A0A3B3UYI3_9TELE Loading...

NCBP2 antisense 2 (head to head)

AlphaFold DB , UniProt , Accession A0A3B3UYI3, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 101 aa.

						>A0A3B3UYI3_9TELE|A0A3B3UYI3
MLSRMLAYLVNNLQVIEKLAESRPIRRAAQLTAYALTKAQIVGRDTSERVMRSQTLRQVRQEAGRVPGDLEEVSNRLRRVRETFVKEVKDGWKDGSRRIKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.9	Low	76.2	Confident	205 Å²	205	131 Å²	131	100%	1.01	67%	0.667	S	S	*	*				0	-62.2	0	-66.5	-62.4	180	0	0	111.7	S3 R4 M5	M1-S3 PolarHBondContact O-N 3.3Å; M1-R4 PolarHBondContact O-N 3.08Å; M1-R4 VanDerWaalsContact O-N 3.12Å; M1-M5 PolarHBondContact O-N 3.01Å; M1-M5 VanDerWaalsContact O-N 3.09Å
2	L	72.4	Confident	76.3	Confident	136 Å²	136	125 Å²	125	71%	0.712	64%	0.638	S	S	*	*	H	α-helix	trans	-57.5	-46	-178.1	-125.3	85.7	0	0	0	114.6	R4 M5 L6	L2-R4 PolarHBondContact O-N 3.28Å; L2-M5 PolarHBondContact O-N 3.11Å; L2-L6 WeakPolarHBondContact O-CB 3.38Å; L2-L6 WeakPolarHBondContact O-CG 3.32Å; L2-L6 PolarHBondContact O-N 3.41Å
3	S	75.3	Confident	75.9	Confident	97 Å²	97	124.5 Å²	124.5	68%	0.678	64%	0.637	S	S	*	*	H	α-helix	trans	-59	-34.8	178.3	166.2	0	0	0	0	112.4	M1 A7	M1-S3 PolarHBondContact O-N 3.3Å; S3-A7 WeakPolarHBondContact O-CB 3.4Å; S3-A7 PolarHBondContact O-N 2.89Å
4	R	80.1	Confident	75.8	Confident	213 Å²	213	125.9 Å²	125.9	80%	0.804	64%	0.639	S	S	*	*	H	α-helix	trans	-76.4	-36.2	178.5	-163.4	159.7	-178.9	150.5	-3	112.1	M1 L2 Y8	M1-R4 PolarHBondContact O-N 3.08Å; M1-R4 VanDerWaalsContact O-N 3.12Å; L2-R4 PolarHBondContact O-N 3.28Å; R4-Y8 WeakPolarHBondContact O-CB 3.45Å; R4-Y8 PolarHBondContact O-N 2.76Å
5	M	75.9	Confident	75.7	Confident	129 Å²	129	120.7 Å²	120.7	64%	0.635	62%	0.616	S	S	*	*	H	α-helix	trans	-65	-44.9	170.3	-71.6	-165.3	88.8	0	0	111.5	M1 L2 A7 Y8 L9	M1-M5 PolarHBondContact O-N 3.01Å; M1-M5 VanDerWaalsContact O-N 3.09Å; L2-M5 PolarHBondContact O-N 3.11Å; M5-A7 VanDerWaalsContact C-N 3.35Å; M5-A7 PolarHBondContact O-N 2.69Å; M5-Y8 WeakPolarHBondContact O-CB 3.36Å; M5-Y8 PolarHBondContact O-N 2.71Å; M5-Y8 VanDerWaalsContact O-N 3.13Å; M5-L9 VanDerWaalsContact O-CG 3.26Å; M5-L9 WeakPolarHBondContact O-CG 3.42Å; M5-L9 PolarHBondContact O-N 2.89Å
6	L	76.6	Confident	75.5	Confident	100 Å²	100	117.6 Å²	117.6	52%	0.524	60%	0.6	S	S	.	*	H	α-helix	trans	-60.6	-44.7	175.9	-75.6	169.2	0	0	0	111.3	L2 Y8 L9 V10	L2-L6 WeakPolarHBondContact O-CB 3.38Å; L2-L6 WeakPolarHBondContact O-CG 3.32Å; L2-L6 PolarHBondContact O-N 3.41Å; L6-Y8 VanDerWaalsContact C-N 3.26Å; L6-Y8 PolarHBondContact O-N 3.3Å; L6-L9 PolarHBondContact O-N 3.11Å; L6-V10 WeakPolarHBondContact O-CB 3.43Å; L6-V10 VanDerWaalsContact O-CG2 3.22Å; L6-V10 WeakPolarHBondContact O-CG2 3.39Å; L6-V10 PolarHBondContact O-N 3.04Å
7	A	77.4	Confident	75.1	Confident	58 Å²	58	116.6 Å²	116.6	48%	0.479	59%	0.593	S	S	.	*	H	α-helix	trans	-58.9	-39.4	174.7	0	0	0	0	0	111.8	S3 M5 N11	S3-A7 WeakPolarHBondContact O-CB 3.4Å; S3-A7 PolarHBondContact O-N 2.89Å; M5-A7 VanDerWaalsContact C-N 3.35Å; M5-A7 PolarHBondContact O-N 2.69Å; A7-N11 VanDerWaalsContact O-CB 3.24Å; A7-N11 WeakPolarHBondContact O-CB 2.94Å; A7-N11 PolarHBondContact O-N 3.48Å
8	Y	79	Confident	75.1	Confident	181 Å²	181	117.6 Å²	117.6	71%	0.71	59%	0.592	S	S	*	*	H	α-helix	trans	-68.4	-41	177.6	-156.6	-93.2	0	0	0	112.8	R4 M5 L6 N11 N12	R4-Y8 WeakPolarHBondContact O-CB 3.45Å; R4-Y8 PolarHBondContact O-N 2.76Å; M5-Y8 WeakPolarHBondContact O-CB 3.36Å; M5-Y8 PolarHBondContact O-N 2.71Å; M5-Y8 VanDerWaalsContact O-N 3.13Å; L6-Y8 VanDerWaalsContact C-N 3.26Å; L6-Y8 PolarHBondContact O-N 3.3Å; Y8-N11 PolarHBondContact O-N 3.1Å; Y8-N12 PolarHBondContact O-N 3.24Å
9	L	73	Confident	74.8	Confident	68 Å²	68	115.2 Å²	115.2	36%	0.356	58%	0.581	S	S	.	*	H	α-helix	trans	-66.7	-39.1	176.8	-66.6	167.8	0	0	0	111.7	M5 L6 N11 N12 V15 I16	M5-L9 VanDerWaalsContact O-CG 3.26Å; M5-L9 WeakPolarHBondContact O-CG 3.42Å; M5-L9 PolarHBondContact O-N 2.89Å; L6-L9 PolarHBondContact O-N 3.11Å; L9-N11 VanDerWaalsContact C-N 3.32Å; L9-N12 PolarHBondContact O-N 2.91Å; L9-V15 HydrophobicContact CD2-CG1 3.57Å; L9-I16 WeakPolarHBondContact O-CG1 3.45Å
10	V	78.1	Confident	74.6	Confident	105 Å²	105	112.1 Å²	112.1	64%	0.636	57%	0.574	S	S	*	*	H	α-helix	trans	-73.3	-24.9	177.6	173.5	0	0	0	0	112	L6 N12 I16	L6-V10 WeakPolarHBondContact O-CB 3.43Å; L6-V10 VanDerWaalsContact O-CG2 3.22Å; L6-V10 WeakPolarHBondContact O-CG2 3.39Å; L6-V10 PolarHBondContact O-N 3.04Å; V10-N12 VanDerWaalsContact C-N 3.29Å; V10-I16 WeakPolarHBondContact O-CD1 3.23Å
11	N	80.5	Confident	74.7	Confident	149 Å²	149	112 Å²	112	80%	0.797	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	2.7	178.2	-149.5	-3.3	0	0	0	112.9	A7 Y8 L9	A7-N11 VanDerWaalsContact O-CB 3.24Å; A7-N11 WeakPolarHBondContact O-CB 2.94Å; A7-N11 PolarHBondContact O-N 3.48Å; Y8-N11 PolarHBondContact O-N 3.1Å; L9-N11 VanDerWaalsContact C-N 3.32Å
12	N	77.2	Confident	75.1	Confident	59 Å²	59	104 Å²	104	32%	0.316	54%	0.535	S	S	.	.			trans	-120.6	106	177.2	-167.4	-51.5	0	0	0	111.1	Y8 L9 V10 Q14 V15 I16	Y8-N12 PolarHBondContact O-N 3.24Å; L9-N12 PolarHBondContact O-N 2.91Å; V10-N12 VanDerWaalsContact C-N 3.29Å; N12-Q14 VanDerWaalsContact C-N 3.35Å; N12-Q14 PolarHBondContact O-N 3.31Å; N12-Q14 PolarHBondContact OD1-N 3.03Å; N12-V15 HydrophobicContact CB-CB 4.25Å; N12-V15 HydrophobicContact CB-CG2 4.02Å; N12-V15 PolarHBondContact O-N 3.03Å; N12-V15 PolarHBondContact OD1-N 3.13Å; N12-I16 WeakPolarHBondContact O-CG1 3.36Å; N12-I16 PolarHBondContact O-N 3.38Å; N12-I16 VanDerWaalsContact O-N 3.16Å
13	L	72.1	Confident	75.2	Confident	118 Å²	118	107.7 Å²	107.7	62%	0.618	54%	0.539	S	S	*	.	H	α-helix	trans	-58.3	-41.8	-175.8	-176.7	62.9	0	0	0	113.2	V15 I16 E17	L13-V15 VanDerWaalsContact C-N 3.28Å; L13-V15 PolarHBondContact O-N 2.78Å; L13-I16 WeakPolarHBondContact O-CB 3.35Å; L13-I16 PolarHBondContact O-N 2.92Å; L13-I16 VanDerWaalsContact O-N 3.17Å; L13-E17 WeakPolarHBondContact O-CG 3.41Å; L13-E17 PolarHBondContact O-N 2.7Å
14	Q	73.4	Confident	75.4	Confident	144 Å²	144	107.6 Å²	107.6	67%	0.673	54%	0.536	S	S	*	.	H	α-helix	trans	-64.2	-35.3	-179.6	-72.3	-180	-39.4	0	0	112.1	N12 E17 K18	N12-Q14 VanDerWaalsContact C-N 3.35Å; N12-Q14 PolarHBondContact O-N 3.31Å; N12-Q14 PolarHBondContact OD1-N 3.03Å; Q14-E17 PolarHBondContact O-N 2.83Å; Q14-K18 VanDerWaalsContact O-CG 3.28Å; Q14-K18 WeakPolarHBondContact O-CG 3.34Å; Q14-K18 PolarHBondContact O-N 3.48Å; Q14-K18 VanDerWaalsContact O-N 3.1Å
15	V	74.3	Confident	75.4	Confident	48 Å²	48	100.6 Å²	100.6	29%	0.291	51%	0.514	S	S	.	.	H	α-helix	trans	-69.6	-41.1	176.4	178.5	0	0	0	0	110.4	L9 N12 L13 E17 K18 L19	L9-V15 HydrophobicContact CD2-CG1 3.57Å; N12-V15 HydrophobicContact CB-CB 4.25Å; N12-V15 HydrophobicContact CB-CG2 4.02Å; N12-V15 PolarHBondContact O-N 3.03Å; N12-V15 PolarHBondContact OD1-N 3.13Å; L13-V15 VanDerWaalsContact C-N 3.28Å; L13-V15 PolarHBondContact O-N 2.78Å; V15-E17 VanDerWaalsContact C-N 3.34Å; V15-E17 PolarHBondContact O-N 3.35Å; V15-K18 PolarHBondContact O-N 2.89Å; V15-L19 HydrophobicContact CG1-CD1 3.83Å; V15-L19 HydrophobicContact CG1-CG 4.2Å; V15-L19 WeakPolarHBondContact O-CB 3.39Å; V15-L19 WeakPolarHBondContact O-CG 3.35Å; V15-L19 PolarHBondContact O-N 3.3Å
16	I	72.6	Confident	75.2	Confident	71 Å²	71	101 Å²	101	36%	0.364	51%	0.509	S	S	.	.	H	α-helix	trans	-60.9	-43.3	175.1	-62.1	166.2	0	0	0	110.9	L9 V10 N12 L13 L19 A20	L9-I16 WeakPolarHBondContact O-CG1 3.45Å; V10-I16 WeakPolarHBondContact O-CD1 3.23Å; N12-I16 WeakPolarHBondContact O-CG1 3.36Å; N12-I16 PolarHBondContact O-N 3.38Å; N12-I16 VanDerWaalsContact O-N 3.16Å; L13-I16 WeakPolarHBondContact O-CB 3.35Å; L13-I16 PolarHBondContact O-N 2.92Å; L13-I16 VanDerWaalsContact O-N 3.17Å; I16-L19 CarbonylContact O-C 3.42Å; I16-L19 WeakPolarHBondContact O-CB 3.41Å; I16-L19 PolarHBondContact O-N 3.2Å; I16-A20 WeakPolarHBondContact O-CB 3.29Å; I16-A20 PolarHBondContact O-N 3.31Å
17	E	69.1	Low	75.4	Confident	102 Å²	102	104.3 Å²	104.3	48%	0.477	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-47.9	177.8	-74.6	175.2	167.1	0	0	111.6	L13 Q14 V15 L19 A20 E21	L13-E17 WeakPolarHBondContact O-CG 3.41Å; L13-E17 PolarHBondContact O-N 2.7Å; Q14-E17 PolarHBondContact O-N 2.83Å; V15-E17 VanDerWaalsContact C-N 3.34Å; V15-E17 PolarHBondContact O-N 3.35Å; E17-L19 VanDerWaalsContact C-N 3.29Å; E17-L19 PolarHBondContact O-N 3.48Å; E17-A20 PolarHBondContact O-N 3.36Å; E17-E21 WeakPolarHBondContact O-CG 3.5Å; E17-E21 PolarHBondContact O-N 3.44Å
18	K	74.6	Confident	75.5	Confident	134 Å²	134	103.9 Å²	103.9	58%	0.583	51%	0.511	S	S	*	.	H	α-helix	trans	-64.1	-35.8	177	-68.1	-73	151.4	-146.8	0	112.5	Q14 V15 E21 S22	Q14-K18 VanDerWaalsContact O-CG 3.28Å; Q14-K18 WeakPolarHBondContact O-CG 3.34Å; Q14-K18 PolarHBondContact O-N 3.48Å; Q14-K18 VanDerWaalsContact O-N 3.1Å; V15-K18 PolarHBondContact O-N 2.89Å; K18-E21 IonicContact NZ-OE1 2.86Å; K18-E21 IonicContact NZ-OE2 3.51Å; K18-E21 PolarHBondContact NZ-OE2 2.9Å; K18-S22 PolarHBondContact O-N 3.49Å
19	L	70.4	Confident	75.5	Confident	71 Å²	71	98 Å²	98	37%	0.372	50%	0.5	S	S	.	.	H	α-helix	trans	-67.6	-43	173.6	-81.4	179.7	0	0	0	111.2	V15 I16 E17 E21 S22 I25	V15-L19 HydrophobicContact CG1-CD1 3.83Å; V15-L19 HydrophobicContact CG1-CG 4.2Å; V15-L19 WeakPolarHBondContact O-CB 3.39Å; V15-L19 WeakPolarHBondContact O-CG 3.35Å; V15-L19 PolarHBondContact O-N 3.3Å; I16-L19 CarbonylContact O-C 3.42Å; I16-L19 WeakPolarHBondContact O-CB 3.41Å; I16-L19 PolarHBondContact O-N 3.2Å; E17-L19 VanDerWaalsContact C-N 3.29Å; E17-L19 PolarHBondContact O-N 3.48Å; L19-E21 VanDerWaalsContact C-N 3.3Å; L19-E21 PolarHBondContact O-N 3.11Å; L19-S22 WeakPolarHBondContact O-CB 3.44Å; L19-S22 PolarHBondContact O-N 2.78Å; L19-S22 PolarHBondContact O-OG 2.95Å; L19-I25 VanDerWaalsContact C-CD1 3.48Å; L19-I25 HydrophobicContact CB-CD1 3.41Å; L19-I25 VanDerWaalsContact CB-CD1 3.41Å; L19-I25 HydrophobicContact CD1-CD1 4.48Å; L19-I25 HydrophobicContact CD2-CD1 3.91Å; L19-I25 HydrophobicContact CG-CD1 4.11Å; L19-I25 VanDerWaalsContact O-CB 3.29Å; L19-I25 WeakPolarHBondContact O-CB 3.31Å; L19-I25 WeakPolarHBondContact O-CD1 3.45Å
20	A	69.8	Low	75.9	Confident	53 Å²	53	99.4 Å²	99.4	44%	0.438	50%	0.504	S	S	.	.	H	α-helix	trans	-64.9	-33.7	175.6	0	0	0	0	0	112.7	I16 E17 S22	I16-A20 WeakPolarHBondContact O-CB 3.29Å; I16-A20 PolarHBondContact O-N 3.31Å; E17-A20 PolarHBondContact O-N 3.36Å; A20-S22 PolarHBondContact O-N 3.46Å
21	E	76.2	Confident	76.1	Confident	112 Å²	112	100.1 Å²	100.1	52%	0.523	50%	0.504	S	S	.	.	H	α-helix	trans	-64.4	-27.7	171.7	-74.5	175.8	169.8	0	0	112.2	E17 K18 L19 R26	E17-E21 WeakPolarHBondContact O-CG 3.5Å; E17-E21 PolarHBondContact O-N 3.44Å; K18-E21 IonicContact NZ-OE1 2.86Å; K18-E21 IonicContact NZ-OE2 3.51Å; K18-E21 PolarHBondContact NZ-OE2 2.9Å; L19-E21 VanDerWaalsContact C-N 3.3Å; L19-E21 PolarHBondContact O-N 3.11Å; E21-R26 PolarHBondContact O-NH2 3.09Å
22	S	80.1	Confident	76.1	Confident	35 Å²	35	97.4 Å²	97.4	25%	0.245	49%	0.493	C	S	.	.	S	Bend	trans	-63.8	145.4	-178.6	84.7	0	0	0	0	113.1	K18 L19 A20 I25 R26	K18-S22 PolarHBondContact O-N 3.49Å; L19-S22 WeakPolarHBondContact O-CB 3.44Å; L19-S22 PolarHBondContact O-N 2.78Å; L19-S22 PolarHBondContact O-OG 2.95Å; A20-S22 PolarHBondContact O-N 3.46Å; S22-I25 PolarHBondContact O-N 3.36Å; S22-R26 PolarHBondContact O-N 2.98Å
23	R	74.1	Confident	76.4	Confident	215 Å²	215	97.2 Å²	97.2	81%	0.811	50%	0.499	S	S	*	.	H	α-helix	trans	-59.4	-41.8	177.9	-64.5	-176	177.6	-165.2	-0.6	113.3	I25 R26 R27	R23-I25 PolarHBondContact O-N 3.27Å; R23-R26 PolarHBondContact O-N 3.43Å; R23-R27 WeakPolarHBondContact O-CG 3.38Å; R23-R27 PolarHBondContact O-N 2.99Å
24	P	79.4	Confident	76.9	Confident	94 Å²	94	98.2 Å²	98.2	61%	0.61	50%	0.496	S	S	*	.	H	α-helix	trans	-61.9	-42	-179.4	-25.1	35.5	0	0	0	113.8	R27 A28	P24-R27 PolarHBondContact O-N 3.18Å; P24-A28 PolarHBondContact O-N 3.45Å
25	I	78.5	Confident	77.5	Confident	67 Å²	67	94.1 Å²	94.1	34%	0.344	49%	0.487	S	S	.	.	H	α-helix	trans	-73.8	-36.6	-178.5	-72.2	171.1	0	0	0	111	L19 S22 R23 R27 A28 A29	L19-I25 VanDerWaalsContact C-CD1 3.48Å; L19-I25 HydrophobicContact CB-CD1 3.41Å; L19-I25 VanDerWaalsContact CB-CD1 3.41Å; L19-I25 HydrophobicContact CD1-CD1 4.48Å; L19-I25 HydrophobicContact CD2-CD1 3.91Å; L19-I25 HydrophobicContact CG-CD1 4.11Å; L19-I25 VanDerWaalsContact O-CB 3.29Å; L19-I25 WeakPolarHBondContact O-CB 3.31Å; L19-I25 WeakPolarHBondContact O-CD1 3.45Å; S22-I25 PolarHBondContact O-N 3.36Å; R23-I25 PolarHBondContact O-N 3.27Å; I25-R27 VanDerWaalsContact C-N 3.28Å; I25-R27 PolarHBondContact O-N 2.91Å; I25-A28 PolarHBondContact O-N 3.3Å; I25-A29 WeakPolarHBondContact O-CB 3.25Å; I25-A29 PolarHBondContact O-N 3.46Å
26	R	73.6	Confident	77.9	Confident	138 Å²	138	96.5 Å²	96.5	52%	0.521	50%	0.498	S	S	.	.	H	α-helix	trans	-56.9	-42.8	170	-165.5	177.9	-52.4	-131.3	0.5	112	E21 S22 R23 Q30	E21-R26 PolarHBondContact O-NH2 3.09Å; S22-R26 PolarHBondContact O-N 2.98Å; R23-R26 PolarHBondContact O-N 3.43Å; R26-Q30 WeakPolarHBondContact O-CB 3.49Å; R26-Q30 WeakPolarHBondContact O-CG 3.37Å; R26-Q30 PolarHBondContact O-N 2.81Å
27	R	79.8	Confident	78.2	Confident	168 Å²	168	96.6 Å²	96.6	63%	0.634	50%	0.501	S	S	*	.	H	α-helix	trans	-66.3	-43.2	175.1	-68.6	-59.4	-172	-173.9	5.7	112.1	R23 P24 I25 A29 Q30 L31	R23-R27 WeakPolarHBondContact O-CG 3.38Å; R23-R27 PolarHBondContact O-N 2.99Å; P24-R27 PolarHBondContact O-N 3.18Å; I25-R27 VanDerWaalsContact C-N 3.28Å; I25-R27 PolarHBondContact O-N 2.91Å; R27-A29 PolarHBondContact O-N 2.86Å; R27-Q30 VanDerWaalsContact NH1-OE1 3.11Å; R27-Q30 PolarHBondContact O-N 3.37Å; R27-L31 WeakPolarHBondContact O-CB 3.44Å; R27-L31 VanDerWaalsContact O-CG 3.29Å; R27-L31 WeakPolarHBondContact O-CG 3.25Å; R27-L31 PolarHBondContact O-N 2.95Å
28	A	78.9	Confident	78.9	Confident	50 Å²	50	96.8 Å²	96.8	41%	0.413	50%	0.501	S	S	.	.	H	α-helix	trans	-62.2	-42.8	177	0	0	0	0	0	112.3	P24 I25 L31 T32	P24-A28 PolarHBondContact O-N 3.45Å; I25-A28 PolarHBondContact O-N 3.3Å; A28-L31 PolarHBondContact O-N 3.48Å; A28-T32 WeakPolarHBondContact O-CB 3.09Å; A28-T32 PolarHBondContact O-N 3.32Å; A28-T32 PolarHBondContact O-OG1 3.44Å
29	A	80.1	Confident	78.8	Confident	58 Å²	58	93.3 Å²	93.3	48%	0.479	50%	0.497	S	S	.	.	H	α-helix	trans	-63.3	-44	175.3	0	0	0	0	0	111.6	I25 R27 T32 A33	I25-A29 WeakPolarHBondContact O-CB 3.25Å; I25-A29 PolarHBondContact O-N 3.46Å; R27-A29 PolarHBondContact O-N 2.86Å; A29-T32 PolarHBondContact O-N 2.87Å; A29-A33 VanDerWaalsContact O-CB 3.3Å; A29-A33 WeakPolarHBondContact O-CB 3.27Å; A29-A33 PolarHBondContact O-N 3.39Å
30	Q	81.7	Confident	79.1	Confident	96 Å²	96	94.4 Å²	94.4	45%	0.449	50%	0.5	S	S	.	.	H	α-helix	trans	-60.6	-44.9	174.9	-75.8	172.4	-7.1	0	0	112.1	R26 R27 T32 A33 Y34	R26-Q30 WeakPolarHBondContact O-CB 3.49Å; R26-Q30 WeakPolarHBondContact O-CG 3.37Å; R26-Q30 PolarHBondContact O-N 2.81Å; R27-Q30 VanDerWaalsContact NH1-OE1 3.11Å; R27-Q30 PolarHBondContact O-N 3.37Å; Q30-T32 VanDerWaalsContact C-N 3.33Å; Q30-T32 PolarHBondContact O-N 3.05Å; Q30-A33 PolarHBondContact O-N 3.22Å; Q30-Y34 WeakPolarHBondContact O-CB 3.37Å; Q30-Y34 PolarHBondContact O-N 3.4Å
31	L	82.6	Confident	79.3	Confident	120 Å²	120	96.9 Å²	96.9	63%	0.628	51%	0.505	S	S	*	.	H	α-helix	trans	-62.6	-41.8	176.5	-72.7	170.8	0	0	0	111.4	R27 A28 Y34 A35	R27-L31 WeakPolarHBondContact O-CB 3.44Å; R27-L31 VanDerWaalsContact O-CG 3.29Å; R27-L31 WeakPolarHBondContact O-CG 3.25Å; R27-L31 PolarHBondContact O-N 2.95Å; A28-L31 PolarHBondContact O-N 3.48Å; L31-Y34 PolarHBondContact O-N 2.95Å; L31-A35 WeakPolarHBondContact O-CB 3.19Å; L31-A35 PolarHBondContact O-N 3.16Å
32	T	80.2	Confident	78.9	Confident	93 Å²	93	95.9 Å²	95.9	57%	0.571	51%	0.506	S	S	*	.	H	α-helix	trans	-66.5	-48.2	178.5	-55.3	0	0	0	0	111.1	A28 A29 Q30 Y34 A35 L36	A28-T32 WeakPolarHBondContact O-CB 3.09Å; A28-T32 PolarHBondContact O-N 3.32Å; A28-T32 PolarHBondContact O-OG1 3.44Å; A29-T32 PolarHBondContact O-N 2.87Å; Q30-T32 VanDerWaalsContact C-N 3.33Å; Q30-T32 PolarHBondContact O-N 3.05Å; T32-Y34 VanDerWaalsContact C-N 3.31Å; T32-Y34 PolarHBondContact O-N 2.85Å; T32-A35 PolarHBondContact O-N 2.81Å; T32-L36 VanDerWaalsContact O-CB 3.26Å; T32-L36 WeakPolarHBondContact O-CB 3.37Å; T32-L36 PolarHBondContact O-N 3.35Å
33	A	83	Confident	78	Confident	54 Å²	54	95.6 Å²	95.6	45%	0.446	51%	0.509	S	S	.	.	H	α-helix	trans	-61.4	-40.8	176.9	0	0	0	0	0	111.5	A29 Q30 T37	A29-A33 VanDerWaalsContact O-CB 3.3Å; A29-A33 WeakPolarHBondContact O-CB 3.27Å; A29-A33 PolarHBondContact O-N 3.39Å; Q30-A33 PolarHBondContact O-N 3.22Å; A33-T37 WeakPolarHBondContact O-CB 3.23Å; A33-T37 PolarHBondContact O-N 2.97Å; A33-T37 PolarHBondContact O-OG1 2.85Å
34	Y	82.4	Confident	77.4	Confident	139 Å²	139	93.6 Å²	93.6	55%	0.545	50%	0.501	S	S	.	.	H	α-helix	trans	-66	-46.8	176.4	-178.6	-101	0	0	0	112	Q30 L31 T32 T37 K38	Q30-Y34 WeakPolarHBondContact O-CB 3.37Å; Q30-Y34 PolarHBondContact O-N 3.4Å; L31-Y34 PolarHBondContact O-N 2.95Å; T32-Y34 VanDerWaalsContact C-N 3.31Å; T32-Y34 PolarHBondContact O-N 2.85Å; Y34-T37 PolarHBondContact O-N 3.49Å; Y34-K38 HydrophobicContact CD1-CD 4.24Å; Y34-K38 HydrophobicContact CE1-CD 3.58Å; Y34-K38 HydrophobicContact CE1-CG 4.3Å; Y34-K38 HydrophobicContact CE2-CD 4.18Å; Y34-K38 HydrophobicContact CE2-CG 4.42Å; Y34-K38 VanDerWaalsContact O-CB 3.31Å; Y34-K38 WeakPolarHBondContact O-CB 3.19Å; Y34-K38 WeakPolarHBondContact O-CG 3.4Å; Y34-K38 PolarHBondContact O-N 2.98Å; Y34-K38 WeakPolarHBondContact OH-CE 3.36Å; Y34-K38 PolarHBondContact OH-NZ 3.45Å
35	A	86.2	Confident	76.6	Confident	58 Å²	58	92.5 Å²	92.5	48%	0.479	49%	0.49	S	S	.	.	H	α-helix	trans	-62.6	-45.5	177.7	0	0	0	0	0	111.3	L31 T32 K38 A39	L31-A35 WeakPolarHBondContact O-CB 3.19Å; L31-A35 PolarHBondContact O-N 3.16Å; T32-A35 PolarHBondContact O-N 2.81Å; A35-K38 PolarHBondContact O-N 3.44Å; A35-A39 WeakPolarHBondContact O-CB 3.4Å; A35-A39 PolarHBondContact O-N 2.76Å
36	L	83.1	Confident	75.5	Confident	99 Å²	99	92.8 Å²	92.8	52%	0.518	50%	0.495	S	S	.	.	H	α-helix	trans	-63.8	-47.8	177.9	-177.4	63.2	0	0	0	111.3	T32 K38 A39 Q40	T32-L36 VanDerWaalsContact O-CB 3.26Å; T32-L36 WeakPolarHBondContact O-CB 3.37Å; T32-L36 PolarHBondContact O-N 3.35Å; L36-K38 VanDerWaalsContact C-N 3.35Å; L36-K38 PolarHBondContact O-N 2.89Å; L36-A39 PolarHBondContact O-N 3.3Å; L36-Q40 HydrophobicContact CD1-CG 4.49Å; L36-Q40 WeakPolarHBondContact O-CB 3.29Å; L36-Q40 VanDerWaalsContact O-CG 3.3Å; L36-Q40 WeakPolarHBondContact O-CG 3.31Å; L36-Q40 PolarHBondContact O-N 2.82Å
37	T	79.4	Confident	74.7	Confident	72 Å²	72	89.5 Å²	89.5	44%	0.442	49%	0.494	S	S	.	.	H	α-helix	trans	-61.5	-44.2	178.2	-58.3	0	0	0	0	110.9	A33 Y34 Q40 I41	A33-T37 WeakPolarHBondContact O-CB 3.23Å; A33-T37 PolarHBondContact O-N 2.97Å; A33-T37 PolarHBondContact O-OG1 2.85Å; Y34-T37 PolarHBondContact O-N 3.49Å; T37-Q40 PolarHBondContact O-N 3.17Å; T37-I41 HydrophobicContact CG2-CD1 3.85Å; T37-I41 VanDerWaalsContact O-CG1 3.26Å; T37-I41 WeakPolarHBondContact O-CG1 3.37Å; T37-I41 PolarHBondContact O-N 2.99Å
38	K	81.9	Confident	73.6	Confident	106 Å²	106	86 Å²	86	46%	0.461	48%	0.484	S	S	.	.	H	α-helix	trans	-65.4	-40.9	175.4	-80.9	-158.4	160.3	-172.4	0	112.7	Y34 A35 L36 Q40 I41 V42	Y34-K38 HydrophobicContact CD1-CD 4.24Å; Y34-K38 HydrophobicContact CE1-CD 3.58Å; Y34-K38 HydrophobicContact CE1-CG 4.3Å; Y34-K38 HydrophobicContact CE2-CD 4.18Å; Y34-K38 HydrophobicContact CE2-CG 4.42Å; Y34-K38 VanDerWaalsContact O-CB 3.31Å; Y34-K38 WeakPolarHBondContact O-CB 3.19Å; Y34-K38 WeakPolarHBondContact O-CG 3.4Å; Y34-K38 PolarHBondContact O-N 2.98Å; Y34-K38 WeakPolarHBondContact OH-CE 3.36Å; Y34-K38 PolarHBondContact OH-NZ 3.45Å; A35-K38 PolarHBondContact O-N 3.44Å; L36-K38 VanDerWaalsContact C-N 3.35Å; L36-K38 PolarHBondContact O-N 2.89Å; K38-Q40 VanDerWaalsContact C-N 3.3Å; K38-Q40 PolarHBondContact O-N 2.95Å; K38-I41 PolarHBondContact O-N 2.83Å; K38-V42 WeakPolarHBondContact O-CB 3.46Å; K38-V42 VanDerWaalsContact O-CG2 3.28Å; K38-V42 WeakPolarHBondContact O-CG2 3.4Å; K38-V42 PolarHBondContact O-N 3.41Å
39	A	73.6	Confident	72.5	Confident	61 Å²	61	91.3 Å²	91.3	50%	0.504	49%	0.494	S	S	.	.	H	α-helix	trans	-63.3	-38.9	176	0	0	0	0	0	111.3	A35 L36 G43	A35-A39 WeakPolarHBondContact O-CB 3.4Å; A35-A39 PolarHBondContact O-N 2.76Å; L36-A39 PolarHBondContact O-N 3.3Å; A39-G43 WeakPolarHBondContact O-CA 3.23Å; A39-G43 PolarHBondContact O-N 2.78Å
40	Q	75.7	Confident	71.3	Confident	95 Å²	95	92.1 Å²	92.1	44%	0.444	49%	0.492	S	S	.	.	H	α-helix	trans	-66.9	-41.8	174.4	-74.2	178.1	-4.6	0	0	112.1	L36 T37 K38 R44	L36-Q40 HydrophobicContact CD1-CG 4.49Å; L36-Q40 WeakPolarHBondContact O-CB 3.29Å; L36-Q40 VanDerWaalsContact O-CG 3.3Å; L36-Q40 WeakPolarHBondContact O-CG 3.31Å; L36-Q40 PolarHBondContact O-N 2.82Å; T37-Q40 PolarHBondContact O-N 3.17Å; K38-Q40 VanDerWaalsContact C-N 3.3Å; K38-Q40 PolarHBondContact O-N 2.95Å; Q40-R44 VanDerWaalsContact O-CB 3.23Å; Q40-R44 WeakPolarHBondContact O-CB 3.36Å; Q40-R44 WeakPolarHBondContact O-CG 3.31Å; Q40-R44 PolarHBondContact O-N 2.77Å
41	I	74.3	Confident	69.9	Low	104 Å²	104	95.1 Å²	95.1	53%	0.533	51%	0.508	S	S	.	.	H	α-helix	trans	-66.9	-49	177.6	-67.6	164.3	0	0	0	110.7	T37 K38 G43 R44 D45	T37-I41 HydrophobicContact CG2-CD1 3.85Å; T37-I41 VanDerWaalsContact O-CG1 3.26Å; T37-I41 WeakPolarHBondContact O-CG1 3.37Å; T37-I41 PolarHBondContact O-N 2.99Å; K38-I41 PolarHBondContact O-N 2.83Å; I41-G43 VanDerWaalsContact C-N 3.32Å; I41-G43 PolarHBondContact O-N 3.29Å; I41-R44 PolarHBondContact O-N 2.88Å; I41-D45 WeakPolarHBondContact O-CB 3.37Å; I41-D45 PolarHBondContact O-N 2.83Å
42	V	69.4	Low	68.7	Low	91 Å²	91	98.2 Å²	98.2	55%	0.552	51%	0.512	S	S	*	.	H	α-helix	trans	-63.9	-40.3	177.4	173.1	0	0	0	0	110.6	K38 T46	K38-V42 WeakPolarHBondContact O-CB 3.46Å; K38-V42 VanDerWaalsContact O-CG2 3.28Å; K38-V42 WeakPolarHBondContact O-CG2 3.4Å; K38-V42 PolarHBondContact O-N 3.41Å; V42-T46 HydrophobicContact CG1-CG2 4.36Å; V42-T46 VanDerWaalsContact O-CB 3.31Å; V42-T46 WeakPolarHBondContact O-CB 3.3Å; V42-T46 VanDerWaalsContact O-CG2 3.29Å; V42-T46 WeakPolarHBondContact O-CG2 3.44Å; V42-T46 PolarHBondContact O-N 3.45Å; V42-T46 PolarHBondContact O-OG1 2.96Å
43	G	61.2	Low	67.2	Low	29 Å²	29	96 Å²	96	30%	0.299	50%	0.5	S	S	.	.	H	α-helix	trans	-66	-37.3	176.2	0	0	0	0	0	113.1	A39 I41 T46 S47	A39-G43 WeakPolarHBondContact O-CA 3.23Å; A39-G43 PolarHBondContact O-N 2.78Å; I41-G43 VanDerWaalsContact C-N 3.32Å; I41-G43 PolarHBondContact O-N 3.29Å; G43-T46 WeakPolarHBondContact CA-OG1 3.21Å; G43-T46 PolarHBondContact O-OG1 2.62Å; G43-S47 WeakPolarHBondContact O-CB 3.23Å; G43-S47 PolarHBondContact O-N 3.46Å; G43-S47 PolarHBondContact O-OG 2.95Å
44	R	61.6	Low	65.7	Low	174 Å²	174	102.8 Å²	102.8	66%	0.657	52%	0.523	S	S	*	.	H	α-helix	trans	-72.4	-43.4	174	-77.1	179.5	-176.3	176.2	2.7	112.2	Q40 I41 S47 E48	Q40-R44 VanDerWaalsContact O-CB 3.23Å; Q40-R44 WeakPolarHBondContact O-CB 3.36Å; Q40-R44 WeakPolarHBondContact O-CG 3.31Å; Q40-R44 PolarHBondContact O-N 2.77Å; I41-R44 PolarHBondContact O-N 2.88Å; R44-S47 PolarHBondContact O-N 2.9Å; R44-E48 WeakPolarHBondContact O-CB 3.32Å; R44-E48 WeakPolarHBondContact O-CG 3.48Å; R44-E48 PolarHBondContact O-N 3.17Å
45	D	61.4	Low	64.4	Low	70 Å²	70	99 Å²	99	37%	0.374	51%	0.514	S	S	.	.	H	α-helix	trans	-69.7	-36.3	-179.9	-165	24.2	0	0	0	111.5	I41 R49	I41-D45 WeakPolarHBondContact O-CB 3.37Å; I41-D45 PolarHBondContact O-N 2.83Å; D45-R49 WeakPolarHBondContact O-CB 3.25Å; D45-R49 VanDerWaalsContact O-CG 3.23Å; D45-R49 WeakPolarHBondContact O-CG 3.41Å; D45-R49 PolarHBondContact O-N 3.33Å; D45-R49 IonicContact OD1-CZ 2.79Å; D45-R49 IonicContact OD1-NE 3.32Å; D45-R49 PolarHBondContact OD1-NE 3.1Å; D45-R49 IonicContact OD1-NH2 3.7Å; D45-R49 IonicContact OD2-CZ 3.97Å; D45-R49 IonicContact OD2-NE 3.55Å; D45-R49 IonicContact OD2-NH2 3.71Å; D45-R49 PolarHBondContact OD2-NH2 3.32Å
46	T	56.2	Low	62.9	Low	74 Å²	74	100.4 Å²	100.4	45%	0.454	51%	0.513	S	S	.	.	H	α-helix	trans	-69.4	-40.8	170.3	50.5	0	0	0	0	111.9	V42 G43 R49 V50	V42-T46 HydrophobicContact CG1-CG2 4.36Å; V42-T46 VanDerWaalsContact O-CB 3.31Å; V42-T46 WeakPolarHBondContact O-CB 3.3Å; V42-T46 VanDerWaalsContact O-CG2 3.29Å; V42-T46 WeakPolarHBondContact O-CG2 3.44Å; V42-T46 PolarHBondContact O-N 3.45Å; V42-T46 PolarHBondContact O-OG1 2.96Å; G43-T46 WeakPolarHBondContact CA-OG1 3.21Å; G43-T46 PolarHBondContact O-OG1 2.62Å; T46-R49 PolarHBondContact O-N 3.29Å; T46-V50 VanDerWaalsContact O-CB 3.25Å; T46-V50 WeakPolarHBondContact O-CB 3.2Å; T46-V50 WeakPolarHBondContact O-CG2 3.28Å; T46-V50 PolarHBondContact O-N 2.76Å
47	S	55.3	Low	61.5	Low	69 Å²	69	106.1 Å²	106.1	48%	0.483	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-43.1	174.6	-66.5	0	0	0	0	112.2	G43 R44 V50 M51	G43-S47 WeakPolarHBondContact O-CB 3.23Å; G43-S47 PolarHBondContact O-N 3.46Å; G43-S47 PolarHBondContact O-OG 2.95Å; R44-S47 PolarHBondContact O-N 2.9Å; S47-V50 PolarHBondContact O-N 2.9Å; S47-M51 WeakPolarHBondContact O-CB 3.36Å; S47-M51 VanDerWaalsContact O-CG 3.25Å; S47-M51 WeakPolarHBondContact O-CG 3.34Å; S47-M51 PolarHBondContact O-N 3.47Å
48	E	57.2	Low	60.3	Low	94 Å²	94	108.6 Å²	108.6	44%	0.439	53%	0.534	S	S	.	.	H	α-helix	trans	-66.7	-38.8	177.5	-79.1	-168.3	-172.5	0	0	112.3	R44 M51 R52	R44-E48 WeakPolarHBondContact O-CB 3.32Å; R44-E48 WeakPolarHBondContact O-CG 3.48Å; R44-E48 PolarHBondContact O-N 3.17Å; E48-M51 PolarHBondContact O-N 3.19Å; E48-R52 WeakPolarHBondContact O-CB 3.44Å; E48-R52 WeakPolarHBondContact O-CG 3.22Å; E48-R52 PolarHBondContact O-N 3.09Å; E48-R52 IonicContact OE2-CZ 3.59Å; E48-R52 IonicContact OE2-NH1 3.85Å; E48-R52 IonicContact OE2-NH2 2.76Å; E48-R52 PolarHBondContact OE2-NH2 3.27Å
49	R	56.5	Low	59	Low	162 Å²	162	106.9 Å²	106.9	61%	0.611	53%	0.532	S	S	*	.	H	α-helix	trans	-68.2	-36.1	173.2	-72.8	176.6	-161.1	-160.1	7.7	112.5	D45 T46 S53	D45-R49 WeakPolarHBondContact O-CB 3.25Å; D45-R49 VanDerWaalsContact O-CG 3.23Å; D45-R49 WeakPolarHBondContact O-CG 3.41Å; D45-R49 PolarHBondContact O-N 3.33Å; D45-R49 IonicContact OD1-CZ 2.79Å; D45-R49 IonicContact OD1-NE 3.32Å; D45-R49 PolarHBondContact OD1-NE 3.1Å; D45-R49 IonicContact OD1-NH2 3.7Å; D45-R49 IonicContact OD2-CZ 3.97Å; D45-R49 IonicContact OD2-NE 3.55Å; D45-R49 IonicContact OD2-NH2 3.71Å; D45-R49 PolarHBondContact OD2-NH2 3.32Å; T46-R49 PolarHBondContact O-N 3.29Å; R49-S53 VanDerWaalsContact O-CB 3.27Å; R49-S53 WeakPolarHBondContact O-CB 3.31Å; R49-S53 PolarHBondContact O-N 3.12Å; R49-S53 PolarHBondContact O-OG 2.83Å
50	V	53.9	Low	58	Low	74 Å²	74	114.1 Å²	114.1	45%	0.448	55%	0.547	S	S	.	.	H	α-helix	trans	-68.7	-35.5	173.9	169.4	0	0	0	0	111.1	T46 S47 L56	T46-V50 VanDerWaalsContact O-CB 3.25Å; T46-V50 WeakPolarHBondContact O-CB 3.2Å; T46-V50 WeakPolarHBondContact O-CG2 3.28Å; T46-V50 PolarHBondContact O-N 2.76Å; S47-V50 PolarHBondContact O-N 2.9Å; V50-L56 HydrophobicContact CG1-CD1 4.28Å; V50-L56 HydrophobicContact CG1-CD2 3.73Å; V50-L56 HydrophobicContact CG1-CG 4.14Å; V50-L56 VanDerWaalsContact O-CD1 3.29Å; V50-L56 WeakPolarHBondContact O-CD1 3.2Å; V50-L56 WeakPolarHBondContact O-CG 3.24Å
51	M	53.9	Low	57	Low	159 Å²	159	116.8 Å²	116.8	78%	0.783	56%	0.559	S	S	*	*	H	α-helix	trans	-78.3	-32.8	176.8	-71.5	-165	82.5	0	0	113.7	S47 E48	S47-M51 WeakPolarHBondContact O-CB 3.36Å; S47-M51 VanDerWaalsContact O-CG 3.25Å; S47-M51 WeakPolarHBondContact O-CG 3.34Å; S47-M51 PolarHBondContact O-N 3.47Å; E48-M51 PolarHBondContact O-N 3.19Å
52	R	57.2	Low	55.9	Low	185 Å²	185	117.8 Å²	117.8	70%	0.698	56%	0.561	S	S	*	*	H	α-helix	trans	-81.8	-24.5	178	-74.8	-173	-162.8	132.9	17	113.7	E48 Q54	E48-R52 WeakPolarHBondContact O-CB 3.44Å; E48-R52 WeakPolarHBondContact O-CG 3.22Å; E48-R52 PolarHBondContact O-N 3.09Å; E48-R52 IonicContact OE2-CZ 3.59Å; E48-R52 IonicContact OE2-NH1 3.85Å; E48-R52 IonicContact OE2-NH2 2.76Å; E48-R52 PolarHBondContact OE2-NH2 3.27Å; R52-Q54 PolarHBondContact O-N 3.47Å
53	S	47.4	Very low	55	Low	47 Å²	47	116.6 Å²	116.6	33%	0.329	56%	0.561	S	S	.	*	S	Bend	trans	-83.4	119.3	178.7	63.7	0	0	0	0	109.7	R49 T55 L56	R49-S53 VanDerWaalsContact O-CB 3.27Å; R49-S53 WeakPolarHBondContact O-CB 3.31Å; R49-S53 PolarHBondContact O-N 3.12Å; R49-S53 PolarHBondContact O-OG 2.83Å; S53-T55 WeakPolarHBondContact CB-OG1 3.26Å; S53-T55 PolarHBondContact O-N 2.83Å; S53-L56 PolarHBondContact O-N 3.26Å
54	Q	52.5	Low	54.4	Low	197 Å²	197	118.5 Å²	118.5	92%	0.921	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.9	8.8	167.5	-69.6	170.1	-18.8	0	0	113.3	R52	R52-Q54 PolarHBondContact O-N 3.47Å
55	T	55.3	Low	54.3	Low	59 Å²	59	120.9 Å²	120.9	36%	0.362	59%	0.59	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.3	-10.6	178	-32.8	0	0	0	0	113	S53 R57 Q58 V59	S53-T55 WeakPolarHBondContact CB-OG1 3.26Å; S53-T55 PolarHBondContact O-N 2.83Å; T55-R57 PolarHBondContact O-N 2.8Å; T55-R57 VanDerWaalsContact O-N 3.13Å; T55-Q58 HydrophobicContact CG2-CB 4.24Å; T55-Q58 PolarHBondContact O-N 2.84Å; T55-V59 HydrophobicContact CG2-CG2 4.07Å; T55-V59 WeakPolarHBondContact O-CG2 3.42Å; T55-V59 PolarHBondContact O-N 3.34Å
56	L	53.2	Low	53.9	Low	88 Å²	88	122.7 Å²	122.7	46%	0.461	60%	0.603	S	S	.	*	H	α-helix	trans	-58.9	-24.9	175.7	-84.8	172.3	0	0	0	114.1	V50 S53 R60	V50-L56 HydrophobicContact CG1-CD1 4.28Å; V50-L56 HydrophobicContact CG1-CD2 3.73Å; V50-L56 HydrophobicContact CG1-CG 4.14Å; V50-L56 VanDerWaalsContact O-CD1 3.29Å; V50-L56 WeakPolarHBondContact O-CD1 3.2Å; V50-L56 WeakPolarHBondContact O-CG 3.24Å; S53-L56 PolarHBondContact O-N 3.26Å; L56-R60 VanDerWaalsContact O-CB 3.23Å; L56-R60 WeakPolarHBondContact O-CB 3.4Å; L56-R60 PolarHBondContact O-N 3.3Å
57	R	54	Low	53.8	Low	219 Å²	219	123.9 Å²	123.9	83%	0.826	61%	0.612	S	S	*	*	H	α-helix	trans	-78.6	-34.2	173.3	-76.4	-174.1	175	-172.7	-0.9	113	T55 Q61	T55-R57 PolarHBondContact O-N 2.8Å; T55-R57 VanDerWaalsContact O-N 3.13Å; R57-Q61 PolarHBondContact O-N 2.86Å
58	Q	53.7	Low	53.8	Low	123 Å²	123	124.3 Å²	124.3	58%	0.575	63%	0.628	S	S	*	*	H	α-helix	trans	-73.5	-43.5	172.6	-91.6	174.5	-10.6	0	0	111.3	T55 R60 Q61 E62	T55-Q58 HydrophobicContact CG2-CB 4.24Å; T55-Q58 PolarHBondContact O-N 2.84Å; Q58-R60 VanDerWaalsContact C-N 3.31Å; Q58-R60 PolarHBondContact O-N 3.46Å; Q58-Q61 CarbonylContact O-C 3.57Å; Q58-Q61 PolarHBondContact O-N 3.38Å; Q58-Q61 VanDerWaalsContact O-N 3.08Å; Q58-E62 WeakPolarHBondContact O-CB 3.45Å; Q58-E62 WeakPolarHBondContact O-CG 3.47Å; Q58-E62 PolarHBondContact O-N 3.15Å
59	V	55.8	Low	54	Low	70 Å²	70	123.9 Å²	123.9	42%	0.424	63%	0.628	S	S	.	*	H	α-helix	trans	-65.8	-32	175.7	178.1	0	0	0	0	111.3	T55 Q61 E62 A63	T55-V59 HydrophobicContact CG2-CG2 4.07Å; T55-V59 WeakPolarHBondContact O-CG2 3.42Å; T55-V59 PolarHBondContact O-N 3.34Å; V59-Q61 VanDerWaalsContact C-N 3.34Å; V59-E62 PolarHBondContact O-N 3.24Å; V59-A63 WeakPolarHBondContact O-CA 3.26Å; V59-A63 WeakPolarHBondContact O-CB 3.22Å; V59-A63 PolarHBondContact O-N 3.01Å
60	R	52.3	Low	54.4	Low	214 Å²	214	123.8 Å²	123.8	81%	0.808	64%	0.639	S	S	*	*	H	α-helix	trans	-69.7	-31.2	172.3	-169.6	172.5	-174.2	-177.8	1.2	112.8	L56 Q58 G64	L56-R60 VanDerWaalsContact O-CB 3.23Å; L56-R60 WeakPolarHBondContact O-CB 3.4Å; L56-R60 PolarHBondContact O-N 3.3Å; Q58-R60 VanDerWaalsContact C-N 3.31Å; Q58-R60 PolarHBondContact O-N 3.46Å; R60-G64 PolarHBondContact O-N 2.92Å
61	Q	54.3	Low	54.9	Low	150 Å²	150	126.7 Å²	126.7	70%	0.701	65%	0.648	S	S	*	*	H	α-helix	trans	-79.4	-31	173.8	-76.2	-179.8	2.6	0	0	112.7	R57 Q58 V59	R57-Q61 PolarHBondContact O-N 2.86Å; Q58-Q61 CarbonylContact O-C 3.57Å; Q58-Q61 PolarHBondContact O-N 3.38Å; Q58-Q61 VanDerWaalsContact O-N 3.08Å; V59-Q61 VanDerWaalsContact C-N 3.34Å
62	E	52.5	Low	55.7	Low	125 Å²	125	125 Å²	125	58%	0.584	64%	0.638	S	S	*	*	H	α-helix	trans	-84.6	-30.6	176.1	-72.5	-178.3	175.1	0	0	113.1	Q58 V59 G64 R65 V66	Q58-E62 WeakPolarHBondContact O-CB 3.45Å; Q58-E62 WeakPolarHBondContact O-CG 3.47Å; Q58-E62 PolarHBondContact O-N 3.15Å; V59-E62 PolarHBondContact O-N 3.24Å; E62-G64 VanDerWaalsContact C-N 3.26Å; E62-R65 CarbonylContact O-C 3.53Å; E62-R65 WeakPolarHBondContact O-CA 3.26Å; E62-R65 WeakPolarHBondContact O-CB 3.18Å; E62-R65 PolarHBondContact O-N 3.37Å; E62-V66 PolarHBondContact O-N 3.26Å; E62-V66 VanDerWaalsContact O-N 3.11Å
63	A	49.3	Very low	56.7	Low	66 Å²	66	121 Å²	121	55%	0.545	63%	0.634	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.2	-18.7	169.2	0	0	0	0	0	111.9	V59 R65	V59-A63 WeakPolarHBondContact O-CA 3.26Å; V59-A63 WeakPolarHBondContact O-CB 3.22Å; V59-A63 PolarHBondContact O-N 3.01Å; A63-R65 PolarHBondContact O-N 2.9Å
64	G	49.6	Very low	58	Low	69 Å²	69	121.8 Å²	121.8	71%	0.711	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.6	-9.9	160.9	0	0	0	0	0	113.3	R60 E62	R60-G64 PolarHBondContact O-N 2.92Å; E62-G64 VanDerWaalsContact C-N 3.26Å
65	R	57.8	Low	59.3	Low	224 Å²	224	115.1 Å²	115.1	85%	0.845	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.6	-5	-177.8	-93.2	-175	172.9	143.3	-0.7	115.5	E62 A63	E62-R65 CarbonylContact O-C 3.53Å; E62-R65 WeakPolarHBondContact O-CA 3.26Å; E62-R65 WeakPolarHBondContact O-CB 3.18Å; E62-R65 PolarHBondContact O-N 3.37Å; A63-R65 PolarHBondContact O-N 2.9Å
66	V	54.3	Low	60.6	Low	109 Å²	109	121.4 Å²	121.4	66%	0.661	63%	0.627	S	S	*	*	S	Bend	trans	-151.3	124.2	179.9	-174.9	0	0	0	0	112	E62	E62-V66 PolarHBondContact O-N 3.26Å; E62-V66 VanDerWaalsContact O-N 3.11Å
67	P	53.7	Low	62.2	Low	98 Å²	98	123.2 Å²	123.2	64%	0.636	64%	0.637	S	S	*	*				-127	158.2	-56.1	30.6	-10.8	0	0	0	111.8	D69	P67-D69 PolarHBondContact O-N 3.13Å
68	G	54.6	Low	63.7	Low	79 Å²	79	119.2 Å²	119.2	81%	0.814	62%	0.622	S	S	*	*			trans	-73.7	26.6	-178.1	0	0	0	0	0	116.9
69	D	62.8	Low	65.4	Low	84 Å²	84	120.7 Å²	120.7	45%	0.449	62%	0.622	S	S	.	*			trans	-117.7	72.1	-177.1	-72.6	-33.4	0	0	0	112.2	P67 E71 E72 V73	P67-D69 PolarHBondContact O-N 3.13Å; D69-E71 PolarHBondContact O-N 3.35Å; D69-E71 VanDerWaalsContact O-N 3.1Å; D69-E72 HydrophobicContact CB-CB 3.66Å; D69-E72 PolarHBondContact O-N 3.49Å; D69-V73 PolarHBondContact O-N 3.03Å
70	L	63.5	Low	67.1	Low	160 Å²	160	122 Å²	122	84%	0.838	63%	0.63	S	S	*	*	H	α-helix	trans	-48.5	-31.5	159.7	-107.4	97.1	0	0	0	111.1	S74	L70-S74 WeakPolarHBondContact O-CB 3.45Å; L70-S74 PolarHBondContact O-N 3.43Å
71	E	65.6	Low	68.8	Low	135 Å²	135	120.6 Å²	120.6	63%	0.631	63%	0.625	S	S	*	*	H	α-helix	trans	-65.8	-41.3	177.8	-162.2	171.4	167.1	0	0	112.4	D69 S74 N75	D69-E71 PolarHBondContact O-N 3.35Å; D69-E71 VanDerWaalsContact O-N 3.1Å; E71-S74 PolarHBondContact O-N 2.84Å; E71-S74 PolarHBondContact O-OG 2.88Å; E71-N75 WeakPolarHBondContact O-CB 3.26Å; E71-N75 VanDerWaalsContact O-CG 3.28Å; E71-N75 PolarHBondContact O-N 2.69Å; E71-N75 PolarHBondContact O-ND2 2.88Å; E71-N75 VanDerWaalsContact O-ND2 3.11Å
72	E	71	Confident	70.6	Confident	123 Å²	123	118 Å²	118	58%	0.575	61%	0.613	S	S	*	*	H	α-helix	trans	-71.1	-38.3	178.9	-164.4	174.4	-156.2	0	0	111.8	D69 N75 R76	D69-E72 HydrophobicContact CB-CB 3.66Å; D69-E72 PolarHBondContact O-N 3.49Å; E72-N75 PolarHBondContact O-N 2.81Å; E72-R76 WeakPolarHBondContact O-CB 3.39Å; E72-R76 PolarHBondContact O-N 3.34Å
73	V	77.3	Confident	72.4	Confident	101 Å²	101	116 Å²	116	61%	0.612	61%	0.609	S	S	*	*	H	α-helix	trans	-63.2	-43	171.4	179.2	0	0	0	0	110.5	D69 N75 R76 L77	D69-V73 PolarHBondContact O-N 3.03Å; V73-N75 VanDerWaalsContact C-N 3.32Å; V73-N75 PolarHBondContact O-N 2.86Å; V73-R76 PolarHBondContact O-N 2.76Å; V73-L77 WeakPolarHBondContact O-CB 3.17Å; V73-L77 PolarHBondContact O-N 3.28Å
74	S	74.4	Confident	74.3	Confident	64 Å²	64	119.8 Å²	119.8	45%	0.448	61%	0.614	S	S	.	*	H	α-helix	trans	-62.4	-39.7	176.3	85.2	0	0	0	0	112.1	L70 E71 L77 R78	L70-S74 WeakPolarHBondContact O-CB 3.45Å; L70-S74 PolarHBondContact O-N 3.43Å; E71-S74 PolarHBondContact O-N 2.84Å; E71-S74 PolarHBondContact O-OG 2.88Å; S74-L77 PolarHBondContact O-N 3.49Å; S74-R78 WeakPolarHBondContact O-CB 3.43Å; S74-R78 PolarHBondContact O-N 3.47Å
75	N	81.1	Confident	76.4	Confident	58 Å²	58	120.5 Å²	120.5	31%	0.31	60%	0.604	S	S	.	*	H	α-helix	trans	-70.5	-33.4	179	-80.1	-37.8	0	0	0	112.2	E71 E72 V73 R79	E71-N75 WeakPolarHBondContact O-CB 3.26Å; E71-N75 VanDerWaalsContact O-CG 3.28Å; E71-N75 PolarHBondContact O-N 2.69Å; E71-N75 PolarHBondContact O-ND2 2.88Å; E71-N75 VanDerWaalsContact O-ND2 3.11Å; E72-N75 PolarHBondContact O-N 2.81Å; V73-N75 VanDerWaalsContact C-N 3.32Å; V73-N75 PolarHBondContact O-N 2.86Å; N75-R79 PolarHBondContact O-N 3.44Å; N75-R79 PolarHBondContact O-NE 3.48Å
76	R	82.6	Confident	78	Confident	190 Å²	190	116.3 Å²	116.3	72%	0.717	59%	0.592	S	S	*	*	H	α-helix	trans	-72	-41.4	173.4	-157.4	167.1	-171.2	173.9	1.4	111.2	E72 V73 R78 R79 V80	E72-R76 WeakPolarHBondContact O-CB 3.39Å; E72-R76 PolarHBondContact O-N 3.34Å; V73-R76 PolarHBondContact O-N 2.76Å; R76-R78 VanDerWaalsContact C-N 3.34Å; R76-R78 PolarHBondContact O-N 2.87Å; R76-R79 PolarHBondContact O-N 3.18Å; R76-V80 WeakPolarHBondContact O-CG2 3.02Å; R76-V80 PolarHBondContact O-N 2.89Å; R76-V80 VanDerWaalsContact O-N 3.11Å
77	L	86.3	Confident	79.6	Confident	127 Å²	127	117.8 Å²	117.8	67%	0.665	59%	0.591	S	S	*	*	H	α-helix	trans	-62.4	-41.2	174.8	-148.2	93.3	0	0	0	111.6	V73 S74 V80 R81	V73-L77 WeakPolarHBondContact O-CB 3.17Å; V73-L77 PolarHBondContact O-N 3.28Å; S74-L77 PolarHBondContact O-N 3.49Å; L77-V80 PolarHBondContact O-N 3.38Å; L77-R81 WeakPolarHBondContact O-CB 3.3Å; L77-R81 PolarHBondContact O-N 2.85Å
78	R	85.8	Confident	81.4	Confident	134 Å²	134	117 Å²	117	51%	0.506	58%	0.584	S	S	.	*	H	α-helix	trans	-61	-45.6	176.9	-173.5	172.7	73.1	95.9	-10.8	111.7	S74 R76 R81 E82	S74-R78 WeakPolarHBondContact O-CB 3.43Å; S74-R78 PolarHBondContact O-N 3.47Å; R76-R78 VanDerWaalsContact C-N 3.34Å; R76-R78 PolarHBondContact O-N 2.87Å; R78-R81 WeakPolarHBondContact O-CB 3.18Å; R78-R81 PolarHBondContact O-N 2.76Å; R78-E82 WeakPolarHBondContact CG-OE1 3.49Å; R78-E82 IonicContact CZ-OE1 3.66Å; R78-E82 IonicContact NH1-OE1 2.7Å; R78-E82 PolarHBondContact NH1-OE1 3.16Å; R78-E82 IonicContact NH1-OE2 3.94Å; R78-E82 WeakPolarHBondContact O-CG 3.29Å; R78-E82 PolarHBondContact O-N 3.35Å
79	R	88	Confident	83	Confident	155 Å²	155	120.2 Å²	120.2	59%	0.585	58%	0.576	S	S	*	*	H	α-helix	trans	-61	-45	176	-85	-177.2	-87.1	-177.4	-8.1	112.5	N75 R76 R81 E82 T83	N75-R79 PolarHBondContact O-N 3.44Å; N75-R79 PolarHBondContact O-NE 3.48Å; R76-R79 PolarHBondContact O-N 3.18Å; R79-R81 VanDerWaalsContact C-N 3.33Å; R79-R81 PolarHBondContact O-N 2.83Å; R79-E82 PolarHBondContact O-N 3.5Å; R79-T83 PolarHBondContact O-N 3.44Å; R79-T83 PolarHBondContact O-OG1 3.45Å; R79-T83 VanDerWaalsContact O-OG1 3.09Å
80	V	92.6	Very high	84.1	Confident	98 Å²	98	119.6 Å²	119.6	59%	0.594	57%	0.573	S	S	*	*	H	α-helix	trans	-62.4	-42.7	177.5	174.6	0	0	0	0	111.1	R76 L77 T83 F84	R76-V80 WeakPolarHBondContact O-CG2 3.02Å; R76-V80 PolarHBondContact O-N 2.89Å; R76-V80 VanDerWaalsContact O-N 3.11Å; L77-V80 PolarHBondContact O-N 3.38Å; V80-T83 PolarHBondContact O-N 3.19Å; V80-F84 WeakPolarHBondContact O-CB 3.38Å; V80-F84 PolarHBondContact O-N 3.45Å
81	R	88.6	Confident	85	Confident	183 Å²	183	114.2 Å²	114.2	69%	0.691	56%	0.556	S	S	*	*	H	α-helix	trans	-60.4	-45.5	175	179.5	-172.6	172.4	-152.8	-1.8	111.7	L77 R78 R79 F84 V85	L77-R81 WeakPolarHBondContact O-CB 3.3Å; L77-R81 PolarHBondContact O-N 2.85Å; R78-R81 WeakPolarHBondContact O-CB 3.18Å; R78-R81 PolarHBondContact O-N 2.76Å; R79-R81 VanDerWaalsContact C-N 3.33Å; R79-R81 PolarHBondContact O-N 2.83Å; R81-F84 PolarHBondContact O-N 3.19Å; R81-V85 HydrophobicContact CG-CG2 4.45Å; R81-V85 VanDerWaalsContact O-CG2 3.31Å; R81-V85 WeakPolarHBondContact O-CG2 3.29Å; R81-V85 PolarHBondContact O-N 3.37Å
82	E	91.3	Very high	85.8	Confident	96 Å²	96	117.5 Å²	117.5	45%	0.449	56%	0.563	S	S	.	*	H	α-helix	trans	-62.3	-44.4	179.8	-76.7	171.3	-170.8	0	0	111.7	R78 R79 F84 V85 K86	R78-E82 WeakPolarHBondContact CG-OE1 3.49Å; R78-E82 IonicContact CZ-OE1 3.66Å; R78-E82 IonicContact NH1-OE1 2.7Å; R78-E82 PolarHBondContact NH1-OE1 3.16Å; R78-E82 IonicContact NH1-OE2 3.94Å; R78-E82 WeakPolarHBondContact O-CG 3.29Å; R78-E82 PolarHBondContact O-N 3.35Å; R79-E82 PolarHBondContact O-N 3.5Å; E82-F84 VanDerWaalsContact C-N 3.35Å; E82-F84 PolarHBondContact O-N 3.32Å; E82-V85 PolarHBondContact O-N 2.99Å; E82-K86 WeakPolarHBondContact O-CB 3.36Å; E82-K86 PolarHBondContact O-N 2.93Å
83	T	90.8	Very high	86.2	Confident	83 Å²	83	116.7 Å²	116.7	51%	0.509	56%	0.558	S	S	.	*	H	α-helix	trans	-60	-46.3	174.3	-55	0	0	0	0	111	R79 V80 V85 K86 E87	R79-T83 PolarHBondContact O-N 3.44Å; R79-T83 PolarHBondContact O-OG1 3.45Å; R79-T83 VanDerWaalsContact O-OG1 3.09Å; V80-T83 PolarHBondContact O-N 3.19Å; T83-V85 PolarHBondContact O-N 3.49Å; T83-K86 WeakPolarHBondContact O-CB 3.46Å; T83-K86 PolarHBondContact O-N 2.9Å; T83-E87 WeakPolarHBondContact O-CB 3.48Å; T83-E87 PolarHBondContact O-N 3.48Å
84	F	88.6	Confident	86.2	Confident	146 Å²	146	116 Å²	116	64%	0.64	55%	0.55	S	S	*	*	H	α-helix	trans	-62.8	-43	-179.9	-157.5	-91.9	0	0	0	112.4	V80 R81 E82 K86 E87 V88	V80-F84 WeakPolarHBondContact O-CB 3.38Å; V80-F84 PolarHBondContact O-N 3.45Å; R81-F84 PolarHBondContact O-N 3.19Å; E82-F84 VanDerWaalsContact C-N 3.35Å; E82-F84 PolarHBondContact O-N 3.32Å; F84-K86 VanDerWaalsContact C-N 3.31Å; F84-K86 PolarHBondContact O-N 3.05Å; F84-E87 PolarHBondContact O-N 3.23Å; F84-V88 HydrophobicContact CD1-CG2 3.89Å; F84-V88 HydrophobicContact CE1-CG2 3.78Å; F84-V88 WeakPolarHBondContact O-CB 3.21Å; F84-V88 WeakPolarHBondContact O-CG2 3.43Å; F84-V88 PolarHBondContact O-N 3.35Å
85	V	94.9	Very high	86	Confident	83 Å²	83	114.3 Å²	114.3	50%	0.503	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-40.3	175.8	169.5	0	0	0	0	111	R81 E82 T83 K89	R81-V85 HydrophobicContact CG-CG2 4.45Å; R81-V85 VanDerWaalsContact O-CG2 3.31Å; R81-V85 WeakPolarHBondContact O-CG2 3.29Å; R81-V85 PolarHBondContact O-N 3.37Å; E82-V85 PolarHBondContact O-N 2.99Å; T83-V85 PolarHBondContact O-N 3.49Å; V85-K89 VanDerWaalsContact O-CB 3.23Å; V85-K89 WeakPolarHBondContact O-CB 3.17Å; V85-K89 PolarHBondContact O-N 2.88Å
86	K	89.7	Confident	85.3	Confident	137 Å²	137	114.4 Å²	114.4	60%	0.596	55%	0.548	S	S	*	.	H	α-helix	trans	-65.4	-49.2	177.9	-168.2	-176.5	177.1	-165.7	0	111.2	E82 T83 F84 V88 K89 D90	E82-K86 WeakPolarHBondContact O-CB 3.36Å; E82-K86 PolarHBondContact O-N 2.93Å; T83-K86 WeakPolarHBondContact O-CB 3.46Å; T83-K86 PolarHBondContact O-N 2.9Å; F84-K86 VanDerWaalsContact C-N 3.31Å; F84-K86 PolarHBondContact O-N 3.05Å; K86-V88 VanDerWaalsContact C-N 3.34Å; K86-V88 PolarHBondContact O-N 3.28Å; K86-K89 PolarHBondContact O-N 3.4Å; K86-D90 WeakPolarHBondContact O-CB 3.44Å; K86-D90 PolarHBondContact O-N 3.4Å
87	E	89.1	Confident	84.4	Confident	140 Å²	140	112.5 Å²	112.5	65%	0.654	54%	0.541	S	S	*	.	H	α-helix	trans	-57.6	-45.5	177.4	-154.1	95.6	-164	0	0	111.6	T83 F84 D90 G91	T83-E87 WeakPolarHBondContact O-CB 3.48Å; T83-E87 PolarHBondContact O-N 3.48Å; F84-E87 PolarHBondContact O-N 3.23Å; E87-D90 PolarHBondContact O-N 3.5Å; E87-G91 PolarHBondContact O-N 3.17Å
88	V	91.2	Very high	83.1	Confident	80 Å²	80	116.6 Å²	116.6	49%	0.485	55%	0.548	S	S	.	.	H	α-helix	trans	-66.2	-41.5	179.1	170.1	0	0	0	0	111.2	F84 K86 W92	F84-V88 HydrophobicContact CD1-CG2 3.89Å; F84-V88 HydrophobicContact CE1-CG2 3.78Å; F84-V88 WeakPolarHBondContact O-CB 3.21Å; F84-V88 WeakPolarHBondContact O-CG2 3.43Å; F84-V88 PolarHBondContact O-N 3.35Å; K86-V88 VanDerWaalsContact C-N 3.34Å; K86-V88 PolarHBondContact O-N 3.28Å; V88-W92 VanDerWaalsContact O-CB 3.31Å; V88-W92 WeakPolarHBondContact O-CB 3.15Å; V88-W92 PolarHBondContact O-N 2.92Å
89	K	87.8	Confident	81.8	Confident	148 Å²	148	117.1 Å²	117.1	64%	0.643	56%	0.559	S	S	*	*	H	α-helix	trans	-67.1	-43.2	178.6	-176.2	179	178.6	-178.2	0	111.7	V85 K86 W92 K93	V85-K89 VanDerWaalsContact O-CB 3.23Å; V85-K89 WeakPolarHBondContact O-CB 3.17Å; V85-K89 PolarHBondContact O-N 2.88Å; K86-K89 PolarHBondContact O-N 3.4Å; K89-W92 PolarHBondContact O-N 3.49Å; K89-K93 WeakPolarHBondContact O-CB 3.28Å; K89-K93 PolarHBondContact O-N 3.1Å
90	D	86.3	Confident	80.1	Confident	70 Å²	70	118.7 Å²	118.7	37%	0.374	57%	0.57	S	S	.	*	H	α-helix	trans	-69.7	-43.7	179.7	-70.8	-19.8	0	0	0	110.4	K86 E87 W92 K93 D94	K86-D90 WeakPolarHBondContact O-CB 3.44Å; K86-D90 PolarHBondContact O-N 3.4Å; E87-D90 PolarHBondContact O-N 3.5Å; D90-W92 VanDerWaalsContact C-N 3.31Å; D90-W92 PolarHBondContact O-N 3.18Å; D90-K93 PolarHBondContact O-N 2.76Å; D90-K93 VanDerWaalsContact O-N 3.16Å; D90-D94 PolarHBondContact O-N 2.92Å
91	G	83	Confident	77.7	Confident	48 Å²	48	126.2 Å²	126.2	50%	0.495	60%	0.595	S	S	.	*	H	α-helix	trans	-58.9	-39.1	172.6	0	0	0	0	0	113.2	E87 G95	E87-G91 PolarHBondContact O-N 3.17Å; G91-G95 PolarHBondContact O-N 3.38Å
92	W	82.1	Confident	77.2	Confident	204 Å²	204	123.4 Å²	123.4	77%	0.773	59%	0.59	S	S	*	*	H	α-helix	trans	-68.1	-41.6	175	-167.8	-72	0	0	0	112.4	V88 K89 D90 S96	V88-W92 VanDerWaalsContact O-CB 3.31Å; V88-W92 WeakPolarHBondContact O-CB 3.15Å; V88-W92 PolarHBondContact O-N 2.92Å; K89-W92 PolarHBondContact O-N 3.49Å; D90-W92 VanDerWaalsContact C-N 3.31Å; D90-W92 PolarHBondContact O-N 3.18Å; W92-S96 VanDerWaalsContact O-CB 3.25Å; W92-S96 WeakPolarHBondContact O-CB 3.48Å; W92-S96 PolarHBondContact O-N 3.3Å
93	K	79.6	Confident	76.4	Confident	106 Å²	106	124.8 Å²	124.8	46%	0.461	60%	0.597	S	S	.	*	H	α-helix	trans	-68.3	-38.7	-179.5	-170.7	178	-179.1	-176.3	0	112	K89 D90 R97	K89-K93 WeakPolarHBondContact O-CB 3.28Å; K89-K93 PolarHBondContact O-N 3.1Å; D90-K93 PolarHBondContact O-N 2.76Å; D90-K93 VanDerWaalsContact O-N 3.16Å; K93-R97 WeakPolarHBondContact O-CG 3.35Å; K93-R97 PolarHBondContact O-N 3.02Å; K93-R97 VanDerWaalsContact O-N 3.17Å
94	D	76.1	Confident	75.6	Confident	85 Å²	85	127.1 Å²	127.1	46%	0.455	60%	0.602	S	S	.	*	H	α-helix	trans	-76.2	-36.1	176.9	-75.4	-15.6	0	0	0	112.3	D90 S96 R97 R98	D90-D94 PolarHBondContact O-N 2.92Å; D94-S96 VanDerWaalsContact C-N 3.35Å; D94-R97 PolarHBondContact O-N 3.28Å; D94-R97 IonicContact OD1-NH1 3.41Å; D94-R97 PolarHBondContact OD1-NH1 3.42Å; D94-R98 PolarHBondContact O-N 2.57Å; D94-R98 VanDerWaalsContact O-N 3.1Å
95	G	71	Confident	74.9	Confident	30 Å²	30	126 Å²	126	31%	0.309	60%	0.6	S	S	.	*	H	α-helix	trans	-59.4	-45.2	168.5	0	0	0	0	0	112	G91 R97 R98 I99	G91-G95 PolarHBondContact O-N 3.38Å; G95-R97 VanDerWaalsContact C-N 3.3Å; G95-R97 PolarHBondContact O-N 3.37Å; G95-R98 PolarHBondContact O-N 2.79Å; G95-I99 WeakPolarHBondContact O-CD1 3.14Å; G95-I99 VanDerWaalsContact O-CG1 3.26Å; G95-I99 WeakPolarHBondContact O-CG1 3.41Å; G95-I99 PolarHBondContact O-N 3.07Å; G95-I99 VanDerWaalsContact O-N 3.15Å
96	S	65.7	Low	73.6	Confident	59 Å²	59	128.7 Å²	128.7	41%	0.413	61%	0.606	S	S	.	*	H	α-helix	trans	-60.9	-33.7	176.4	161.9	0	0	0	0	113.7	W92 D94	W92-S96 VanDerWaalsContact O-CB 3.25Å; W92-S96 WeakPolarHBondContact O-CB 3.48Å; W92-S96 PolarHBondContact O-N 3.3Å; D94-S96 VanDerWaalsContact C-N 3.35Å
97	R	64.3	Low	72.6	Confident	150 Å²	150	128.1 Å²	128.1	57%	0.566	61%	0.607	S	S	*	*	H	α-helix	trans	-77.3	-32.4	177.8	-75.9	170.7	175.2	164.6	-12	112.7	K93 D94 G95	K93-R97 WeakPolarHBondContact O-CG 3.35Å; K93-R97 PolarHBondContact O-N 3.02Å; K93-R97 VanDerWaalsContact O-N 3.17Å; D94-R97 PolarHBondContact O-N 3.28Å; D94-R97 IonicContact OD1-NH1 3.41Å; D94-R97 PolarHBondContact OD1-NH1 3.42Å; G95-R97 VanDerWaalsContact C-N 3.3Å; G95-R97 PolarHBondContact O-N 3.37Å
98	R	58.4	Low	71.4	Confident	214 Å²	214	127.3 Å²	127.3	81%	0.808	60%	0.604	S	S	*	*	H	α-helix	trans	-73.1	-26.8	175.5	-73.4	-172.8	-179.8	-131.1	3.1	113.3	D94 G95 K100	D94-R98 PolarHBondContact O-N 2.57Å; D94-R98 VanDerWaalsContact O-N 3.1Å; G95-R98 PolarHBondContact O-N 2.79Å; R98-K100 VanDerWaalsContact C-N 3.29Å
99	I	58.4	Low	69.9	Low	144 Å²	144	130.9 Å²	130.9	74%	0.738	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.6	-12.2	177.7	-62.7	163.2	0	0	0	112.3	G95	G95-I99 WeakPolarHBondContact O-CD1 3.14Å; G95-I99 VanDerWaalsContact O-CG1 3.26Å; G95-I99 WeakPolarHBondContact O-CG1 3.41Å; G95-I99 PolarHBondContact O-N 3.07Å; G95-I99 VanDerWaalsContact O-N 3.15Å
100	K	52.5	Low	68.4	Low	189 Å²	189	129.5 Å²	129.5	82%	0.822	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98	8.6	179.7	-90.6	-170.4	173.8	-173.5	0	115	R98	R98-K100 VanDerWaalsContact C-N 3.29Å
101	K	43	Very low	66.7	Low	255 Å²	255	134.9 Å²	134.9	100%	1.109	63%	0.632	S	S	*	*			trans	-111.2	0	165.8	-94.2	-169.6	174.5	-172.3	0	108.8

Retrieved 101 of 101 residues in 224.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).