V102-F104 HydrophobicContact CG1-CD2 4.42Å; V102-F104 HydrophobicContact CG1-CE2 4.19Å; V102-F104 WeakPolarHBondContact O-CD2 3.08Å; V102-I107 HydrophobicContact CG1-CD1 4.4Å; V102-I115 HydrophobicContact CB-CD1 4.44Å; V102-I115 HydrophobicContact CG1-CD1 3.9Å
103	D	92.5	Very high	92.1	Very high	81 Å²	81	51.9 Å²	51.9	43%	0.433	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.3	133.3	175.3	-175.8	29.4	0	0	0	111.5	L97 Q105	L97-D103 VanDerWaalsContact O-OD1 3.08Å; D103-Q105 WeakPolarHBondContact OD1-CG 3.36Å; D103-Q105 PolarHBondContact OD1-N 3.48Å; D103-Q105 PolarHBondContact OD1-NE2 3.12Å
104	F	93.8	Very high	92.1	Very high	0 Å²	0	56.5 Å²	56.5	0%	0	29%	0.292	C	S	.	.			trans	-113.8	4.2	-177.3	-90.7	-124.5	0	0	0	112.6	I74 V96 L97 V99 V102 I107 A112 I115 L116	I74-F104 HydrophobicContact CB-CD1 4.37Å; I74-F104 HydrophobicContact CG1-CD1 4.18Å; I74-F104 HydrophobicContact CG2-CD1 4.44Å; V96-F104 HydrophobicContact CB-CB 4.43Å; V96-F104 HydrophobicContact CB-CD1 4.36Å; V96-F104 HydrophobicContact CG1-CB 3.96Å; V96-F104 HydrophobicContact CG1-CD1 3.75Å; V96-F104 HydrophobicContact CG1-CG 3.98Å; L97-F104 PolarHBondContact O-N 3.26Å; V99-F104 HydrophobicContact CB-CD2 3.97Å; V99-F104 HydrophobicContact CB-CE1 4.3Å; V99-F104 HydrophobicContact CB-CE2 3.45Å; V99-F104 VanDerWaalsContact CB-CE2 3.45Å; V99-F104 HydrophobicContact CB-CZ 3.63Å; V99-F104 HydrophobicContact CG1-CZ 4.43Å; V99-F104 HydrophobicContact CG2-CD1 3.88Å; V99-F104 HydrophobicContact CG2-CD2 3.85Å; V99-F104 HydrophobicContact CG2-CE1 3.59Å; V99-F104 HydrophobicContact CG2-CE2 3.6Å; V99-F104 HydrophobicContact CG2-CG 4Å; V99-F104 HydrophobicContact CG2-CZ 3.45Å; V99-F104 VanDerWaalsContact CG2-CZ 3.45Å; V102-F104 HydrophobicContact CB-CD2 4.49Å; V102-F104 HydrophobicContact CB-CE2 4.17Å; V102-F104 HydrophobicContact CG1-CD2 4.42Å; V102-F104 HydrophobicContact CG1-CE2 4.19Å; V102-F104 WeakPolarHBondContact O-CD2 3.08Å; F104-I107 HydrophobicContact CB-CG2 4.19Å; F104-I107 HydrophobicContact CD1-CG2 4.14Å; F104-I107 HydrophobicContact CD2-CD1 4.1Å; F104-I107 HydrophobicContact CE2-CD1 3.93Å; F104-I107 HydrophobicContact CG-CG2 4.09Å; F104-I107 HydrophobicContact CZ-CD1 4.23Å; F104-A112 HydrophobicContact CD1-CB 4.1Å; F104-A112 HydrophobicContact CE1-CB 3.61Å; F104-A112 HydrophobicContact CZ-CB 4.27Å; F104-I115 HydrophobicContact CE2-CD1 4.09Å; F104-I115 HydrophobicContact CE2-CG2 4.21Å; F104-I115 HydrophobicContact CZ-CB 4.13Å; F104-I115 HydrophobicContact CZ-CD1 4.24Å; F104-I115 HydrophobicContact CZ-CG2 3.96Å; F104-L116 HydrophobicContact CE1-CD1 4.33Å; F104-L116 HydrophobicContact CE1-CG 4.29Å; F104-L116 HydrophobicContact CZ-CG 4.47Å
105	Q	87.9	Confident	92	Very high	99 Å²	99	57.8 Å²	57.8	46%	0.463	30%	0.299	S	S	.	.	S	Bend	trans	-69.7	-46.2	179.4	-69.5	174.8	94.5	0	0	112.2	L97 D103	L97-Q105 HydrophobicContact CD2-CG 4.41Å; D103-Q105 WeakPolarHBondContact OD1-CG 3.36Å; D103-Q105 PolarHBondContact OD1-N 3.48Å; D103-Q105 PolarHBondContact OD1-NE2 3.12Å
106	D	87.9	Confident	91.8	Very high	124 Å²	124	57.3 Å²	57.3	66%	0.663	30%	0.297	S	S	*	.	S	Bend	trans	-115.6	27.7	-177.4	-72.8	-35	0	0	0	113.5
107	I	90.5	Very high	91.5	Very high	17 Å²	17	63.9 Å²	63.9	9%	0.087	33%	0.325	C	S	.	.			trans	-84	146.6	-177.4	-160.9	168.2	0	0	0	112.5	G67 K68 I74 V102 F104 R111 A112 I115	G67-I107 WeakPolarHBondContact CA-O 3.34Å; K68-I107 PolarHBondContact N-O 2.99Å; I74-I107 HydrophobicContact CD1-CG2 4.16Å; I74-I107 HydrophobicContact CG1-CG2 3.6Å; V102-I107 HydrophobicContact CG1-CD1 4.4Å; F104-I107 HydrophobicContact CB-CG2 4.19Å; F104-I107 HydrophobicContact CD1-CG2 4.14Å; F104-I107 HydrophobicContact CD2-CD1 4.1Å; F104-I107 HydrophobicContact CE2-CD1 3.93Å; F104-I107 HydrophobicContact CG-CG2 4.09Å; F104-I107 HydrophobicContact CZ-CD1 4.23Å; I107-R111 HydrophobicContact CD1-CB 4.34Å; I107-R111 HydrophobicContact CD1-CG 4Å; I107-R111 HydrophobicContact CG1-CB 4.1Å; I107-R111 HydrophobicContact CG1-CG 4.13Å; I107-A112 HydrophobicContact CD1-CB 4.34Å; I107-A112 HydrophobicContact CG2-CB 3.92Å; I107-I115 HydrophobicContact CD1-CD1 3.73Å
108	E	91.9	Very high	91.1	Very high	86 Å²	86	67.9 Å²	67.9	40%	0.402	35%	0.351	S	S	.	.			trans	-67.1	142.7	168.7	-69.9	-60.6	159.4	0	0	111.3	K68 S110 R111 A112	K68-E108 WeakPolarHBondContact CD-OE1 3.36Å; E108-S110 VanDerWaalsContact C-N 3.34Å; E108-S110 PolarHBondContact O-N 3.24Å; E108-R111 HydrophobicContact CB-CB 4.22Å; E108-R111 PolarHBondContact O-N 3.13Å; E108-A112 PolarHBondContact O-N 3.42Å
109	H	91	Very high	90.6	Very high	76 Å²	76	67.4 Å²	67.4	35%	0.352	35%	0.349	S	S	.	.	H	α-helix	trans	-57.5	-46.8	-178.3	-175.5	80.2	0	0	0	112.1	G66 R111 A112 V113	G66-H109 WeakPolarHBondContact O-CB 3.19Å; G66-H109 PolarHBondContact O-ND1 3.03Å; H109-R111 VanDerWaalsContact C-N 3.31Å; H109-R111 PolarHBondContact O-N 3.09Å; H109-A112 PolarHBondContact O-N 3.34Å; H109-V113 WeakPolarHBondContact O-CG2 3.39Å; H109-V113 PolarHBondContact O-N 2.64Å
110	S	91.4	Very high	90.2	Very high	88 Å²	88	78 Å²	78	62%	0.615	39%	0.389	S	S	*	.	H	α-helix	trans	-59	-42.7	179.1	52.1	0	0	0	0	112	E108 V113 E114	E108-S110 VanDerWaalsContact C-N 3.34Å; E108-S110 PolarHBondContact O-N 3.24Å; S110-V113 PolarHBondContact O-N 3.44Å; S110-E114 PolarHBondContact O-N 3Å
111	R	92.2	Very high	90.1	Very high	125 Å²	125	79.7 Å²	79.7	47%	0.472	40%	0.395	S	S	.	.	H	α-helix	trans	-68.4	-40.4	179.1	-174.6	58.9	176.6	177.9	0.7	112	I107 E108 H109 V113 E114 I115	I107-R111 HydrophobicContact CD1-CB 4.34Å; I107-R111 HydrophobicContact CD1-CG 4Å; I107-R111 HydrophobicContact CG1-CB 4.1Å; I107-R111 HydrophobicContact CG1-CG 4.13Å; E108-R111 HydrophobicContact CB-CB 4.22Å; E108-R111 PolarHBondContact O-N 3.13Å; H109-R111 VanDerWaalsContact C-N 3.31Å; H109-R111 PolarHBondContact O-N 3.09Å; R111-V113 VanDerWaalsContact C-N 3.33Å; R111-V113 PolarHBondContact O-N 3.25Å; R111-E114 WeakPolarHBondContact CD-OE2 3.36Å; R111-E114 IonicContact CZ-OE2 3.09Å; R111-E114 IonicContact NE-OE2 3.72Å; R111-E114 IonicContact NH1-OE1 2.8Å; R111-E114 PolarHBondContact NH1-OE1 3.27Å; R111-E114 VanDerWaalsContact NH1-OE1 3.09Å; R111-E114 IonicContact NH1-OE2 3.62Å; R111-E114 PolarHBondContact NH1-OE2 2.77Å; R111-E114 WeakPolarHBondContact O-CB 3.29Å; R111-E114 PolarHBondContact O-N 2.91Å; R111-I115 HydrophobicContact CG-CD1 4.12Å; R111-I115 WeakPolarHBondContact O-CG1 3.41Å; R111-I115 PolarHBondContact O-N 2.83Å
112	A	92	Very high	90.2	Very high	0 Å²	0	71.9 Å²	71.9	0%	0	35%	0.353	C	S	.	.	H	α-helix	trans	-58.5	-45.6	173.8	0	0	0	0	0	111.5	I64 I74 F104 I107 E108 H109 E114 I115 L116	I64-A112 HydrophobicContact CD1-CB 4.12Å; I74-A112 HydrophobicContact CD1-CB 3.94Å; I74-A112 HydrophobicContact CG1-CB 4.17Å; F104-A112 HydrophobicContact CD1-CB 4.1Å; F104-A112 HydrophobicContact CE1-CB 3.61Å; F104-A112 HydrophobicContact CZ-CB 4.27Å; I107-A112 HydrophobicContact CD1-CB 4.34Å; I107-A112 HydrophobicContact CG2-CB 3.92Å; E108-A112 PolarHBondContact O-N 3.42Å; H109-A112 PolarHBondContact O-N 3.34Å; A112-E114 VanDerWaalsContact C-N 3.34Å; A112-E114 PolarHBondContact O-N 2.77Å; A112-I115 PolarHBondContact O-N 3.33Å; A112-L116 WeakPolarHBondContact O-CB 3.29Å; A112-L116 VanDerWaalsContact O-CG 3.3Å; A112-L116 WeakPolarHBondContact O-CG 3.39Å; A112-L116 PolarHBondContact O-N 2.87Å
113	V	91.1	Very high	90.3	Very high	37 Å²	37	71.9 Å²	71.9	22%	0.224	35%	0.353	C	S	.	.	H	α-helix	trans	-61.7	-41.7	176.6	173.8	0	0	0	0	111.5	I64 H109 S110 R111 K117	I64-V113 HydrophobicContact CD1-CG2 3.85Å; I64-V113 HydrophobicContact CG1-CG2 4.35Å; H109-V113 WeakPolarHBondContact O-CG2 3.39Å; H109-V113 PolarHBondContact O-N 2.64Å; S110-V113 PolarHBondContact O-N 3.44Å; R111-V113 VanDerWaalsContact C-N 3.33Å; R111-V113 PolarHBondContact O-N 3.25Å; V113-K117 HydrophobicContact CG1-CD 3.77Å; V113-K117 VanDerWaalsContact CG1-CE 3.45Å; V113-K117 HydrophobicContact CG1-CG 4.32Å; V113-K117 WeakPolarHBondContact O-CB 3.3Å; V113-K117 VanDerWaalsContact O-CG 3.26Å; V113-K117 WeakPolarHBondContact O-CG 3.48Å; V113-K117 PolarHBondContact O-N 3.32Å
114	E	91.6	Very high	90.4	Very high	98 Å²	98	68.1 Å²	68.1	46%	0.458	33%	0.333	S	S	.	.	H	α-helix	trans	-62.3	-46.1	178.6	-170.1	-168.8	169.1	0	0	112.2	S110 R111 A112 K117 T118	S110-E114 PolarHBondContact O-N 3Å; R111-E114 WeakPolarHBondContact CD-OE2 3.36Å; R111-E114 IonicContact CZ-OE2 3.09Å; R111-E114 IonicContact NE-OE2 3.72Å; R111-E114 IonicContact NH1-OE1 2.8Å; R111-E114 PolarHBondContact NH1-OE1 3.27Å; R111-E114 VanDerWaalsContact NH1-OE1 3.09Å; R111-E114 IonicContact NH1-OE2 3.62Å; R111-E114 PolarHBondContact NH1-OE2 2.77Å; R111-E114 WeakPolarHBondContact O-CB 3.29Å; R111-E114 PolarHBondContact O-N 2.91Å; A112-E114 VanDerWaalsContact C-N 3.34Å; A112-E114 PolarHBondContact O-N 2.77Å; E114-K117 PolarHBondContact O-N 3.25Å; E114-T118 WeakPolarHBondContact O-CB 3.24Å; E114-T118 PolarHBondContact O-N 3.29Å; E114-T118 PolarHBondContact O-OG1 3.37Å
115	I	91.3	Very high	90.5	Very high	26 Å²	26	73.3 Å²	73.3	13%	0.133	36%	0.355	C	S	.	.	H	α-helix	trans	-62.5	-48.8	179	-68.5	168.1	0	0	0	110.3	V99 V102 F104 I107 R111 A112 K117 T118 A119	V99-I115 HydrophobicContact CG1-CG2 4.35Å; V102-I115 HydrophobicContact CB-CD1 4.44Å; V102-I115 HydrophobicContact CG1-CD1 3.9Å; F104-I115 HydrophobicContact CE2-CD1 4.09Å; F104-I115 HydrophobicContact CE2-CG2 4.21Å; F104-I115 HydrophobicContact CZ-CB 4.13Å; F104-I115 HydrophobicContact CZ-CD1 4.24Å; F104-I115 HydrophobicContact CZ-CG2 3.96Å; I107-I115 HydrophobicContact CD1-CD1 3.73Å; R111-I115 HydrophobicContact CG-CD1 4.12Å; R111-I115 WeakPolarHBondContact O-CG1 3.41Å; R111-I115 PolarHBondContact O-N 2.83Å; A112-I115 PolarHBondContact O-N 3.33Å; I115-K117 VanDerWaalsContact C-N 3.28Å; I115-K117 PolarHBondContact O-N 3.45Å; I115-T118 PolarHBondContact O-N 3.11Å; I115-A119 WeakPolarHBondContact O-CB 3.38Å; I115-A119 PolarHBondContact O-N 3.47Å; I115-A119 VanDerWaalsContact O-N 3.1Å
116	L	90.1	Very high	90.8	Very high	9 Å²	9	68.6 Å²	68.6	5%	0.047	33%	0.333	C	S	.	.	H	α-helix	trans	-63.2	-34.3	179	-70.3	170.6	0	0	0	112.2	L60 F62 I64 V99 F104 A112 I122 M124	L60-L116 HydrophobicContact CD1-CB 4.04Å; F62-L116 HydrophobicContact CE2-CD1 4.34Å; F62-L116 HydrophobicContact CZ-CD2 4.31Å; I64-L116 HydrophobicContact CD1-CD1 3.91Å; I64-L116 HydrophobicContact CG2-CD1 4.13Å; V99-L116 HydrophobicContact CG1-CD2 4.11Å; V99-L116 HydrophobicContact CG2-CD2 4.11Å; F104-L116 HydrophobicContact CE1-CD1 4.33Å; F104-L116 HydrophobicContact CE1-CG 4.29Å; F104-L116 HydrophobicContact CZ-CG 4.47Å; A112-L116 WeakPolarHBondContact O-CB 3.29Å; A112-L116 VanDerWaalsContact O-CG 3.3Å; A112-L116 WeakPolarHBondContact O-CG 3.39Å; A112-L116 PolarHBondContact O-N 2.87Å; L116-I122 HydrophobicContact CD2-CD1 4.07Å; L116-I122 HydrophobicContact CD2-CG2 4.01Å; L116-M124 HydrophobicContact CD2-CE 4.33Å
117	K	87.4	Confident	91.1	Very high	140 Å²	140	66.3 Å²	66.3	61%	0.609	32%	0.315	S	S	*	.	H	α-helix	trans	-74.8	-36	178.3	-78.3	178.4	179	175.6	0	113	K54 V113 E114 I115	K54-K117 PolarHBondContact NZ-O 3.24Å; V113-K117 HydrophobicContact CG1-CD 3.77Å; V113-K117 VanDerWaalsContact CG1-CE 3.45Å; V113-K117 HydrophobicContact CG1-CG 4.32Å; V113-K117 WeakPolarHBondContact O-CB 3.3Å; V113-K117 VanDerWaalsContact O-CG 3.26Å; V113-K117 WeakPolarHBondContact O-CG 3.48Å; V113-K117 PolarHBondContact O-N 3.32Å; E114-K117 PolarHBondContact O-N 3.25Å; I115-K117 VanDerWaalsContact C-N 3.28Å; I115-K117 PolarHBondContact O-N 3.45Å
118	T	86.4	Confident	91.1	Very high	110 Å²	110	67.3 Å²	67.3	68%	0.675	32%	0.319	S	S	*	.	H	α-helix	trans	-79.8	-31.7	-174.9	-55.6	0	0	0	0	112.3	E114 I115 R120	E114-T118 WeakPolarHBondContact O-CB 3.24Å; E114-T118 PolarHBondContact O-N 3.29Å; E114-T118 PolarHBondContact O-OG1 3.37Å; I115-T118 PolarHBondContact O-N 3.11Å; T118-R120 PolarHBondContact O-N 2.99Å
119	A	85	Confident	90.8	Very high	15 Å²	15	66.1 Å²	66.1	12%	0.124	31%	0.313	C	S	.	.			trans	-67.6	130.2	-179.4	0	0	0	0	0	112.6	K54 I115 I122	K54-A119 WeakPolarHBondContact CD-O 3.38Å; I115-A119 WeakPolarHBondContact O-CB 3.38Å; I115-A119 PolarHBondContact O-N 3.47Å; I115-A119 VanDerWaalsContact O-N 3.1Å; A119-I122 HydrophobicContact CB-CD1 4.38Å; A119-I122 HydrophobicContact CB-CG1 3.65Å
120	R	85.9	Confident	90.1	Very high	222 Å²	222	63.9 Å²	63.9	84%	0.838	31%	0.305	S	S	*	.	S	Bend	trans	-81.1	-34.5	169.8	-70.9	-175.7	178.4	-178.7	-0.4	112	K54 T118	K54-R120 VanDerWaalsContact CB-O 3.32Å; K54-R120 WeakPolarHBondContact CB-O 3.39Å; K54-R120 PolarHBondContact N-O 3.34Å; T118-R120 PolarHBondContact O-N 2.99Å
121	E	90.3	Very high	89.2	Confident	96 Å²	96	67.7 Å²	67.7	45%	0.449	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	133.2	173	-176.2	165	-140	0	0	107.8	V51 L52 K53 N100	V51-E121 HydrophobicContact CG1-CG 4.36Å; L52-E121 WeakPolarHBondContact O-CA 3.34Å; K53-E121 WeakPolarHBondContact CE-OE1 3.37Å; K53-E121 HydrophobicContact CG-CG 4.49Å; N100-E121 PolarHBondContact ND2-O 3.06Å; N100-E121 PolarHBondContact OD1-O 2.67Å
122	I	91.8	Very high	88.2	Confident	0 Å²	0	64.1 Å²	64.1	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	105.5	-174.1	-62	176.2	0	0	0	106.7	V51 L52 L60 V99 L116 A119 M124	V51-I122 CarbonylContact C-O 3.2Å; V51-I122 WeakPolarHBondContact CA-O 3.1Å; L52-I122 HydrophobicContact CB-CB 4.3Å; L52-I122 PolarHBondContact N-O 3.02Å; L52-I122 PolarHBondContact O-N 3.46Å; L60-I122 HydrophobicContact CD1-CD1 3.73Å; L60-I122 HydrophobicContact CD2-CD1 3.52Å; L60-I122 HydrophobicContact CG-CD1 4.28Å; V99-I122 HydrophobicContact CG1-CG2 3.65Å; L116-I122 HydrophobicContact CD2-CD1 4.07Å; L116-I122 HydrophobicContact CD2-CG2 4.01Å; A119-I122 HydrophobicContact CB-CD1 4.38Å; A119-I122 HydrophobicContact CB-CG1 3.65Å; I122-M124 HydrophobicContact CG2-CB 4.4Å; I122-M124 HydrophobicContact CG2-CE 3.3Å
123	V	94.6	Very high	87.2	Confident	61 Å²	61	64.7 Å²	64.7	37%	0.37	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	108.6	169	-177.3	0	0	0	0	106.7	T49 V51 V99 N100	T49-V123 HydrophobicContact CG2-CG1 3.76Å; V51-V123 HydrophobicContact CG1-CG2 4.27Å; V51-V123 HydrophobicContact CG2-CG1 4.33Å; V51-V123 HydrophobicContact CG2-CG2 4.23Å; V99-V123 CarbonylContact C-O 3.58Å; V99-V123 WeakPolarHBondContact CA-O 3.19Å; N100-V123 PolarHBondContact N-O 2.66Å; N100-V123 PolarHBondContact OD1-N 3.47Å
124	M	94.7	Very high	86.3	Confident	1 Å²	1	67.9 Å²	67.9	1%	0.005	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	140.4	-178.6	64.3	176	73.9	0	0	111.5	T49 I50 L52 F62 L90 S98 V99 L116 I122 V126	T49-M124 CarbonylContact C-O 3.5Å; T49-M124 WeakPolarHBondContact CA-O 3.17Å; I50-M124 HydrophobicContact CB-CG 3.92Å; I50-M124 HydrophobicContact CG2-CG 4.39Å; I50-M124 PolarHBondContact N-O 3.15Å; I50-M124 PolarHBondContact O-N 2.95Å; L52-M124 HydrophobicContact CD1-CE 3.8Å; F62-M124 HydrophobicContact CE1-CE 4.25Å; F62-M124 HydrophobicContact CZ-CE 3.85Å; L90-M124 HydrophobicContact CD1-SD 4.03Å; S98-M124 CarbonylContact O-C 3.57Å; S98-M124 WeakPolarHBondContact O-CA 3.44Å; S98-M124 WeakPolarHBondContact O-CB 3Å; V99-M124 HydrophobicContact CG2-CB 3.91Å; L116-M124 HydrophobicContact CD2-CE 4.33Å; I122-M124 HydrophobicContact CG2-CB 4.4Å; I122-M124 HydrophobicContact CG2-CE 3.3Å; M124-V126 HydrophobicContact CB-CG1 4.44Å; M124-V126 HydrophobicContact CG-CG1 3.87Å; M124-V126 HydrophobicContact SD-CG1 3.71Å
125	K	95.4	Very high	85.1	Confident	109 Å²	109	70.5 Å²	70.5	47%	0.474	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	122.1	165.9	-68.8	178.8	177.8	169.6	0	108.2	R48 L97 S98	R48-K125 CarbonylContact O-C 3.5Å; R48-K125 WeakPolarHBondContact O-CA 3.24Å; L97-K125 HydrophobicContact CB-CB 4.42Å; L97-K125 WeakPolarHBondContact CB-O 3.45Å; L97-K125 PolarHBondContact N-O 3.26Å; S98-K125 PolarHBondContact N-O 3.18Å; S98-K125 PolarHBondContact O-N 3.31Å; S98-K125 WeakPolarHBondContact OG-CB 3.46Å
126	V	95.1	Very high	83.7	Confident	0 Å²	0	69.7 Å²	69.7	0%	0	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	156.6	-179.9	-58.6	0	0	0	0	110.8	P47 R48 I50 L90 D94 Q95 V96 M124	P47-V126 CarbonylContact C-O 3.38Å; P47-V126 VanDerWaalsContact CA-O 3.27Å; P47-V126 WeakPolarHBondContact CA-O 3.43Å; R48-V126 HydrophobicContact CG-CG2 3.67Å; R48-V126 PolarHBondContact N-O 2.62Å; R48-V126 PolarHBondContact O-N 3.48Å; I50-V126 HydrophobicContact CD1-CG2 3.7Å; I50-V126 HydrophobicContact CG1-CG2 3.97Å; L90-V126 HydrophobicContact CD1-CG1 4.05Å; D94-V126 HydrophobicContact CB-CB 4.27Å; Q95-V126 CarbonylContact O-C 3.46Å; Q95-V126 WeakPolarHBondContact O-CA 3.13Å; V96-V126 HydrophobicContact CG2-CG1 4.36Å; M124-V126 HydrophobicContact CB-CG1 4.44Å; M124-V126 HydrophobicContact CG-CG1 3.87Å; M124-V126 HydrophobicContact SD-CG1 3.71Å
127	R	93.3	Very high	82.5	Confident	76 Å²	76	73.7 Å²	73.7	29%	0.287	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	128.6	173.9	178.8	179.8	62	-176.9	-3.6	109.2	F45 D94 Q95 L97 F129	F45-R127 VanDerWaalsContact O-CG 3.25Å; F45-R127 WeakPolarHBondContact O-CG 3.38Å; D94-R127 WeakPolarHBondContact CA-O 3.45Å; Q95-R127 PolarHBondContact N-O 3Å; Q95-R127 PolarHBondContact O-N 2.58Å; L97-R127 HydrophobicContact CD1-CB 4.15Å; R127-F129 PolarHBondContact O-N 2.93Å
128	F	91.1	Very high	81.3	Confident	38 Å²	38	73.3 Å²	73.3	17%	0.167	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	115.6	174.3	-177.7	-124.2	0	0	0	110	Q44 F45 Q91 D94 P130	Q44-F128 WeakPolarHBondContact O-CB 3.44Å; F45-F128 HydrophobicContact CD1-CD1 4.18Å; F45-F128 HydrophobicContact CE1-CD1 4.1Å; F45-F128 HydrophobicContact CE1-CE1 4.38Å; Q91-F128 HydrophobicContact CG-CD2 4.08Å; Q91-F128 HydrophobicContact CG-CE2 4.39Å; D94-F128 VanDerWaalsContact OD1-CA 3.29Å; D94-F128 WeakPolarHBondContact OD1-CA 3.49Å; D94-F128 WeakPolarHBondContact OD1-CB 3.43Å; F128-P130 HydrophobicContact CD1-CG 4.36Å; F128-P130 HydrophobicContact CE1-CB 4.37Å; F128-P130 HydrophobicContact CE1-CG 3.69Å; F128-P130 HydrophobicContact CE2-CB 4.02Å; F128-P130 HydrophobicContact CE2-CG 4.16Å; F128-P130 HydrophobicContact CZ-CB 3.73Å; F128-P130 HydrophobicContact CZ-CG 3.57Å
129	F	85	Confident	80	Confident	62 Å²	62	75.9 Å²	75.9	27%	0.272	33%	0.328	S	S	.	.			trans	-141.3	74.2	-177.5	-153.5	-81.1	0	0	0	111	F75 G93 R127 Y131 N132 Y133	F75-F129 HydrophobicContact CE1-CB 4.49Å; G93-F129 CarbonylContact O-C 3.51Å; G93-F129 PolarHBondContact O-N 3.09Å; R127-F129 PolarHBondContact O-N 2.93Å; F129-Y131 VanDerWaalsContact C-N 3.33Å; F129-Y131 PolarHBondContact O-N 3.17Å; F129-N132 HydrophobicContact CD1-CB 3.49Å; F129-N132 VanDerWaalsContact CD1-CB 3.49Å; F129-N132 WeakPolarHBondContact CD1-ND2 3.12Å; F129-N132 HydrophobicContact CE1-CB 3.72Å; F129-N132 WeakPolarHBondContact CE1-ND2 3.3Å; F129-N132 WeakPolarHBondContact CE1-OD1 3.22Å; F129-Y133 PolarHBondContact O-N 3.07Å
130	P	77.7	Confident	78.5	Confident	29 Å²	29	80.4 Å²	80.4	19%	0.188	35%	0.354	C	S	.	.	H	α-helix	trans	-66.8	-30.2	-171.3	26.1	-34.9	0	0	0	113.6	F128 Y133 Q134	F128-P130 HydrophobicContact CD1-CG 4.36Å; F128-P130 HydrophobicContact CE1-CB 4.37Å; F128-P130 HydrophobicContact CE1-CG 3.69Å; F128-P130 HydrophobicContact CE2-CB 4.02Å; F128-P130 HydrophobicContact CE2-CG 4.16Å; F128-P130 HydrophobicContact CZ-CB 3.73Å; F128-P130 HydrophobicContact CZ-CG 3.57Å; P130-Y133 WeakPolarHBondContact O-CB 3.45Å; P130-Y133 PolarHBondContact O-N 3.18Å; P130-Q134 WeakPolarHBondContact O-CG 3.31Å; P130-Q134 PolarHBondContact O-N 3.49Å
131	Y	72.3	Confident	76.7	Confident	167 Å²	167	75.1 Å²	75.1	66%	0.655	35%	0.347	S	S	*	.	H	α-helix	trans	-65	-49.3	-178.2	-69.2	-77.7	0	0	0	113	F129 Y133 Q134 R135	F129-Y131 VanDerWaalsContact C-N 3.33Å; F129-Y131 PolarHBondContact O-N 3.17Å; Y131-Y133 PolarHBondContact O-N 3.36Å; Y131-Q134 PolarHBondContact O-N 3.31Å; Y131-R135 PolarHBondContact O-N 3.28Å
132	N	69.8	Low	74.3	Confident	51 Å²	51	82.4 Å²	82.4	27%	0.273	38%	0.38	S	S	.	.	H	α-helix	trans	-66.9	-32	177	-72	-14.6	0	0	0	111.8	F75 F129 R135 Q136	F75-N132 HydrophobicContact CE1-CB 4.13Å; F75-N132 HydrophobicContact CZ-CB 3.76Å; F129-N132 HydrophobicContact CD1-CB 3.49Å; F129-N132 VanDerWaalsContact CD1-CB 3.49Å; F129-N132 WeakPolarHBondContact CD1-ND2 3.12Å; F129-N132 HydrophobicContact CE1-CB 3.72Å; F129-N132 WeakPolarHBondContact CE1-ND2 3.3Å; F129-N132 WeakPolarHBondContact CE1-OD1 3.22Å; N132-R135 PolarHBondContact O-N 2.78Å; N132-Q136 PolarHBondContact O-N 3.14Å
133	Y	72.3	Confident	73.4	Confident	12 Å²	12	86.5 Å²	86.5	5%	0.047	40%	0.399	C	S	.	.	H	α-helix	trans	-61.2	-46.3	175	179.9	-97	0	0	0	111.3	R65 F75 I76 S77 E92 F129 P130 Y131 R135 Q136 K137	R65-Y133 PolarHBondContact NH2-O 3.29Å; F75-Y133 HydrophobicContact CB-CD2 3.81Å; F75-Y133 HydrophobicContact CB-CE2 4.31Å; F75-Y133 HydrophobicContact CD1-CD2 4.18Å; F75-Y133 HydrophobicContact CG-CD2 4.23Å; I76-Y133 WeakPolarHBondContact O-CE2 3.48Å; S77-Y133 VanDerWaalsContact CA-OH 3.24Å; S77-Y133 WeakPolarHBondContact CA-OH 3.25Å; S77-Y133 PolarHBondContact O-OH 3.25Å; E92-Y133 VanDerWaalsContact CD-OH 3.3Å; E92-Y133 HydrophobicContact CG-CE1 3.57Å; E92-Y133 HydrophobicContact CG-CE2 4.16Å; E92-Y133 VanDerWaalsContact CG-OH 3.3Å; E92-Y133 WeakPolarHBondContact CG-OH 3.4Å; E92-Y133 WeakPolarHBondContact OE1-CE1 3.34Å; E92-Y133 PolarHBondContact OE1-OH 3.36Å; F129-Y133 PolarHBondContact O-N 3.07Å; P130-Y133 WeakPolarHBondContact O-CB 3.45Å; P130-Y133 PolarHBondContact O-N 3.18Å; Y131-Y133 PolarHBondContact O-N 3.36Å; Y133-R135 PolarHBondContact O-N 3.39Å; Y133-Q136 WeakPolarHBondContact O-CB 3.09Å; Y133-Q136 PolarHBondContact O-N 3.1Å; Y133-K137 HydrophobicContact CE1-CD 4.09Å; Y133-K137 HydrophobicContact CE1-CG 4.39Å; Y133-K137 PolarHBondContact O-N 3.34Å; Y133-K137 WeakPolarHBondContact OH-CE 3.49Å
134	Q	71.6	Confident	72.3	Confident	103 Å²	103	87.8 Å²	87.8	48%	0.481	40%	0.4	S	S	.	.	H	α-helix	trans	-60.8	-46.9	177.1	-73.2	170.9	-6.9	0	0	112.2	P130 Y131 Q136 K137 E138	P130-Q134 WeakPolarHBondContact O-CG 3.31Å; P130-Q134 PolarHBondContact O-N 3.49Å; Y131-Q134 PolarHBondContact O-N 3.31Å; Q134-Q136 PolarHBondContact O-N 2.99Å; Q134-Q136 VanDerWaalsContact O-N 3.17Å; Q134-K137 WeakPolarHBondContact O-CA 3.44Å; Q134-K137 WeakPolarHBondContact O-CB 3.08Å; Q134-K137 PolarHBondContact O-N 2.9Å; Q134-E138 PolarHBondContact O-N 3.2Å; Q134-E138 VanDerWaalsContact O-N 3.09Å
135	R	65.8	Low	71.1	Confident	153 Å²	153	92.7 Å²	92.7	58%	0.577	42%	0.422	S	S	*	.	H	α-helix	trans	-57	-34.7	175.5	-62.8	-173.4	80.2	-168.4	7.3	112.9	Y131 N132 Y133 R139	Y131-R135 PolarHBondContact O-N 3.28Å; N132-R135 PolarHBondContact O-N 2.78Å; Y133-R135 PolarHBondContact O-N 3.39Å; R135-R139 WeakPolarHBondContact O-CG 3.47Å; R135-R139 PolarHBondContact O-N 3.1Å
136	Q	62.5	Low	69.6	Low	9 Å²	9	91.7 Å²	91.7	4%	0.042	42%	0.419	C	S	.	.	H	α-helix	trans	-70.4	-37.4	175.2	-166.2	173.3	41	0	0	112.4	L72 F75 N132 Y133 Q134 T140	L72-Q136 HydrophobicContact CD1-CB 3.77Å; L72-Q136 HydrophobicContact CD1-CG 3.58Å; F75-Q136 VanDerWaalsContact CD2-OE1 3.23Å; N132-Q136 PolarHBondContact O-N 3.14Å; Y133-Q136 WeakPolarHBondContact O-CB 3.09Å; Y133-Q136 PolarHBondContact O-N 3.1Å; Q134-Q136 PolarHBondContact O-N 2.99Å; Q134-Q136 VanDerWaalsContact O-N 3.17Å; Q136-T140 PolarHBondContact O-OG1 3.08Å
137	K	63.8	Low	68	Low	94 Å²	94	97.4 Å²	97.4	41%	0.409	45%	0.446	S	S	.	.	H	α-helix	trans	-60.2	-49.2	174.6	-81.7	-169.7	174.6	173.3	0	110.3	R65 E92 Y133 Q134 R139 T140 V141	R65-K137 VanDerWaalsContact NH1-N 3.17Å; R65-K137 VanDerWaalsContact NH2-CG 3.34Å; E92-K137 WeakPolarHBondContact OE1-CE 3.49Å; E92-K137 IonicContact OE1-NZ 3.87Å; E92-K137 PolarHBondContact OE1-NZ 3.27Å; Y133-K137 HydrophobicContact CE1-CD 4.09Å; Y133-K137 HydrophobicContact CE1-CG 4.39Å; Y133-K137 PolarHBondContact O-N 3.34Å; Y133-K137 WeakPolarHBondContact OH-CE 3.49Å; Q134-K137 WeakPolarHBondContact O-CA 3.44Å; Q134-K137 WeakPolarHBondContact O-CB 3.08Å; Q134-K137 PolarHBondContact O-N 2.9Å; K137-R139 VanDerWaalsContact C-N 3.29Å; K137-R139 PolarHBondContact O-N 3.48Å; K137-T140 PolarHBondContact O-N 3.31Å; K137-T140 VanDerWaalsContact O-N 3.14Å; K137-T140 PolarHBondContact O-OG1 3.4Å; K137-V141 WeakPolarHBondContact O-CG2 3.43Å
138	E	62.3	Low	66.4	Low	132 Å²	132	98.9 Å²	98.9	62%	0.617	46%	0.456	S	S	*	.	H	α-helix	trans	-61	-36.1	-175.8	-68.3	165.5	-180	0	0	112.8	Q134 T140	Q134-E138 PolarHBondContact O-N 3.2Å; Q134-E138 VanDerWaalsContact O-N 3.09Å; E138-T140 VanDerWaalsContact C-N 3.3Å; E138-T140 PolarHBondContact O-N 3.42Å
139	R	59.3	Low	64.6	Low	164 Å²	164	103.2 Å²	103.2	62%	0.619	48%	0.477	S	S	*	.	H	α-helix	trans	-71.4	-18.6	178.4	-75.1	-176.2	174.9	-149.7	-2.8	115.1	R135 K137	R135-R139 WeakPolarHBondContact O-CG 3.47Å; R135-R139 PolarHBondContact O-N 3.1Å; K137-R139 VanDerWaalsContact C-N 3.29Å; K137-R139 PolarHBondContact O-N 3.48Å
140	T	54	Low	63	Low	109 Å²	109	106.4 Å²	106.4	67%	0.669	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.7	6.6	-175.8	18.2	0	0	0	0	113.5	Q136 K137 E138	Q136-T140 PolarHBondContact O-OG1 3.08Å; K137-T140 PolarHBondContact O-N 3.31Å; K137-T140 VanDerWaalsContact O-N 3.14Å; K137-T140 PolarHBondContact O-OG1 3.4Å; E138-T140 VanDerWaalsContact C-N 3.3Å; E138-T140 PolarHBondContact O-N 3.42Å
141	V	48.9	Very low	61.8	Low	112 Å²	112	112.8 Å²	112.8	68%	0.679	52%	0.518	S	S	*	.			trans	-96.3	27.2	-177.7	-151.4	0	0	0	0	113.3	K137	K137-V141 WeakPolarHBondContact O-CG2 3.43Å
142	H	38.8	Very low	60.8	Low	248 Å²	248	107.9 Å²	107.9	100%	1.148	51%	0.506	S	S	*	.			trans	-122.2	0	175.8	-74	18.1	0	0	0	110.3

Retrieved 142 of 142 residues in 175.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).