A0A3B3VFB5_9TELE Loading...

Profilin

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

AlphaFold DB , UniProt , Accession A0A3B3VFB5, Species 9TELE (Poecilia latipinna, sailfin molly), Gene PFN2, Length 129 aa.

						>A0A3B3VFB5_9TELE|A0A3B3VFB5|PFN2
MADGSCQDSAIVGYTDAKYVWAAHAGGTFNNITSQEIDVLVGKDRESFYTNGLTLGSKKCSVLRDSLQDDGDWTMDIRTKSQGGEPTYNISVGRAGKVLVLVMGKEAVHGGNLNKKAHAMAEYLRKSGY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.5	Low	88.4	Confident	90 Å²	90	48.5 Å²	48.5	44%	0.443	31%	0.308	S	S	.	.				0	-6.4	0	-61	-58.8	-82.7	0	0	113.6	D3 C6 V102	M1-D3 VanDerWaalsContact C-N 3.31Å; M1-D3 PolarHBondContact O-N 3.04Å; M1-C6 HydrophobicContact CE-CB 3.36Å; M1-C6 WeakPolarHBondContact CE-SG 3.41Å; M1-C6 HydrophobicContact SD-CB 4.34Å; M1-V102 HydrophobicContact CE-CB 3.61Å; M1-V102 HydrophobicContact CE-CG1 3.28Å; M1-V102 HydrophobicContact SD-CB 4.3Å; M1-V102 HydrophobicContact SD-CG1 3.63Å
2	A	75.7	Confident	89.3	Confident	109 Å²	109	44.5 Å²	44.5	90%	0.901	28%	0.283	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.8	-5.3	-178.1	0	0	0	0	0	114.7	G4	A2-G4 PolarHBondContact O-N 2.79Å
3	D	81.3	Confident	89.9	Confident	101 Å²	101	41.1 Å²	41.1	54%	0.54	26%	0.261	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.7	8.4	-176.6	67.8	-50.1	0	0	0	113.6	M1 S5 K116	M1-D3 VanDerWaalsContact C-N 3.31Å; M1-D3 PolarHBondContact O-N 3.04Å; D3-S5 PolarHBondContact O-N 3.03Å; D3-S5 PolarHBondContact OD1-OG 3.21Å; D3-K116 IonicContact OD1-NZ 3.88Å; D3-K116 PolarHBondContact OD1-NZ 3.47Å; D3-K116 IonicContact OD2-NZ 2.7Å; D3-K116 PolarHBondContact OD2-NZ 3.21Å
4	G	87.1	Confident	90.4	Very high	36 Å²	36	39.9 Å²	39.9	37%	0.371	25%	0.249	S	C	.	.	S	Bend	trans	75.8	1.9	171.4	0	0	0	0	0	115.4	A2 C6 K105	A2-G4 PolarHBondContact O-N 2.79Å; G4-C6 VanDerWaalsContact C-N 3.33Å; G4-K105 VanDerWaalsContact O-CD 3.26Å; G4-K105 WeakPolarHBondContact O-CD 3.46Å; G4-K105 WeakPolarHBondContact O-CE 3.45Å; G4-K105 PolarHBondContact O-NZ 2.92Å
5	S	89.4	Confident	90.6	Very high	22 Å²	22	40.6 Å²	40.6	15%	0.154	25%	0.253	C	S	.	.			trans	-75	-20.2	179.5	67.5	0	0	0	0	113.9	D3 G104 K105 V108 K116	D3-S5 PolarHBondContact O-N 3.03Å; D3-S5 PolarHBondContact OD1-OG 3.21Å; S5-G104 WeakPolarHBondContact O-CA 3.43Å; S5-K105 PolarHBondContact O-N 3.16Å; S5-V108 WeakPolarHBondContact O-CG2 3.42Å; S5-K116 VanDerWaalsContact OG-CE 3.29Å; S5-K116 WeakPolarHBondContact OG-CE 3.43Å
6	C	93.7	Very high	90.4	Very high	17 Å²	17	48.4 Å²	48.4	12%	0.115	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	144.1	-174.2	-54.6	0	0	0	0	110.4	M1 G4 M103 L113	M1-C6 HydrophobicContact CE-CB 3.36Å; M1-C6 WeakPolarHBondContact CE-SG 3.41Å; M1-C6 HydrophobicContact SD-CB 4.34Å; G4-C6 VanDerWaalsContact C-N 3.33Å; C6-M103 CarbonylContact C-O 3.48Å; C6-M103 WeakPolarHBondContact CA-O 3.49Å; C6-M103 WeakPolarHBondContact CB-O 3.3Å; C6-L113 VanDerWaalsContact SG-CD2 3.56Å
7	Q	94.9	Very high	90.6	Very high	67 Å²	67	47.2 Å²	47.2	31%	0.313	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	-23.4	174.3	67.3	-178.6	-61.1	0	0	112.5	M103 G104 K105	Q7-M103 HydrophobicContact CG-CB 4.26Å; Q7-M103 HydrophobicContact CG-CG 3.99Å; Q7-M103 HydrophobicContact CG-SD 3.99Å; Q7-M103 PolarHBondContact N-O 3.34Å; Q7-G104 PolarHBondContact NE2-O 3.46Å; Q7-K105 HydrophobicContact CB-CG 3.9Å
8	D	96.4	Very high	90.9	Very high	5 Å²	5	48.8 Å²	48.8	3%	0.027	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	152.1	177.4	-161	-3.3	0	0	0	110.2	H24 G27 T28 F29 M103	D8-H24 WeakPolarHBondContact OD1-CB 3.36Å; D8-G27 VanDerWaalsContact OD2-C 3.23Å; D8-G27 VanDerWaalsContact OD2-CA 3.3Å; D8-G27 WeakPolarHBondContact OD2-CA 3.44Å; D8-T28 WeakPolarHBondContact OD2-CA 3.31Å; D8-T28 PolarHBondContact OD2-N 2.7Å; D8-F29 HydrophobicContact CB-CD2 3.97Å; D8-F29 HydrophobicContact CB-CE2 4.07Å; D8-F29 VanDerWaalsContact CG-CD2 3.44Å; D8-F29 WeakPolarHBondContact OD2-CG 3.41Å; D8-F29 PolarHBondContact OD2-N 2.65Å; D8-M103 HydrophobicContact CB-CB 3.9Å; D8-M103 PolarHBondContact N-O 3.03Å; D8-M103 PolarHBondContact O-N 3.38Å
9	S	96.8	Very high	91.2	Very high	37 Å²	37	53.5 Å²	53.5	26%	0.259	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.5	144.3	177.6	65.6	0	0	0	0	111.8	A23 H24 L101	S9-A23 CarbonylContact O-C 3.49Å; S9-A23 VanDerWaalsContact O-CA 3.29Å; S9-A23 WeakPolarHBondContact O-CA 3.49Å; S9-H24 PolarHBondContact O-N 3.12Å; S9-L101 CarbonylContact C-O 3.58Å; S9-L101 WeakPolarHBondContact CA-O 3.32Å
10	A	98	Very high	91.5	Very high	4 Å²	4	52.5 Å²	52.5	3%	0.033	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	153.1	176.4	0	0	0	0	0	113.3	V12 A22 A23 F29 L101	A10-V12 HydrophobicContact CB-CG2 4.01Å; A10-A22 CarbonylContact C-O 3.56Å; A10-A22 WeakPolarHBondContact CA-O 3.29Å; A10-A22 WeakPolarHBondContact CB-O 3.29Å; A10-A23 HydrophobicContact CB-CB 3.72Å; A10-F29 HydrophobicContact CB-CB 3.54Å; A10-F29 HydrophobicContact CB-CD2 4.1Å; A10-F29 HydrophobicContact CB-CG 4.18Å; A10-L101 PolarHBondContact N-O 3.36Å; A10-L101 PolarHBondContact O-N 2.81Å
11	I	98.1	Very high	91.8	Very high	45 Å²	45	54.5 Å²	54.5	23%	0.231	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	121.3	163.8	-57.1	-59.7	0	0	0	106.9	W21 A22 V98 L99 V100 L124	I11-W21 HydrophobicContact CG2-CB 4.35Å; I11-W21 HydrophobicContact CG2-CE3 4.26Å; I11-W21 PolarHBondContact O-N 3.02Å; I11-A22 PolarHBondContact N-O 3.04Å; I11-A22 PolarHBondContact O-N 3.05Å; I11-V98 HydrophobicContact CG2-CB 3.92Å; I11-V98 HydrophobicContact CG2-CG1 4.01Å; I11-V98 HydrophobicContact CG2-CG2 4.17Å; I11-L99 WeakPolarHBondContact CA-O 3.45Å; I11-V100 HydrophobicContact CD1-CB 4.43Å; I11-V100 HydrophobicContact CD1-CG1 4.28Å; I11-V100 HydrophobicContact CD1-CG2 3.96Å; I11-L124 HydrophobicContact CD1-CD1 4.13Å
12	V	98.3	Very high	93.5	Very high	1 Å²	1	53 Å²	53	1%	0.006	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	117.2	-173.3	-179	0	0	0	0	108.7	A10 V20 I32 I37 V98 L99 L101	A10-V12 HydrophobicContact CB-CG2 4.01Å; V12-V20 HydrophobicContact CG2-CG2 4.16Å; V12-I32 HydrophobicContact CG2-CD1 4.33Å; V12-I37 HydrophobicContact CG1-CD1 3.25Å; V12-I37 HydrophobicContact CG1-CG1 3.57Å; V12-V98 CarbonylContact O-C 3.54Å; V12-V98 VanDerWaalsContact O-CA 3.28Å; V12-V98 WeakPolarHBondContact O-CA 3.4Å; V12-L99 HydrophobicContact CB-CB 4.43Å; V12-L99 PolarHBondContact N-O 2.97Å; V12-L99 PolarHBondContact O-N 3.35Å; V12-L101 HydrophobicContact CB-CD1 4.02Å; V12-L101 HydrophobicContact CG2-CD1 3.6Å
13	G	97.9	Very high	94.5	Very high	0 Å²	0	49.2 Å²	49.2	0%	0	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.4	139.7	172.4	0	0	0	0	0	110.4	A17 K18 Y19 K97	G13-A17 CarbonylContact C-O 3.06Å; G13-A17 VanDerWaalsContact CA-O 3.32Å; G13-A17 WeakPolarHBondContact CA-O 3.42Å; G13-K18 WeakPolarHBondContact O-CA 3.34Å; G13-Y19 PolarHBondContact N-O 3.1Å; G13-Y19 PolarHBondContact O-N 2.99Å; G13-K97 WeakPolarHBondContact CA-O 3.3Å
14	Y	96.2	Very high	95.2	Very high	24 Å²	24	49.3 Å²	49.3	9%	0.094	27%	0.27	C	S	.	.			trans	-123.7	-3.3	179.9	75	-90.6	0	0	0	114.2	V41 R94 A95 G96 K97 V98 L99	Y14-V41 HydrophobicContact CD2-CB 4.26Å; Y14-V41 HydrophobicContact CD2-CG1 3.74Å; Y14-V41 HydrophobicContact CD2-CG2 4.33Å; Y14-V41 HydrophobicContact CE2-CG1 4.43Å; Y14-V41 HydrophobicContact CG-CG1 3.89Å; Y14-R94 HydrophobicContact CE1-CG 4.14Å; Y14-R94 PolarHBondContact OH-NE 3.2Å; Y14-A95 WeakPolarHBondContact CE1-O 3.36Å; Y14-A95 PolarHBondContact OH-O 3.06Å; Y14-G96 PolarHBondContact OH-O 3.33Å; Y14-G96 VanDerWaalsContact OH-O 3.05Å; Y14-K97 WeakPolarHBondContact CD1-O 3.33Å; Y14-K97 PolarHBondContact N-O 3.35Å; Y14-V98 WeakPolarHBondContact CE1-O 3.36Å; Y14-L99 HydrophobicContact CD1-CD2 3.78Å; Y14-L99 HydrophobicContact CD1-CG 3.76Å; Y14-L99 HydrophobicContact CE1-CD2 4.08Å; Y14-L99 HydrophobicContact CG-CD2 4.32Å; Y14-L99 HydrophobicContact CG-CG 4.2Å
15	T	93.4	Very high	95.5	Very high	51 Å²	51	51.7 Å²	51.7	31%	0.313	29%	0.286	S	S	.	.	S	Bend	trans	-99.1	-119	176.2	59.2	0	0	0	0	110.9	K97	T15-K97 HydrophobicContact CG2-CB 4.49Å
16	D	88.1	Confident	95.5	Very high	166 Å²	166	54.7 Å²	54.7	89%	0.888	32%	0.32	S	S	*	.	S	Bend	trans	-70.2	-39.6	-174.7	-54.8	-38	0	0	0	111.8	K18	D16-K18 PolarHBondContact O-N 3.34Å
17	A	93.2	Very high	95.5	Very high	28 Å²	28	54.3 Å²	54.3	23%	0.231	32%	0.32	C	S	.	.	S	Bend	trans	-95.3	63.7	177.1	0	0	0	0	0	110.7	G13 Y19 W21	G13-A17 CarbonylContact C-O 3.06Å; G13-A17 VanDerWaalsContact CA-O 3.32Å; G13-A17 WeakPolarHBondContact CA-O 3.42Å; A17-Y19 HydrophobicContact CB-CD1 4.36Å; A17-Y19 HydrophobicContact CB-CE1 3.6Å; A17-Y19 PolarHBondContact O-N 3.46Å; A17-W21 HydrophobicContact CB-CZ2 3.83Å; A17-W21 PolarHBondContact O-NE1 3.28Å
18	K	96.3	Very high	95.5	Very high	76 Å²	76	53.3 Å²	53.3	33%	0.33	32%	0.318	S	S	.	.			trans	-77.5	78.4	-174	-166.9	-178.8	-58.4	178.8	0	113.5	G13 D16 I37 D38	G13-K18 WeakPolarHBondContact O-CA 3.34Å; D16-K18 PolarHBondContact O-N 3.34Å; K18-I37 HydrophobicContact CD-CB 4.47Å; K18-I37 HydrophobicContact CD-CG2 4.23Å; K18-I37 HydrophobicContact CG-CB 4.22Å; K18-I37 HydrophobicContact CG-CD1 4.03Å; K18-I37 HydrophobicContact CG-CG2 3.87Å; K18-D38 WeakPolarHBondContact CE-OD1 3.36Å; K18-D38 IonicContact NZ-OD1 3.08Å; K18-D38 PolarHBondContact NZ-OD1 3.22Å; K18-D38 IonicContact NZ-OD2 2.64Å
19	Y	96.6	Very high	95.6	Very high	137 Å²	137	53 Å²	53	54%	0.537	32%	0.317	S	S	.	.	S	Bend	trans	-163.1	172.7	177.1	56.4	-90.6	0	0	0	110.5	G13 A17 W21	G13-Y19 PolarHBondContact N-O 3.1Å; G13-Y19 PolarHBondContact O-N 2.99Å; A17-Y19 HydrophobicContact CB-CD1 4.36Å; A17-Y19 HydrophobicContact CB-CE1 3.6Å; A17-Y19 PolarHBondContact O-N 3.46Å; Y19-W21 AromaticContact CD2-CD1 3.71Å; Y19-W21 AromaticContact CE2-CD1 3.45Å; Y19-W21 VanDerWaalsContact CE2-CD1 3.45Å; Y19-W21 HydrophobicContact CE2-CG 4.35Å; Y19-W21 AromaticContact CE2-NE1 4Å; Y19-W21 AromaticContact CZ-CD1 3.88Å; Y19-W21 AromaticContact CZ-NE1 3.95Å; Y19-W21 VanDerWaalsContact O-CD1 3.23Å; Y19-W21 PolarHBondContact O-N 3.45Å
20	V	97.9	Very high	95.5	Very high	34 Å²	34	54.3 Å²	54.3	21%	0.206	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.3	109.9	173.9	-177.8	0	0	0	0	109.5	V12 A23 F29 I32	V12-V20 HydrophobicContact CG2-CG2 4.16Å; V20-A23 HydrophobicContact CG1-CB 3.66Å; V20-F29 WeakPolarHBondContact CG2-O 3.4Å; V20-I32 HydrophobicContact CG2-CB 3.95Å
21	W	97.4	Very high	95.5	Very high	94 Å²	94	59.1 Å²	59.1	36%	0.356	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	-37.9	178.8	-68.7	10.4	0	0	0	111.5	I11 A17 Y19 V98 Y129	I11-W21 HydrophobicContact CG2-CB 4.35Å; I11-W21 HydrophobicContact CG2-CE3 4.26Å; I11-W21 PolarHBondContact O-N 3.02Å; A17-W21 HydrophobicContact CB-CZ2 3.83Å; A17-W21 PolarHBondContact O-NE1 3.28Å; Y19-W21 AromaticContact CD2-CD1 3.71Å; Y19-W21 AromaticContact CE2-CD1 3.45Å; Y19-W21 VanDerWaalsContact CE2-CD1 3.45Å; Y19-W21 HydrophobicContact CE2-CG 4.35Å; Y19-W21 AromaticContact CE2-NE1 4Å; Y19-W21 AromaticContact CZ-CD1 3.88Å; Y19-W21 AromaticContact CZ-NE1 3.95Å; Y19-W21 VanDerWaalsContact O-CD1 3.23Å; Y19-W21 PolarHBondContact O-N 3.45Å; W21-V98 HydrophobicContact CD2-CG1 4.06Å; W21-V98 HydrophobicContact CE3-CG1 3.68Å; W21-V98 HydrophobicContact CH2-CG1 3.45Å; W21-V98 VanDerWaalsContact CH2-CG1 3.45Å; W21-V98 HydrophobicContact CZ2-CG1 3.83Å; W21-V98 HydrophobicContact CZ3-CG1 3.37Å; W21-Y129 HydrophobicContact CH2-CD1 4.19Å; W21-Y129 HydrophobicContact CH2-CE1 4.49Å; W21-Y129 AromaticContact CZ3-CD1 3.8Å; W21-Y129 HydrophobicContact CZ3-CD1 3.8Å; W21-Y129 AromaticContact CZ3-CE1 3.99Å; W21-Y129 HydrophobicContact CZ3-CE1 3.99Å
22	A	97.4	Very high	95.4	Very high	58 Å²	58	57.5 Å²	57.5	48%	0.479	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.1	142.8	174.7	0	0	0	0	0	109.6	A10 I11	A10-A22 CarbonylContact C-O 3.56Å; A10-A22 WeakPolarHBondContact CA-O 3.29Å; A10-A22 WeakPolarHBondContact CB-O 3.29Å; I11-A22 PolarHBondContact N-O 3.04Å; I11-A22 PolarHBondContact O-N 3.05Å
23	A	97	Very high	95.4	Very high	30 Å²	30	60.1 Å²	60.1	25%	0.248	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.2	161.5	173.4	0	0	0	0	0	110.8	S9 A10 V20 A25 N30	S9-A23 CarbonylContact O-C 3.49Å; S9-A23 VanDerWaalsContact O-CA 3.29Å; S9-A23 WeakPolarHBondContact O-CA 3.49Å; A10-A23 HydrophobicContact CB-CB 3.72Å; V20-A23 HydrophobicContact CG1-CB 3.66Å; A23-A25 PolarHBondContact O-N 2.84Å; A23-N30 WeakPolarHBondContact CB-OD1 3.31Å
24	H	94.8	Very high	95.3	Very high	104 Å²	104	62.6 Å²	62.6	48%	0.481	37%	0.371	S	S	.	.			trans	-65.4	125.5	175.6	-174.8	73.7	0	0	0	110	D8 S9 G26 G27 N30	D8-H24 WeakPolarHBondContact OD1-CB 3.36Å; S9-H24 PolarHBondContact O-N 3.12Å; H24-G26 PolarHBondContact O-N 3.24Å; H24-G27 PolarHBondContact O-N 2.89Å; H24-N30 PolarHBondContact O-ND2 2.95Å
25	A	92.8	Very high	95.2	Very high	85 Å²	85	67.2 Å²	67.2	70%	0.702	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	130.9	-175.7	0	0	0	0	0	112.1	A23 G27	A23-A25 PolarHBondContact O-N 2.84Å; A25-G27 PolarHBondContact O-N 3.29Å
26	G	91.3	Very high	95.4	Very high	85 Å²	85	65.4 Å²	65.4	88%	0.876	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.2	-2.6	-177.4	0	0	0	0	0	115.1	H24	H24-G26 PolarHBondContact O-N 3.24Å
27	G	93.8	Very high	95.8	Very high	10 Å²	10	57.5 Å²	57.5	10%	0.103	34%	0.339	C	S	.	.	S	Bend	trans	-70.7	157.5	173.6	0	0	0	0	0	113.4	D8 H24 A25 F29 N30	D8-G27 VanDerWaalsContact OD2-C 3.23Å; D8-G27 VanDerWaalsContact OD2-CA 3.3Å; D8-G27 WeakPolarHBondContact OD2-CA 3.44Å; H24-G27 PolarHBondContact O-N 2.89Å; A25-G27 PolarHBondContact O-N 3.29Å; G27-F29 PolarHBondContact O-N 2.79Å; G27-N30 PolarHBondContact N-ND2 2.82Å; G27-N30 PolarHBondContact O-N 2.99Å; G27-N30 PolarHBondContact O-ND2 3.32Å
28	T	94.9	Very high	95.8	Very high	45 Å²	45	59.7 Å²	59.7	28%	0.276	35%	0.347	S	S	.	.	G	3₁₀ helix	trans	-56	-38.9	174.1	-60.1	0	0	0	0	111.6	D8 N30 N31 L55 K58	D8-T28 WeakPolarHBondContact OD2-CA 3.31Å; D8-T28 PolarHBondContact OD2-N 2.7Å; T28-N30 PolarHBondContact O-N 2.84Å; T28-N31 PolarHBondContact O-N 3.36Å; T28-N31 VanDerWaalsContact O-N 3.09Å; T28-L55 WeakPolarHBondContact CG2-O 3.29Å; T28-K58 HydrophobicContact CG2-CB 3.95Å
29	F	97	Very high	95.7	Very high	0 Å²	0	59.3 Å²	59.3	0%	0	35%	0.35	C	S	.	.	G	3₁₀ helix	trans	-68.8	-15.4	-173.5	-61.4	-30.4	0	0	0	114.7	D8 A10 V20 G27 N31 I32 L55 I90 L101 M103	D8-F29 HydrophobicContact CB-CD2 3.97Å; D8-F29 HydrophobicContact CB-CE2 4.07Å; D8-F29 VanDerWaalsContact CG-CD2 3.44Å; D8-F29 WeakPolarHBondContact OD2-CG 3.41Å; D8-F29 PolarHBondContact OD2-N 2.65Å; A10-F29 HydrophobicContact CB-CB 3.54Å; A10-F29 HydrophobicContact CB-CD2 4.1Å; A10-F29 HydrophobicContact CB-CG 4.18Å; V20-F29 WeakPolarHBondContact CG2-O 3.4Å; G27-F29 PolarHBondContact O-N 2.79Å; F29-N31 PolarHBondContact O-N 3.47Å; F29-I32 HydrophobicContact CB-CD1 3.87Å; F29-I32 HydrophobicContact CD1-CD1 3.77Å; F29-I32 HydrophobicContact CD1-CG1 4.5Å; F29-I32 HydrophobicContact CG-CD1 4.1Å; F29-I32 WeakPolarHBondContact O-CG1 3.38Å; F29-I32 PolarHBondContact O-N 3.01Å; F29-L55 HydrophobicContact CE1-CB 4.35Å; F29-L55 HydrophobicContact CE1-CD1 4.15Å; F29-I90 HydrophobicContact CE1-CD1 4.27Å; F29-I90 HydrophobicContact CE1-CG2 4.43Å; F29-I90 HydrophobicContact CZ-CD1 4.32Å; F29-I90 HydrophobicContact CZ-CG1 4.27Å; F29-I90 HydrophobicContact CZ-CG2 3.86Å; F29-L101 HydrophobicContact CD1-CD2 4.23Å; F29-L101 HydrophobicContact CD2-CB 3.96Å; F29-L101 HydrophobicContact CE1-CB 4.44Å; F29-L101 HydrophobicContact CE1-CD2 4.12Å; F29-L101 HydrophobicContact CE2-CB 3.73Å; F29-L101 HydrophobicContact CG-CB 4.41Å; F29-L101 HydrophobicContact CZ-CB 3.98Å; F29-L101 HydrophobicContact CZ-CD2 4.42Å; F29-M103 HydrophobicContact CE1-CE 3.84Å; F29-M103 HydrophobicContact CE2-CB 3.92Å; F29-M103 HydrophobicContact CZ-CB 3.84Å; F29-M103 HydrophobicContact CZ-CE 3.83Å
30	N	96	Very high	95.5	Very high	64 Å²	64	52.9 Å²	52.9	34%	0.342	33%	0.325	S	S	.	.	G	3₁₀ helix	trans	-61.2	-26.8	171.1	-68.7	-75.9	0	0	0	112.6	A23 H24 G27 T28	A23-N30 WeakPolarHBondContact CB-OD1 3.31Å; H24-N30 PolarHBondContact O-ND2 2.95Å; G27-N30 PolarHBondContact N-ND2 2.82Å; G27-N30 PolarHBondContact O-N 2.99Å; G27-N30 PolarHBondContact O-ND2 3.32Å; T28-N30 PolarHBondContact O-N 2.84Å
31	N	96.5	Very high	95.2	Very high	104 Å²	104	53 Å²	53	56%	0.556	33%	0.326	S	S	*	.	G	3₁₀ helix	trans	-96.4	9.7	-172.6	-56.4	-54.2	0	0	0	112.5	T28 F29 T33	T28-N31 PolarHBondContact O-N 3.36Å; T28-N31 VanDerWaalsContact O-N 3.09Å; F29-N31 PolarHBondContact O-N 3.47Å; N31-T33 PolarHBondContact O-N 3.25Å
32	I	97.6	Very high	94.9	Very high	12 Å²	12	49.5 Å²	49.5	6%	0.062	32%	0.319	C	S	.	.			trans	-63.5	127.2	178.1	-70.8	169.7	0	0	0	109.5	V12 V20 F29 E36 I37 L55 L101	V12-I32 HydrophobicContact CG2-CD1 4.33Å; V20-I32 HydrophobicContact CG2-CB 3.95Å; F29-I32 HydrophobicContact CB-CD1 3.87Å; F29-I32 HydrophobicContact CD1-CD1 3.77Å; F29-I32 HydrophobicContact CD1-CG1 4.5Å; F29-I32 HydrophobicContact CG-CD1 4.1Å; F29-I32 WeakPolarHBondContact O-CG1 3.38Å; F29-I32 PolarHBondContact O-N 3.01Å; I32-E36 WeakPolarHBondContact CA-OE2 3.2Å; I32-E36 HydrophobicContact CG2-CB 4.25Å; I32-I37 HydrophobicContact CG2-CD1 4.19Å; I32-I37 HydrophobicContact CG2-CG1 3.69Å; I32-L55 HydrophobicContact CD1-CD2 4.41Å; I32-L101 HydrophobicContact CD1-CD2 3.59Å
33	T	97.1	Very high	94.4	Very high	55 Å²	55	56.3 Å²	56.3	34%	0.337	34%	0.338	S	S	.	.			trans	-92.5	162.5	-179.2	70.7	0	0	0	0	111.7	N31 Q35 E36 I37	N31-T33 PolarHBondContact O-N 3.25Å; T33-Q35 PolarHBondContact O-N 3.35Å; T33-Q35 PolarHBondContact OG1-OE1 3.47Å; T33-E36 PolarHBondContact N-OE2 3.46Å; T33-E36 PolarHBondContact O-N 3.18Å; T33-E36 WeakPolarHBondContact OG1-CG 3.44Å; T33-E36 PolarHBondContact OG1-N 2.83Å; T33-I37 WeakPolarHBondContact O-CG1 3.3Å; T33-I37 PolarHBondContact O-N 3.2Å
34	S	95.9	Very high	93.9	Very high	52 Å²	52	59.1 Å²	59.1	36%	0.364	35%	0.349	S	S	.	.	H	α-helix	trans	-59.8	-34.9	173.3	54.2	0	0	0	0	112.3	I37 D38	S34-I37 WeakPolarHBondContact O-CB 3.39Å; S34-I37 PolarHBondContact O-N 3.43Å; S34-D38 PolarHBondContact O-N 3.14Å
35	Q	95.3	Very high	93.5	Very high	122 Å²	122	56 Å²	56	57%	0.57	33%	0.333	S	S	*	.	H	α-helix	trans	-65.9	-41.2	176.2	-62.5	84.7	-1.9	0	0	111.8	T33 I37 D38 V39	T33-Q35 PolarHBondContact O-N 3.35Å; T33-Q35 PolarHBondContact OG1-OE1 3.47Å; Q35-I37 VanDerWaalsContact C-N 3.29Å; Q35-I37 PolarHBondContact O-N 2.84Å; Q35-D38 PolarHBondContact O-N 2.91Å; Q35-V39 WeakPolarHBondContact O-CG2 3.47Å; Q35-V39 PolarHBondContact O-N 3.44Å
36	E	96.1	Very high	93	Very high	13 Å²	13	59.8 Å²	59.8	6%	0.061	34%	0.336	C	S	.	.	H	α-helix	trans	-64.2	-36.6	174.7	-71.6	178.7	149.9	0	0	111.3	I32 T33 V39 L40 T54 L55 G56 S57	I32-E36 WeakPolarHBondContact CA-OE2 3.2Å; I32-E36 HydrophobicContact CG2-CB 4.25Å; T33-E36 PolarHBondContact N-OE2 3.46Å; T33-E36 PolarHBondContact O-N 3.18Å; T33-E36 WeakPolarHBondContact OG1-CG 3.44Å; T33-E36 PolarHBondContact OG1-N 2.83Å; E36-V39 PolarHBondContact O-N 2.55Å; E36-L40 WeakPolarHBondContact O-CG 3.41Å; E36-L40 PolarHBondContact O-N 2.9Å; E36-T54 WeakPolarHBondContact CG-O 3.21Å; E36-T54 VanDerWaalsContact OE1-C 3.24Å; E36-T54 WeakPolarHBondContact OE1-CB 3.38Å; E36-T54 PolarHBondContact OE1-OG1 3.27Å; E36-L55 PolarHBondContact OE1-N 2.93Å; E36-G56 PolarHBondContact OE1-N 2.85Å; E36-G56 PolarHBondContact OE2-N 3.22Å; E36-S57 PolarHBondContact OE1-N 2.98Å; E36-S57 VanDerWaalsContact OE1-N 3.11Å
37	I	96.5	Very high	92.5	Very high	0 Å²	0	57.1 Å²	57.1	0%	0	30%	0.304	C	S	.	.	H	α-helix	trans	-63.6	-45.1	173.9	-61.5	164.4	0	0	0	110.8	V12 K18 I32 T33 S34 Q35 V39 L40 V41	V12-I37 HydrophobicContact CG1-CD1 3.25Å; V12-I37 HydrophobicContact CG1-CG1 3.57Å; K18-I37 HydrophobicContact CD-CB 4.47Å; K18-I37 HydrophobicContact CD-CG2 4.23Å; K18-I37 HydrophobicContact CG-CB 4.22Å; K18-I37 HydrophobicContact CG-CD1 4.03Å; K18-I37 HydrophobicContact CG-CG2 3.87Å; I32-I37 HydrophobicContact CG2-CD1 4.19Å; I32-I37 HydrophobicContact CG2-CG1 3.69Å; T33-I37 WeakPolarHBondContact O-CG1 3.3Å; T33-I37 PolarHBondContact O-N 3.2Å; S34-I37 WeakPolarHBondContact O-CB 3.39Å; S34-I37 PolarHBondContact O-N 3.43Å; Q35-I37 VanDerWaalsContact C-N 3.29Å; Q35-I37 PolarHBondContact O-N 2.84Å; I37-V39 VanDerWaalsContact C-N 3.27Å; I37-V39 PolarHBondContact O-N 3.08Å; I37-L40 WeakPolarHBondContact O-CB 3.27Å; I37-L40 PolarHBondContact O-N 2.77Å; I37-L40 VanDerWaalsContact O-N 3.12Å; I37-V41 WeakPolarHBondContact O-CG2 3.16Å; I37-V41 PolarHBondContact O-N 2.96Å
38	D	94.1	Very high	91.9	Very high	73 Å²	73	57 Å²	57	39%	0.39	30%	0.301	S	S	.	.	H	α-helix	trans	-60.1	-38.9	177.8	-73.7	-30	0	0	0	112.1	K18 S34 Q35 G42	K18-D38 WeakPolarHBondContact CE-OD1 3.36Å; K18-D38 IonicContact NZ-OD1 3.08Å; K18-D38 PolarHBondContact NZ-OD1 3.22Å; K18-D38 IonicContact NZ-OD2 2.64Å; S34-D38 PolarHBondContact O-N 3.14Å; Q35-D38 PolarHBondContact O-N 2.91Å; D38-G42 VanDerWaalsContact O-CA 3.26Å; D38-G42 WeakPolarHBondContact O-CA 3.34Å; D38-G42 PolarHBondContact O-N 2.74Å
39	V	93.3	Very high	91.1	Very high	68 Å²	68	61 Å²	61	41%	0.412	31%	0.312	S	S	.	.	H	α-helix	trans	-64.1	-48.7	173.1	174.7	0	0	0	0	110	Q35 E36 I37 V41 G42 F48 L53	Q35-V39 WeakPolarHBondContact O-CG2 3.47Å; Q35-V39 PolarHBondContact O-N 3.44Å; E36-V39 PolarHBondContact O-N 2.55Å; I37-V39 VanDerWaalsContact C-N 3.27Å; I37-V39 PolarHBondContact O-N 3.08Å; V39-V41 VanDerWaalsContact C-N 3.31Å; V39-V41 PolarHBondContact O-N 3.05Å; V39-G42 PolarHBondContact O-N 3.4Å; V39-G42 VanDerWaalsContact O-N 3.14Å; V39-F48 HydrophobicContact CG1-CD1 4.37Å; V39-F48 HydrophobicContact CG1-CE1 3.55Å; V39-F48 HydrophobicContact CG1-CZ 4.33Å; V39-F48 WeakPolarHBondContact O-CZ 3.33Å; V39-L53 HydrophobicContact CG1-CB 4.24Å
40	L	93	Very high	90.3	Very high	2 Å²	2	66.2 Å²	66.2	1%	0.01	34%	0.343	C	S	.	.	H	α-helix	trans	-58.1	-39.2	-179	-75	169.4	0	0	0	113.8	E36 I37 R45 L53 L55 L67 M75 I77 L99	E36-L40 WeakPolarHBondContact O-CG 3.41Å; E36-L40 PolarHBondContact O-N 2.9Å; I37-L40 WeakPolarHBondContact O-CB 3.27Å; I37-L40 PolarHBondContact O-N 2.77Å; I37-L40 VanDerWaalsContact O-N 3.12Å; L40-R45 PolarHBondContact O-NH1 2.8Å; L40-L53 HydrophobicContact CD2-CD1 4.35Å; L40-L53 HydrophobicContact CD2-CD2 3.94Å; L40-L55 HydrophobicContact CD1-CD2 3.61Å; L40-L55 HydrophobicContact CD2-CD2 4.04Å; L40-L55 HydrophobicContact CG-CD2 4.13Å; L40-L67 VanDerWaalsContact O-CD2 3.31Å; L40-L67 WeakPolarHBondContact O-CD2 3.44Å; L40-M75 HydrophobicContact CD2-CE 3.25Å; L40-I77 HydrophobicContact CD2-CD1 4.4Å; L40-L99 HydrophobicContact CB-CD1 4.26Å; L40-L99 HydrophobicContact CD1-CD1 4.12Å
41	V	92.6	Very high	89.7	Confident	37 Å²	37	69.2 Å²	69.2	22%	0.224	36%	0.36	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.3	5.4	-179.6	-52.7	0	0	0	0	113.3	Y14 I37 V39 L99	Y14-V41 HydrophobicContact CD2-CB 4.26Å; Y14-V41 HydrophobicContact CD2-CG1 3.74Å; Y14-V41 HydrophobicContact CD2-CG2 4.33Å; Y14-V41 HydrophobicContact CE2-CG1 4.43Å; Y14-V41 HydrophobicContact CG-CG1 3.89Å; I37-V41 WeakPolarHBondContact O-CG2 3.16Å; I37-V41 PolarHBondContact O-N 2.96Å; V39-V41 VanDerWaalsContact C-N 3.31Å; V39-V41 PolarHBondContact O-N 3.05Å; V41-L99 HydrophobicContact CG1-CD1 3.89Å; V41-L99 HydrophobicContact CG1-CD2 4.15Å; V41-L99 HydrophobicContact CG1-CG 4.45Å
42	G	90.3	Very high	89.4	Confident	20 Å²	20	64.9 Å²	64.9	21%	0.206	34%	0.339	C	S	.	.			trans	-63.1	159.4	-178.3	0	0	0	0	0	113	D38 V39 R45 Q68	D38-G42 VanDerWaalsContact O-CA 3.26Å; D38-G42 WeakPolarHBondContact O-CA 3.34Å; D38-G42 PolarHBondContact O-N 2.74Å; V39-G42 PolarHBondContact O-N 3.4Å; V39-G42 VanDerWaalsContact O-N 3.14Å; G42-R45 VanDerWaalsContact O-CD 3.23Å; G42-R45 WeakPolarHBondContact O-CD 3.35Å; G42-R45 PolarHBondContact O-NH1 2.94Å; G42-Q68 PolarHBondContact O-NE2 3.07Å; G42-Q68 VanDerWaalsContact O-NE2 3.16Å
43	K	85.8	Confident	89.2	Confident	201 Å²	201	65 Å²	65	87%	0.874	34%	0.34	S	S	*	.	S	Bend	trans	-76.3	-27.9	178.9	-65.3	-175.5	178.9	-178.4	0	113.3	R45	K43-R45 PolarHBondContact O-N 2.88Å
44	D	86.9	Confident	89.1	Confident	90 Å²	90	65.1 Å²	65.1	48%	0.481	34%	0.341	S	S	.	.			trans	-77.2	106.5	176.1	179.3	9.3	0	0	0	108.9	E46 S47 F48	D44-E46 PolarHBondContact OD1-N 3.05Å; D44-S47 PolarHBondContact OD1-N 3.4Å; D44-S47 PolarHBondContact OD1-OG 2.71Å; D44-S47 WeakPolarHBondContact OD2-CB 3.32Å; D44-S47 PolarHBondContact OD2-OG 3.15Å; D44-F48 WeakPolarHBondContact O-CE2 3.26Å; D44-F48 WeakPolarHBondContact O-CZ 3.11Å
45	R	86.5	Confident	89.1	Confident	38 Å²	38	62.7 Å²	62.7	14%	0.143	32%	0.324	C	S	.	.			trans	-103.3	-14.7	-179.8	-49	-53	-73.2	171.9	6.4	112.9	L40 G42 K43 F48 D65	L40-R45 PolarHBondContact O-NH1 2.8Å; G42-R45 VanDerWaalsContact O-CD 3.23Å; G42-R45 WeakPolarHBondContact O-CD 3.35Å; G42-R45 PolarHBondContact O-NH1 2.94Å; K43-R45 PolarHBondContact O-N 2.88Å; R45-F48 HydrophobicContact CB-CE2 4.49Å; R45-F48 VanDerWaalsContact CZ-CE2 3.44Å; R45-F48 VanDerWaalsContact NH1-CE2 3.34Å; R45-D65 IonicContact CZ-OD1 2.68Å; R45-D65 IonicContact CZ-OD2 2.63Å; R45-D65 IonicContact NE-OD1 2.87Å; R45-D65 IonicContact NE-OD2 2.81Å; R45-D65 PolarHBondContact NE-OD2 3.39Å; R45-D65 IonicContact NH2-OD1 3.95Å; R45-D65 PolarHBondContact NH2-OD1 2.91Å; R45-D65 IonicContact NH2-OD2 2.83Å; R45-D65 PolarHBondContact NH2-OD2 2.54Å
46	E	82.6	Confident	89	Confident	164 Å²	164	57.3 Å²	57.3	77%	0.766	30%	0.301	S	S	*	.	S	Bend	trans	-85.5	-36.4	-175.4	-64.9	-158.9	159.1	0	0	111.8	D44 F48 Y49	D44-E46 PolarHBondContact OD1-N 3.05Å; E46-F48 PolarHBondContact O-N 3.13Å; E46-F48 VanDerWaalsContact O-N 3.13Å; E46-Y49 PolarHBondContact O-N 3.27Å
47	S	81.7	Confident	88.9	Confident	30 Å²	30	61.6 Å²	61.6	21%	0.21	33%	0.332	C	S	.	.	H	α-helix	trans	-65.3	-17.5	-179.6	69	0	0	0	0	113.7	D44 Y49 T50 N51	D44-S47 PolarHBondContact OD1-N 3.4Å; D44-S47 PolarHBondContact OD1-OG 2.71Å; D44-S47 WeakPolarHBondContact OD2-CB 3.32Å; D44-S47 PolarHBondContact OD2-OG 3.15Å; S47-Y49 VanDerWaalsContact C-N 3.31Å; S47-Y49 PolarHBondContact O-N 3.38Å; S47-T50 PolarHBondContact O-N 3.34Å; S47-T50 PolarHBondContact O-OG1 2.81Å; S47-T50 VanDerWaalsContact O-OG1 3.13Å; S47-N51 WeakPolarHBondContact O-CB 3.19Å; S47-N51 PolarHBondContact O-N 2.94Å
48	F	80.2	Confident	88.8	Confident	7 Å²	7	64.4 Å²	64.4	3%	0.031	35%	0.345	C	S	.	.	H	α-helix	trans	-64.6	-34.4	175	-60.8	-32.6	0	0	0	113.5	V39 D44 R45 E46 T50 G52 L53 V62	V39-F48 HydrophobicContact CG1-CD1 4.37Å; V39-F48 HydrophobicContact CG1-CE1 3.55Å; V39-F48 HydrophobicContact CG1-CZ 4.33Å; V39-F48 WeakPolarHBondContact O-CZ 3.33Å; D44-F48 WeakPolarHBondContact O-CE2 3.26Å; D44-F48 WeakPolarHBondContact O-CZ 3.11Å; R45-F48 HydrophobicContact CB-CE2 4.49Å; R45-F48 VanDerWaalsContact CZ-CE2 3.44Å; R45-F48 VanDerWaalsContact NH1-CE2 3.34Å; E46-F48 PolarHBondContact O-N 3.13Å; E46-F48 VanDerWaalsContact O-N 3.13Å; F48-T50 VanDerWaalsContact C-N 3.31Å; F48-G52 WeakPolarHBondContact O-CA 3.36Å; F48-G52 PolarHBondContact O-N 3.17Å; F48-L53 HydrophobicContact CD1-CD2 4.45Å; F48-V62 HydrophobicContact CB-CB 4.08Å; F48-V62 HydrophobicContact CB-CG2 3.67Å; F48-V62 HydrophobicContact CG-CG2 4.22Å
49	Y	77.4	Confident	88.8	Confident	130 Å²	130	66.3 Å²	66.3	51%	0.51	35%	0.349	S	S	.	.	H	α-helix	trans	-72.7	-29	-177.9	-66.4	-76.9	0	0	0	111.7	E46 S47 V62 D65	E46-Y49 PolarHBondContact O-N 3.27Å; S47-Y49 VanDerWaalsContact C-N 3.31Å; S47-Y49 PolarHBondContact O-N 3.38Å; Y49-V62 HydrophobicContact CE1-CG1 4.11Å; Y49-D65 WeakPolarHBondContact OH-CB 3.46Å; Y49-D65 PolarHBondContact OH-N 2.92Å
50	T	82.1	Confident	88.9	Confident	108 Å²	108	63 Å²	63	66%	0.663	33%	0.33	S	S	*	.	H	α-helix	trans	-91.2	-48.7	179.8	51.8	0	0	0	0	112.4	S47 F48	S47-T50 PolarHBondContact O-N 3.34Å; S47-T50 PolarHBondContact O-OG1 2.81Å; S47-T50 VanDerWaalsContact O-OG1 3.13Å; F48-T50 VanDerWaalsContact C-N 3.31Å
51	N	83.4	Confident	88.9	Confident	127 Å²	127	64.5 Å²	64.5	68%	0.679	34%	0.34	S	S	*	.	H	α-helix	trans	-94.7	-21.4	-173.2	-62.6	-37.6	0	0	0	113.1	S47	S47-N51 WeakPolarHBondContact O-CB 3.19Å; S47-N51 PolarHBondContact O-N 2.94Å
52	G	88.4	Confident	89.1	Confident	13 Å²	13	63.2 Å²	63.2	13%	0.134	33%	0.333	C	S	.	.			trans	70	-163.1	-168.2	0	0	0	0	0	112.1	F48 C60	F48-G52 WeakPolarHBondContact O-CA 3.36Å; F48-G52 PolarHBondContact O-N 3.17Å; G52-C60 VanDerWaalsContact CA-O 3.28Å; G52-C60 WeakPolarHBondContact CA-O 3.48Å
53	L	93.5	Very high	89.3	Confident	14 Å²	14	66.9 Å²	66.9	7%	0.073	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.8	172.9	176.8	61.3	83.9	0	0	0	110.5	V39 L40 F48 L55 C60 V62 M75 I77	V39-L53 HydrophobicContact CG1-CB 4.24Å; L40-L53 HydrophobicContact CD2-CD1 4.35Å; L40-L53 HydrophobicContact CD2-CD2 3.94Å; F48-L53 HydrophobicContact CD1-CD2 4.45Å; L53-L55 HydrophobicContact CD1-CD1 4.19Å; L53-L55 HydrophobicContact CD1-CD2 4.04Å; L53-L55 HydrophobicContact CD1-CG 3.64Å; L53-C60 HydrophobicContact CD1-CB 4Å; L53-C60 HydrophobicContact CG-CB 4.48Å; L53-C60 PolarHBondContact N-O 2.82Å; L53-C60 VanDerWaalsContact N-O 3.13Å; L53-C60 PolarHBondContact O-N 2.97Å; L53-V62 HydrophobicContact CD2-CG2 3.62Å; L53-V62 HydrophobicContact CG-CG2 4.32Å; L53-M75 HydrophobicContact CD2-CE 4.26Å; L53-I77 HydrophobicContact CD1-CD1 4.42Å; L53-I77 HydrophobicContact CD2-CD1 4.36Å
54	T	95.3	Very high	89.6	Confident	58 Å²	58	61 Å²	61	36%	0.356	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	144.8	171.9	59.3	0	0	0	0	110.9	E36 K58 K59	E36-T54 WeakPolarHBondContact CG-O 3.21Å; E36-T54 VanDerWaalsContact OE1-C 3.24Å; E36-T54 WeakPolarHBondContact OE1-CB 3.38Å; E36-T54 PolarHBondContact OE1-OG1 3.27Å; T54-K58 VanDerWaalsContact CA-O 3.32Å; T54-K58 WeakPolarHBondContact CA-O 3.18Å; T54-K59 HydrophobicContact CG2-CG 4.23Å
55	L	95.7	Very high	90	Very high	1 Å²	1	57.9 Å²	57.9	1%	0.005	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	113.4	171	-67.6	176	0	0	0	108	T28 F29 I32 E36 L40 L53 S57 K58 I77 I90 L101	T28-L55 WeakPolarHBondContact CG2-O 3.29Å; F29-L55 HydrophobicContact CE1-CB 4.35Å; F29-L55 HydrophobicContact CE1-CD1 4.15Å; I32-L55 HydrophobicContact CD1-CD2 4.41Å; E36-L55 PolarHBondContact OE1-N 2.93Å; L40-L55 HydrophobicContact CD1-CD2 3.61Å; L40-L55 HydrophobicContact CD2-CD2 4.04Å; L40-L55 HydrophobicContact CG-CD2 4.13Å; L53-L55 HydrophobicContact CD1-CD1 4.19Å; L53-L55 HydrophobicContact CD1-CD2 4.04Å; L53-L55 HydrophobicContact CD1-CG 3.64Å; L55-S57 VanDerWaalsContact C-N 3.25Å; L55-S57 PolarHBondContact O-N 2.8Å; L55-K58 PolarHBondContact N-O 2.94Å; L55-K58 WeakPolarHBondContact O-CB 3.18Å; L55-K58 PolarHBondContact O-N 3.24Å; L55-I77 HydrophobicContact CD1-CD1 4.07Å; L55-I90 HydrophobicContact CD1-CD1 3.9Å; L55-I90 HydrophobicContact CD1-CG2 4.12Å; L55-L101 HydrophobicContact CD1-CD2 4.29Å; L55-L101 HydrophobicContact CD2-CD2 4.09Å
56	G	94.8	Very high	90.4	Very high	9 Å²	9	57 Å²	57	9%	0.093	30%	0.302	C	S	.	.	T	Hydrogen-bonded Turn	trans	56.5	42.5	-176.9	0	0	0	0	0	112	E36 K58	E36-G56 PolarHBondContact OE1-N 2.85Å; E36-G56 PolarHBondContact OE2-N 3.22Å; G56-K58 PolarHBondContact O-N 2.96Å
57	S	92.6	Very high	90.9	Very high	103 Å²	103	49.2 Å²	49.2	72%	0.72	27%	0.265	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.9	-0.4	-173.1	-52	0	0	0	0	116.4	E36 L55	E36-S57 PolarHBondContact OE1-N 2.98Å; E36-S57 VanDerWaalsContact OE1-N 3.11Å; L55-S57 VanDerWaalsContact C-N 3.25Å; L55-S57 PolarHBondContact O-N 2.8Å
58	K	93.8	Very high	91.3	Very high	59 Å²	59	52 Å²	52	26%	0.257	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	120.3	174.5	-169.5	66.8	172.1	178.8	0	110.1	T28 T54 L55 G56 C60 T79 E85	T28-K58 HydrophobicContact CG2-CB 3.95Å; T54-K58 VanDerWaalsContact CA-O 3.32Å; T54-K58 WeakPolarHBondContact CA-O 3.18Å; L55-K58 PolarHBondContact N-O 2.94Å; L55-K58 WeakPolarHBondContact O-CB 3.18Å; L55-K58 PolarHBondContact O-N 3.24Å; G56-K58 PolarHBondContact O-N 2.96Å; K58-C60 PolarHBondContact O-SG 2.89Å; K58-T79 HydrophobicContact CG-CG2 3.93Å; K58-E85 IonicContact NZ-OE1 2.55Å; K58-E85 PolarHBondContact NZ-OE1 2.88Å
59	K	94.6	Very high	91.9	Very high	113 Å²	113	55.6 Å²	55.6	49%	0.491	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63	137.6	174.4	-67.7	-171.2	-178.6	178.7	0	110.8	T54 K80	T54-K59 HydrophobicContact CG2-CG 4.23Å; K59-K80 HydrophobicContact CB-CB 4.2Å; K59-K80 HydrophobicContact CB-CD 4.45Å; K59-K80 PolarHBondContact O-N 3.34Å
60	C	95.4	Very high	92.4	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	155.6	-177.2	-61.7	0	0	0	0	111.6	G52 L53 K58 I77 R78 K80	G52-C60 VanDerWaalsContact CA-O 3.28Å; G52-C60 WeakPolarHBondContact CA-O 3.48Å; L53-C60 HydrophobicContact CD1-CB 4Å; L53-C60 HydrophobicContact CG-CB 4.48Å; L53-C60 PolarHBondContact N-O 2.82Å; L53-C60 VanDerWaalsContact N-O 3.13Å; L53-C60 PolarHBondContact O-N 2.97Å; K58-C60 PolarHBondContact O-SG 2.89Å; C60-I77 HydrophobicContact CB-CG2 3.37Å; C60-R78 CarbonylContact C-O 3.58Å; C60-R78 VanDerWaalsContact CA-O 3.27Å; C60-R78 WeakPolarHBondContact CA-O 3.28Å; C60-K80 WeakPolarHBondContact O-CE 3.43Å
61	S	94.5	Very high	92.7	Very high	33 Å²	33	53.5 Å²	53.5	23%	0.231	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	134.4	168.3	49.7	0	0	0	0	109.6	I77 R78	S61-I77 CarbonylContact O-C 3.51Å; S61-I77 WeakPolarHBondContact O-CA 3.45Å; S61-I77 WeakPolarHBondContact O-CG2 3.36Å; S61-R78 PolarHBondContact N-O 2.87Å; S61-R78 PolarHBondContact O-N 3.32Å; S61-R78 PolarHBondContact OG-O 3.16Å
62	V	95.1	Very high	93.1	Very high	10 Å²	10	49.5 Å²	49.5	6%	0.061	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	130.4	170.5	178.6	0	0	0	0	108.9	F48 Y49 L53 D65 M75 I77	F48-V62 HydrophobicContact CB-CB 4.08Å; F48-V62 HydrophobicContact CB-CG2 3.67Å; F48-V62 HydrophobicContact CG-CG2 4.22Å; Y49-V62 HydrophobicContact CE1-CG1 4.11Å; L53-V62 HydrophobicContact CD2-CG2 3.62Å; L53-V62 HydrophobicContact CG-CG2 4.32Å; V62-D65 HydrophobicContact CG1-CB 4.11Å; V62-M75 HydrophobicContact CG1-CG 4.2Å; V62-M75 HydrophobicContact CG1-SD 4.31Å; V62-M75 HydrophobicContact CG2-SD 4.31Å; V62-I77 HydrophobicContact CG2-CG1 4.47Å
63	L	94.4	Very high	93.5	Very high	97 Å²	97	51 Å²	51	51%	0.508	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	-40.5	177.3	-58.7	-179	0	0	0	111	D76 R78	L63-D76 HydrophobicContact CB-CB 4.41Å; L63-D76 PolarHBondContact N-O 2.9Å; L63-R78 HydrophobicContact CD1-CB 3.98Å; L63-R78 HydrophobicContact CD2-CB 4.38Å; L63-R78 HydrophobicContact CG-CB 4.25Å
64	R	93.6	Very high	93.7	Very high	78 Å²	78	50.3 Å²	50.3	29%	0.294	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.6	140.2	179.2	-177.7	179.6	68.4	103.5	-3.9	109	D72 T74 M75 D76 N114	R64-D72 IonicContact CZ-OD2 3.33Å; R64-D72 IonicContact NH1-OD1 2.84Å; R64-D72 IonicContact NH1-OD2 3.55Å; R64-D72 PolarHBondContact NH1-OD2 3.12Å; R64-T74 PolarHBondContact NH2-OG1 2.94Å; R64-M75 CarbonylContact O-C 3.58Å; R64-M75 WeakPolarHBondContact O-CA 3.47Å; R64-M75 WeakPolarHBondContact O-CG 3.48Å; R64-D76 HydrophobicContact CB-CB 4.29Å; R64-D76 IonicContact CZ-OD2 2.94Å; R64-D76 PolarHBondContact N-O 3.07Å; R64-D76 IonicContact NE-OD2 3.71Å; R64-D76 PolarHBondContact NE-OD2 3.04Å; R64-D76 IonicContact NH2-OD2 3.58Å; R64-D76 PolarHBondContact NH2-OD2 2.68Å; R64-D76 PolarHBondContact O-N 3.13Å; R64-N114 VanDerWaalsContact NH2-CG 3.31Å; R64-N114 PolarHBondContact NH2-ND2 3.22Å; R64-N114 PolarHBondContact NH2-OD1 3.09Å
65	D	94.4	Very high	93.7	Very high	24 Å²	24	47.6 Å²	47.6	13%	0.128	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	112.4	177.6	178.3	22.7	0	0	0	111.6	R45 Y49 V62 L67 M75	R45-D65 IonicContact CZ-OD1 2.68Å; R45-D65 IonicContact CZ-OD2 2.63Å; R45-D65 IonicContact NE-OD1 2.87Å; R45-D65 IonicContact NE-OD2 2.81Å; R45-D65 PolarHBondContact NE-OD2 3.39Å; R45-D65 IonicContact NH2-OD1 3.95Å; R45-D65 PolarHBondContact NH2-OD1 2.91Å; R45-D65 IonicContact NH2-OD2 2.83Å; R45-D65 PolarHBondContact NH2-OD2 2.54Å; Y49-D65 WeakPolarHBondContact OH-CB 3.46Å; Y49-D65 PolarHBondContact OH-N 2.92Å; V62-D65 HydrophobicContact CG1-CB 4.11Å; D65-L67 WeakPolarHBondContact OD1-CB 3.23Å; D65-L67 PolarHBondContact OD1-N 2.85Å; D65-L67 VanDerWaalsContact OD1-N 3.07Å; D65-M75 HydrophobicContact CB-CG 4.3Å; D65-M75 HydrophobicContact CB-SD 4.4Å
66	S	94.8	Very high	93.8	Very high	18 Å²	18	48.5 Å²	48.5	13%	0.126	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	28.5	172.3	-66.8	0	0	0	0	110.2	Q68 D69 W73 T74	S66-Q68 PolarHBondContact O-N 2.72Å; S66-D69 VanDerWaalsContact CA-OD2 3.28Å; S66-D69 WeakPolarHBondContact CA-OD2 3.44Å; S66-D69 WeakPolarHBondContact CB-OD2 3.47Å; S66-D69 PolarHBondContact O-N 3Å; S66-D69 PolarHBondContact OG-OD2 3.3Å; S66-W73 WeakPolarHBondContact O-CA 3.32Å; S66-W73 PolarHBondContact O-N 3.28Å; S66-W73 VanDerWaalsContact O-N 3.13Å; S66-T74 CarbonylContact C-O 3.5Å; S66-T74 VanDerWaalsContact CA-O 3.28Å; S66-T74 WeakPolarHBondContact CA-O 3.2Å; S66-T74 PolarHBondContact N-O 2.88Å; S66-T74 PolarHBondContact O-N 3.32Å
67	L	93.4	Very high	93.9	Very high	1 Å²	1	48.1 Å²	48.1	1%	0.005	26%	0.259	C	S	.	.	T	Hydrogen-bonded Turn	trans	-67.5	-26.2	-172.3	-160.2	71	0	0	0	112.6	L40 D65 T74 M75 V92 R94	L40-L67 VanDerWaalsContact O-CD2 3.31Å; L40-L67 WeakPolarHBondContact O-CD2 3.44Å; D65-L67 WeakPolarHBondContact OD1-CB 3.23Å; D65-L67 PolarHBondContact OD1-N 2.85Å; D65-L67 VanDerWaalsContact OD1-N 3.07Å; L67-T74 PolarHBondContact N-O 2.84Å; L67-T74 VanDerWaalsContact N-O 3.13Å; L67-M75 HydrophobicContact CB-CB 4.27Å; L67-M75 HydrophobicContact CD1-CB 4.08Å; L67-M75 HydrophobicContact CD2-CE 4.46Å; L67-V92 HydrophobicContact CD1-CB 4.47Å; L67-V92 HydrophobicContact CD1-CG1 4.07Å; L67-R94 HydrophobicContact CD1-CB 3.69Å; L67-R94 HydrophobicContact CG-CB 3.95Å; L67-R94 WeakPolarHBondContact O-CD 3.48Å
68	Q	90.6	Very high	94.1	Very high	88 Å²	88	48 Å²	48	41%	0.411	24%	0.243	S	C	.	.	T	Hydrogen-bonded Turn	trans	-100.5	-4.2	177.7	-54.1	-164.7	23.5	0	0	113	G42 S66	G42-Q68 PolarHBondContact O-NE2 3.07Å; G42-Q68 VanDerWaalsContact O-NE2 3.16Å; S66-Q68 PolarHBondContact O-N 2.72Å
69	D	92.4	Very high	94.2	Very high	84 Å²	84	45.3 Å²	45.3	45%	0.449	23%	0.232	S	C	.	.	S	Bend	trans	-81.9	129.2	-176.9	-61.2	-17	0	0	0	110.3	S66 G71 D72 W73	S66-D69 VanDerWaalsContact CA-OD2 3.28Å; S66-D69 WeakPolarHBondContact CA-OD2 3.44Å; S66-D69 WeakPolarHBondContact CB-OD2 3.47Å; S66-D69 PolarHBondContact O-N 3Å; S66-D69 PolarHBondContact OG-OD2 3.3Å; D69-G71 PolarHBondContact O-N 3.02Å; D69-D72 HydrophobicContact CB-CB 4.41Å; D69-D72 PolarHBondContact O-N 3.15Å; D69-W73 PolarHBondContact O-N 3.33Å; D69-W73 VanDerWaalsContact O-N 3.15Å; D69-W73 PolarHBondContact O-NE1 2.81Å
70	D	88.8	Confident	94.1	Very high	151 Å²	151	43.7 Å²	43.7	81%	0.807	23%	0.225	S	C	*	.	T	Hydrogen-bonded Turn	trans	-68.5	124.6	178.7	-84.5	-23.1	0	0	0	112.3	W73	D70-W73 PolarHBondContact OD1-NE1 2.82Å
71	G	87.9	Confident	93.9	Very high	43 Å²	43	45.9 Å²	45.9	44%	0.443	24%	0.24	S	C	.	.	T	Hydrogen-bonded Turn	trans	99.9	-23.2	-177.7	0	0	0	0	0	114.2	D69 H118	D69-G71 PolarHBondContact O-N 3.02Å; G71-H118 PolarHBondContact O-NE2 2.94Å
72	D	91.8	Very high	93.2	Very high	43 Å²	43	51.5 Å²	51.5	23%	0.23	26%	0.262	C	S	.	.	T	Hydrogen-bonded Turn	trans	-101.9	-61.8	178.9	-164	-35.7	0	0	0	111	R64 D69 T74 H118	R64-D72 IonicContact CZ-OD2 3.33Å; R64-D72 IonicContact NH1-OD1 2.84Å; R64-D72 IonicContact NH1-OD2 3.55Å; R64-D72 PolarHBondContact NH1-OD2 3.12Å; D69-D72 HydrophobicContact CB-CB 4.41Å; D69-D72 PolarHBondContact O-N 3.15Å; D72-T74 WeakPolarHBondContact O-CG2 3.44Å; D72-T74 PolarHBondContact O-N 3.21Å; D72-T74 WeakPolarHBondContact OD1-CB 3.32Å; D72-T74 PolarHBondContact OD1-N 2.82Å; D72-T74 PolarHBondContact OD1-OG1 2.84Å; D72-H118 PolarHBondContact O-CD2 2.86Å; D72-H118 PolarHBondContact O-NE2 3.27Å
73	W	96	Very high	92.7	Very high	44 Å²	44	54.4 Å²	54.4	17%	0.167	30%	0.295	C	S	.	.			trans	54.1	25.3	177.7	-42.6	-56.8	0	0	0	114.7	S66 D69 D70 G93 R94 R125	S66-W73 WeakPolarHBondContact O-CA 3.32Å; S66-W73 PolarHBondContact O-N 3.28Å; S66-W73 VanDerWaalsContact O-N 3.13Å; D69-W73 PolarHBondContact O-N 3.33Å; D69-W73 VanDerWaalsContact O-N 3.15Å; D69-W73 PolarHBondContact O-NE1 2.81Å; D70-W73 PolarHBondContact OD1-NE1 2.82Å; W73-G93 CarbonylContact O-C 3.46Å; W73-G93 WeakPolarHBondContact O-CA 3.3Å; W73-R94 HydrophobicContact CB-CB 4.34Å; W73-R94 PolarHBondContact O-N 2.78Å; W73-R125 VanDerWaalsContact CD1-CZ 3.49Å; W73-R125 VanDerWaalsContact CD2-NH1 3.32Å; W73-R125 VanDerWaalsContact CE2-CZ 3.4Å; W73-R125 VanDerWaalsContact CZ2-NH1 3.27Å
74	T	97.2	Very high	92.3	Very high	0 Å²	0	53.3 Å²	53.3	0%	0	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	155.2	-179.6	72.3	0	0	0	0	112.8	R64 S66 L67 D72 V92 N114 H118	R64-T74 PolarHBondContact NH2-OG1 2.94Å; S66-T74 CarbonylContact C-O 3.5Å; S66-T74 VanDerWaalsContact CA-O 3.28Å; S66-T74 WeakPolarHBondContact CA-O 3.2Å; S66-T74 PolarHBondContact N-O 2.88Å; S66-T74 PolarHBondContact O-N 3.32Å; L67-T74 PolarHBondContact N-O 2.84Å; L67-T74 VanDerWaalsContact N-O 3.13Å; D72-T74 WeakPolarHBondContact O-CG2 3.44Å; D72-T74 PolarHBondContact O-N 3.21Å; D72-T74 WeakPolarHBondContact OD1-CB 3.32Å; D72-T74 PolarHBondContact OD1-N 2.82Å; D72-T74 PolarHBondContact OD1-OG1 2.84Å; T74-V92 CarbonylContact C-O 3.54Å; T74-V92 WeakPolarHBondContact CA-O 3.48Å; T74-N114 VanDerWaalsContact CB-ND2 3.27Å; T74-N114 WeakPolarHBondContact CB-ND2 3.28Å; T74-N114 PolarHBondContact OG1-ND2 2.86Å; T74-H118 HydrophobicContact CG2-CB 3.69Å
75	M	96.7	Very high	92.1	Very high	0 Å²	0	52.6 Å²	52.6	0%	0	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	133.6	172.6	178.2	171.4	69.7	0	0	108.6	L40 L53 V62 R64 D65 L67 I77 S91 V92	L40-M75 HydrophobicContact CD2-CE 3.25Å; L53-M75 HydrophobicContact CD2-CE 4.26Å; V62-M75 HydrophobicContact CG1-CG 4.2Å; V62-M75 HydrophobicContact CG1-SD 4.31Å; V62-M75 HydrophobicContact CG2-SD 4.31Å; R64-M75 CarbonylContact O-C 3.58Å; R64-M75 WeakPolarHBondContact O-CA 3.47Å; R64-M75 WeakPolarHBondContact O-CG 3.48Å; D65-M75 HydrophobicContact CB-CG 4.3Å; D65-M75 HydrophobicContact CB-SD 4.4Å; L67-M75 HydrophobicContact CB-CB 4.27Å; L67-M75 HydrophobicContact CD1-CB 4.08Å; L67-M75 HydrophobicContact CD2-CE 4.46Å; M75-I77 HydrophobicContact CE-CD1 3.5Å; M75-I77 VanDerWaalsContact CE-CD1 3.5Å; M75-I77 HydrophobicContact CE-CG1 4.15Å; M75-I77 HydrophobicContact CG-CD1 4.34Å; M75-I77 HydrophobicContact CG-CG1 3.97Å; M75-I77 HydrophobicContact SD-CD1 4.46Å; M75-S91 WeakPolarHBondContact O-CA 3.49Å; M75-V92 HydrophobicContact CB-CB 4.37Å; M75-V92 HydrophobicContact CE-CB 4.48Å; M75-V92 HydrophobicContact CE-CG2 4.3Å; M75-V92 PolarHBondContact N-O 2.95Å; M75-V92 PolarHBondContact O-N 2.74Å
76	D	97.1	Very high	92	Very high	21 Å²	21	54.1 Å²	54.1	11%	0.112	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	131.3	178.8	-63.5	-49.7	0	0	0	109.9	L63 R64 S91 N114	L63-D76 HydrophobicContact CB-CB 4.41Å; L63-D76 PolarHBondContact N-O 2.9Å; R64-D76 HydrophobicContact CB-CB 4.29Å; R64-D76 IonicContact CZ-OD2 2.94Å; R64-D76 PolarHBondContact N-O 3.07Å; R64-D76 IonicContact NE-OD2 3.71Å; R64-D76 PolarHBondContact NE-OD2 3.04Å; R64-D76 IonicContact NH2-OD2 3.58Å; R64-D76 PolarHBondContact NH2-OD2 2.68Å; R64-D76 PolarHBondContact O-N 3.13Å; D76-S91 PolarHBondContact OD1-OG 3.48Å; D76-N114 VanDerWaalsContact CG-ND2 3.34Å; D76-N114 WeakPolarHBondContact OD1-CB 3.39Å; D76-N114 PolarHBondContact OD1-ND2 3.3Å; D76-N114 PolarHBondContact OD2-ND2 3.24Å
77	I	96.8	Very high	92	Very high	1 Å²	1	55.8 Å²	55.8	1%	0.005	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.1	151.2	-169.6	-55	173.1	0	0	0	107.6	L40 L53 L55 C60 S61 V62 M75 I90 V92	L40-I77 HydrophobicContact CD2-CD1 4.4Å; L53-I77 HydrophobicContact CD1-CD1 4.42Å; L53-I77 HydrophobicContact CD2-CD1 4.36Å; L55-I77 HydrophobicContact CD1-CD1 4.07Å; C60-I77 HydrophobicContact CB-CG2 3.37Å; S61-I77 CarbonylContact O-C 3.51Å; S61-I77 WeakPolarHBondContact O-CA 3.45Å; S61-I77 WeakPolarHBondContact O-CG2 3.36Å; V62-I77 HydrophobicContact CG2-CG1 4.47Å; M75-I77 HydrophobicContact CE-CD1 3.5Å; M75-I77 VanDerWaalsContact CE-CD1 3.5Å; M75-I77 HydrophobicContact CE-CG1 4.15Å; M75-I77 HydrophobicContact CG-CD1 4.34Å; M75-I77 HydrophobicContact CG-CG1 3.97Å; M75-I77 HydrophobicContact SD-CD1 4.46Å; I77-I90 HydrophobicContact CB-CB 4.06Å; I77-I90 HydrophobicContact CB-CG2 4.45Å; I77-I90 PolarHBondContact N-O 3.14Å; I77-I90 PolarHBondContact O-N 3.05Å; I77-V92 HydrophobicContact CD1-CG2 3.63Å
78	R	96	Very high	92.1	Very high	100 Å²	100	58.2 Å²	58.2	38%	0.377	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	137.9	169.5	174.7	171.2	-82.8	-166.3	-15	110.4	C60 S61 L63 Y88 N89	C60-R78 CarbonylContact C-O 3.58Å; C60-R78 VanDerWaalsContact CA-O 3.27Å; C60-R78 WeakPolarHBondContact CA-O 3.28Å; S61-R78 PolarHBondContact N-O 2.87Å; S61-R78 PolarHBondContact O-N 3.32Å; S61-R78 PolarHBondContact OG-O 3.16Å; L63-R78 HydrophobicContact CD1-CB 3.98Å; L63-R78 HydrophobicContact CD2-CB 4.38Å; L63-R78 HydrophobicContact CG-CB 4.25Å; R78-Y88 WeakPolarHBondContact CA-O 3.33Å; R78-N89 VanDerWaalsContact CZ-OD1 3.28Å; R78-N89 PolarHBondContact NE-OD1 3.24Å; R78-N89 PolarHBondContact NH2-ND2 3.38Å; R78-N89 PolarHBondContact NH2-OD1 3.36Å
79	T	95.8	Very high	92.5	Very high	3 Å²	3	54.8 Å²	54.8	2%	0.018	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.1	145.5	174.1	61.1	0	0	0	0	110.4	K58 T87 Y88 I90 M103	K58-T79 HydrophobicContact CG-CG2 3.93Å; T79-T87 VanDerWaalsContact O-CB 3.26Å; T79-T87 WeakPolarHBondContact O-CB 3.28Å; T79-T87 WeakPolarHBondContact O-CG2 3.45Å; T79-T87 WeakPolarHBondContact OG1-CA 3.47Å; T79-Y88 PolarHBondContact N-O 3.18Å; T79-Y88 PolarHBondContact OG1-N 2.75Å; T79-I90 HydrophobicContact CG2-CD1 3.66Å; T79-I90 HydrophobicContact CG2-CG1 4.39Å; T79-M103 HydrophobicContact CG2-CE 4.41Å
80	K	93.8	Very high	92.7	Very high	79 Å²	79	50.9 Å²	50.9	34%	0.343	30%	0.3	S	S	.	.	P	Polyproline II helix	trans	-92.4	138	172.8	-66.1	-179	179.3	176.9	0	109.2	K59 C60	K59-K80 HydrophobicContact CB-CB 4.2Å; K59-K80 HydrophobicContact CB-CD 4.45Å; K59-K80 PolarHBondContact O-N 3.34Å; C60-K80 WeakPolarHBondContact O-CE 3.43Å
81	S	90.1	Very high	93.2	Very high	46 Å²	46	43.7 Å²	43.7	32%	0.322	26%	0.262	S	S	.	.	P	Polyproline II helix	trans	-85.7	142.2	168.6	169.1	0	0	0	0	110	G83 G84 E85	S81-G83 PolarHBondContact OG-N 3.26Å; S81-G84 VanDerWaalsContact OG-CA 3.32Å; S81-G84 WeakPolarHBondContact OG-CA 3.4Å; S81-G84 PolarHBondContact OG-N 2.95Å; S81-E85 WeakPolarHBondContact CA-OE1 3.41Å; S81-E85 WeakPolarHBondContact CA-OE2 3.44Å; S81-E85 WeakPolarHBondContact CB-O 3.31Å; S81-E85 WeakPolarHBondContact CB-OE2 3.28Å; S81-E85 PolarHBondContact OG-N 2.68Å; S81-E85 VanDerWaalsContact OG-N 3.13Å; S81-E85 PolarHBondContact OG-O 3.25Å; S81-E85 PolarHBondContact OG-OE2 3.46Å
82	Q	80.9	Confident	93.6	Very high	150 Å²	150	41.6 Å²	41.6	70%	0.701	24%	0.241	S	C	*	.	S	Bend	trans	-107.9	-19	170.8	-65.6	-172.5	17.2	0	0	112.9	E85	Q82-E85 PolarHBondContact N-OE1 2.84Å; Q82-E85 PolarHBondContact N-OE2 2.89Å
83	G	84.5	Confident	93.9	Very high	72 Å²	72	39.6 Å²	39.6	74%	0.742	23%	0.23	S	C	*	.	S	Bend	trans	-142.3	24.7	-173.5	0	0	0	0	0	114.5	S81 E85	S81-G83 PolarHBondContact OG-N 3.26Å; G83-E85 PolarHBondContact N-OE2 3.34Å
84	G	86.2	Confident	94	Very high	73 Å²	73	40.6 Å²	40.6	75%	0.753	23%	0.233	S	C	*	.	S	Bend	trans	84.2	8.4	-178.2	0	0	0	0	0	114.7	S81	S81-G84 VanDerWaalsContact OG-CA 3.32Å; S81-G84 WeakPolarHBondContact OG-CA 3.4Å; S81-G84 PolarHBondContact OG-N 2.95Å
85	E	89.6	Confident	93.9	Very high	63 Å²	63	40.6 Å²	40.6	29%	0.294	23%	0.233	S	C	.	.	P	Polyproline II helix	trans	-65.4	152.6	174	79.1	-83.2	-160.1	0	0	112.3	K58 S81 Q82 G83 T87	K58-E85 IonicContact NZ-OE1 2.55Å; K58-E85 PolarHBondContact NZ-OE1 2.88Å; S81-E85 WeakPolarHBondContact CA-OE1 3.41Å; S81-E85 WeakPolarHBondContact CA-OE2 3.44Å; S81-E85 WeakPolarHBondContact CB-O 3.31Å; S81-E85 WeakPolarHBondContact CB-OE2 3.28Å; S81-E85 PolarHBondContact OG-N 2.68Å; S81-E85 VanDerWaalsContact OG-N 3.13Å; S81-E85 PolarHBondContact OG-O 3.25Å; S81-E85 PolarHBondContact OG-OE2 3.46Å; Q82-E85 PolarHBondContact N-OE1 2.84Å; Q82-E85 PolarHBondContact N-OE2 2.89Å; G83-E85 PolarHBondContact N-OE2 3.34Å; E85-T87 PolarHBondContact O-N 2.99Å
86	P	91.3	Very high	93.8	Very high	56 Å²	56	42.6 Å²	42.6	36%	0.364	25%	0.254	S	S	.	.	P	Polyproline II helix	trans	-56.3	142	177.2	-24.6	33.5	0	0	0	112.3	Y88 E106	P86-Y88 HydrophobicContact CB-CE1 4.05Å; P86-E106 HydrophobicContact CB-CG 4.44Å
87	T	94.6	Very high	93.7	Very high	53 Å²	53	46.5 Å²	46.5	33%	0.325	27%	0.27	S	S	.	.	P	Polyproline II helix	trans	-103.2	149.6	174.2	61.6	0	0	0	0	110.5	T79 E85	T79-T87 VanDerWaalsContact O-CB 3.26Å; T79-T87 WeakPolarHBondContact O-CB 3.28Å; T79-T87 WeakPolarHBondContact O-CG2 3.45Å; T79-T87 WeakPolarHBondContact OG1-CA 3.47Å; E85-T87 PolarHBondContact O-N 2.99Å
88	Y	96.7	Very high	93.8	Very high	53 Å²	53	46.4 Å²	46.4	21%	0.208	27%	0.27	C	S	.	.			trans	-126.8	140.9	-171.4	-53.2	-64.9	0	0	0	109.9	R78 T79 P86 M103 E106	R78-Y88 WeakPolarHBondContact CA-O 3.33Å; T79-Y88 PolarHBondContact N-O 3.18Å; T79-Y88 PolarHBondContact OG1-N 2.75Å; P86-Y88 HydrophobicContact CB-CE1 4.05Å; Y88-M103 HydrophobicContact CD2-SD 4.07Å; Y88-M103 HydrophobicContact CG-SD 4.28Å; Y88-E106 HydrophobicContact CE1-CB 4.11Å
89	N	97.6	Very high	93.9	Very high	15 Å²	15	41.7 Å²	41.7	8%	0.08	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.4	139.2	171.1	-64.6	-37.8	0	0	0	109.1	R78 G104 V108 G110 L113	R78-N89 VanDerWaalsContact CZ-OD1 3.28Å; R78-N89 PolarHBondContact NE-OD1 3.24Å; R78-N89 PolarHBondContact NH2-ND2 3.38Å; R78-N89 PolarHBondContact NH2-OD1 3.36Å; N89-G104 PolarHBondContact O-N 2.92Å; N89-V108 PolarHBondContact ND2-O 2.64Å; N89-G110 PolarHBondContact ND2-N 3.14Å; N89-L113 HydrophobicContact CB-CD1 3.64Å; N89-L113 WeakPolarHBondContact O-CD1 3.23Å
90	I	97.8	Very high	94	Very high	2 Å²	2	41.8 Å²	41.8	1%	0.01	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	134.3	175.7	-60.8	167.6	0	0	0	106.9	F29 L55 I77 T79 V92 V102 M103	F29-I90 HydrophobicContact CE1-CD1 4.27Å; F29-I90 HydrophobicContact CE1-CG2 4.43Å; F29-I90 HydrophobicContact CZ-CD1 4.32Å; F29-I90 HydrophobicContact CZ-CG1 4.27Å; F29-I90 HydrophobicContact CZ-CG2 3.86Å; L55-I90 HydrophobicContact CD1-CD1 3.9Å; L55-I90 HydrophobicContact CD1-CG2 4.12Å; I77-I90 HydrophobicContact CB-CB 4.06Å; I77-I90 HydrophobicContact CB-CG2 4.45Å; I77-I90 PolarHBondContact N-O 3.14Å; I77-I90 PolarHBondContact O-N 3.05Å; T79-I90 HydrophobicContact CG2-CD1 3.66Å; T79-I90 HydrophobicContact CG2-CG1 4.39Å; I90-V92 HydrophobicContact CG2-CG2 4.31Å; I90-V102 CarbonylContact C-O 3.54Å; I90-V102 VanDerWaalsContact CA-O 3.23Å; I90-V102 WeakPolarHBondContact CA-O 3.35Å; I90-M103 HydrophobicContact CD1-CE 3.82Å; I90-M103 HydrophobicContact CG1-CB 4.15Å; I90-M103 HydrophobicContact CG1-CE 4.05Å; I90-M103 HydrophobicContact CG1-CG 3.87Å
91	S	98	Very high	94.2	Very high	0 Å²	0	38 Å²	38	0%	0	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	138.4	167.3	-63.3	0	0	0	0	109.3	M75 D76 V102 L113 N114	M75-S91 WeakPolarHBondContact O-CA 3.49Å; D76-S91 PolarHBondContact OD1-OG 3.48Å; S91-V102 PolarHBondContact N-O 3.28Å; S91-V102 WeakPolarHBondContact O-CG2 3.48Å; S91-V102 PolarHBondContact O-N 2.76Å; S91-L113 WeakPolarHBondContact OG-CB 3.01Å; S91-N114 VanDerWaalsContact OG-CA 3.31Å; S91-N114 WeakPolarHBondContact OG-CA 3.19Å; S91-N114 PolarHBondContact OG-N 3.38Å; S91-N114 VanDerWaalsContact OG-N 3.07Å
92	V	98	Very high	94.5	Very high	0 Å²	0	36 Å²	36	0%	0	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	129.1	176.2	-175.5	0	0	0	0	107.5	L67 T74 M75 I77 I90 L99 V100 L101	L67-V92 HydrophobicContact CD1-CB 4.47Å; L67-V92 HydrophobicContact CD1-CG1 4.07Å; T74-V92 CarbonylContact C-O 3.54Å; T74-V92 WeakPolarHBondContact CA-O 3.48Å; M75-V92 HydrophobicContact CB-CB 4.37Å; M75-V92 HydrophobicContact CE-CB 4.48Å; M75-V92 HydrophobicContact CE-CG2 4.3Å; M75-V92 PolarHBondContact N-O 2.95Å; M75-V92 PolarHBondContact O-N 2.74Å; I77-V92 HydrophobicContact CD1-CG2 3.63Å; I90-V92 HydrophobicContact CG2-CG2 4.31Å; V92-L99 HydrophobicContact CG1-CB 4.37Å; V92-V100 CarbonylContact C-O 3.48Å; V92-V100 VanDerWaalsContact CA-O 3.28Å; V92-V100 WeakPolarHBondContact CA-O 3.37Å; V92-L101 HydrophobicContact CG1-CG 4.35Å; V92-L101 HydrophobicContact CG2-CD2 4.31Å; V92-L101 HydrophobicContact CG2-CG 4.16Å
93	G	97.8	Very high	95.3	Very high	0 Å²	0	29.1 Å²	29.1	0%	0	19%	0.19	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	134.7	172.5	0	0	0	0	0	110.2	W73 L99 V100	W73-G93 CarbonylContact O-C 3.46Å; W73-G93 WeakPolarHBondContact O-CA 3.3Å; G93-L99 CarbonylContact O-C 3.56Å; G93-L99 WeakPolarHBondContact O-CA 3.48Å; G93-V100 PolarHBondContact N-O 3.44Å; G93-V100 PolarHBondContact O-N 2.83Å
94	R	97.2	Very high	95.9	Very high	65 Å²	65	25.7 Å²	25.7	25%	0.245	15%	0.154	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	120.7	-179.3	177.4	179.6	176.9	-163.8	-0.7	111.3	Y14 L67 W73 L99 R125	Y14-R94 HydrophobicContact CE1-CG 4.14Å; Y14-R94 PolarHBondContact OH-NE 3.2Å; L67-R94 HydrophobicContact CD1-CB 3.69Å; L67-R94 HydrophobicContact CG-CB 3.95Å; L67-R94 WeakPolarHBondContact O-CD 3.48Å; W73-R94 HydrophobicContact CB-CB 4.34Å; W73-R94 PolarHBondContact O-N 2.78Å; R94-L99 HydrophobicContact CB-CD2 3.92Å; R94-L99 HydrophobicContact CG-CD2 3.95Å; R94-R125 VanDerWaalsContact O-CZ 3.25Å; R94-R125 PolarHBondContact O-NE 2.81Å; R94-R125 PolarHBondContact O-NH2 3.17Å
95	A	96.4	Very high	96.3	Very high	0 Å²	0	27 Å²	27	0%	0	14%	0.139	C	C	.	.			trans	-95.7	-168.7	166.5	0	0	0	0	0	111.6	Y14 V98 L124 R125	Y14-A95 WeakPolarHBondContact CE1-O 3.36Å; Y14-A95 PolarHBondContact OH-O 3.06Å; A95-V98 WeakPolarHBondContact CA-O 3.47Å; A95-V98 HydrophobicContact CB-CG2 3.77Å; A95-V98 WeakPolarHBondContact CB-O 3.45Å; A95-V98 PolarHBondContact N-O 2.82Å; A95-L124 HydrophobicContact CB-CB 3.82Å; A95-R125 HydrophobicContact CB-CG 3.95Å
96	G	94.2	Very high	96.4	Very high	42 Å²	42	30.3 Å²	30.3	43%	0.433	16%	0.155	S	C	.	.	S	Bend	trans	-67.6	-35.4	-176.4	0	0	0	0	0	113.9	Y14 Y129	Y14-G96 PolarHBondContact OH-O 3.33Å; Y14-G96 VanDerWaalsContact OH-O 3.05Å; G96-Y129 WeakPolarHBondContact CA-O 3.44Å; G96-Y129 PolarHBondContact N-O 3.13Å; G96-Y129 PolarHBondContact N-OXT 3.2Å
97	K	95.3	Very high	96.3	Very high	103 Å²	103	32.6 Å²	32.6	45%	0.448	18%	0.178	S	C	.	.	S	Bend	trans	-132.4	-18.1	-174.9	-58.1	177.2	-178.7	172.1	0	112.9	G13 Y14 T15 Y129	G13-K97 WeakPolarHBondContact CA-O 3.3Å; Y14-K97 WeakPolarHBondContact CD1-O 3.33Å; Y14-K97 PolarHBondContact N-O 3.35Å; T15-K97 HydrophobicContact CG2-CB 4.49Å; K97-Y129 WeakPolarHBondContact CA-OXT 3.34Å; K97-Y129 VanDerWaalsContact CB-OXT 3.3Å; K97-Y129 WeakPolarHBondContact CB-OXT 3.32Å; K97-Y129 PolarHBondContact N-OXT 2.88Å
98	V	97.6	Very high	96.3	Very high	0 Å²	0	31.4 Å²	31.4	0%	0	17%	0.171	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123	156.1	-178.3	-57.3	0	0	0	0	113.8	I11 V12 Y14 W21 A95 L124 Y129	I11-V98 HydrophobicContact CG2-CB 3.92Å; I11-V98 HydrophobicContact CG2-CG1 4.01Å; I11-V98 HydrophobicContact CG2-CG2 4.17Å; V12-V98 CarbonylContact O-C 3.54Å; V12-V98 VanDerWaalsContact O-CA 3.28Å; V12-V98 WeakPolarHBondContact O-CA 3.4Å; Y14-V98 WeakPolarHBondContact CE1-O 3.36Å; W21-V98 HydrophobicContact CD2-CG1 4.06Å; W21-V98 HydrophobicContact CE3-CG1 3.68Å; W21-V98 HydrophobicContact CH2-CG1 3.45Å; W21-V98 VanDerWaalsContact CH2-CG1 3.45Å; W21-V98 HydrophobicContact CZ2-CG1 3.83Å; W21-V98 HydrophobicContact CZ3-CG1 3.37Å; A95-V98 WeakPolarHBondContact CA-O 3.47Å; A95-V98 HydrophobicContact CB-CG2 3.77Å; A95-V98 WeakPolarHBondContact CB-O 3.45Å; A95-V98 PolarHBondContact N-O 2.82Å; V98-L124 HydrophobicContact CG2-CB 4.46Å; V98-L124 HydrophobicContact CG2-CD1 3.8Å; V98-Y129 PolarHBondContact N-OXT 3.45Å
99	L	98	Very high	96.2	Very high	0 Å²	0	35.1 Å²	35.1	0%	0	19%	0.19	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	136.7	167.6	-56.5	177.2	0	0	0	108.7	I11 V12 Y14 L40 V41 V92 G93 R94 L101	I11-L99 WeakPolarHBondContact CA-O 3.45Å; V12-L99 HydrophobicContact CB-CB 4.43Å; V12-L99 PolarHBondContact N-O 2.97Å; V12-L99 PolarHBondContact O-N 3.35Å; Y14-L99 HydrophobicContact CD1-CD2 3.78Å; Y14-L99 HydrophobicContact CD1-CG 3.76Å; Y14-L99 HydrophobicContact CE1-CD2 4.08Å; Y14-L99 HydrophobicContact CG-CD2 4.32Å; Y14-L99 HydrophobicContact CG-CG 4.2Å; L40-L99 HydrophobicContact CB-CD1 4.26Å; L40-L99 HydrophobicContact CD1-CD1 4.12Å; V41-L99 HydrophobicContact CG1-CD1 3.89Å; V41-L99 HydrophobicContact CG1-CD2 4.15Å; V41-L99 HydrophobicContact CG1-CG 4.45Å; V92-L99 HydrophobicContact CG1-CB 4.37Å; G93-L99 CarbonylContact O-C 3.56Å; G93-L99 WeakPolarHBondContact O-CA 3.48Å; R94-L99 HydrophobicContact CB-CD2 3.92Å; R94-L99 HydrophobicContact CG-CD2 3.95Å; L99-L101 HydrophobicContact CB-CD1 3.9Å
100	V	98	Very high	96	Very high	6 Å²	6	35 Å²	35	4%	0.036	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	116.7	172.1	-176.1	0	0	0	0	107.6	I11 V92 G93 V102 M120 A121 L124	I11-V100 HydrophobicContact CD1-CB 4.43Å; I11-V100 HydrophobicContact CD1-CG1 4.28Å; I11-V100 HydrophobicContact CD1-CG2 3.96Å; V92-V100 CarbonylContact C-O 3.48Å; V92-V100 VanDerWaalsContact CA-O 3.28Å; V92-V100 WeakPolarHBondContact CA-O 3.37Å; G93-V100 PolarHBondContact N-O 3.44Å; G93-V100 PolarHBondContact O-N 2.83Å; V100-V102 HydrophobicContact CG1-CG1 4.23Å; V100-M120 HydrophobicContact CB-CG 4.47Å; V100-M120 HydrophobicContact CG1-CB 4.03Å; V100-M120 HydrophobicContact CG1-CG 3.81Å; V100-M120 HydrophobicContact CG2-CB 4.3Å; V100-M120 HydrophobicContact CG2-CG 3.84Å; V100-A121 HydrophobicContact CG2-CB 4.38Å; V100-L124 HydrophobicContact CG2-CD1 3.52Å
101	L	98.2	Very high	95.8	Very high	0 Å²	0	36.4 Å²	36.4	0%	0	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	134.2	176.3	-64.5	87.7	0	0	0	109.5	S9 A10 V12 F29 I32 L55 V92 L99	S9-L101 CarbonylContact C-O 3.58Å; S9-L101 WeakPolarHBondContact CA-O 3.32Å; A10-L101 PolarHBondContact N-O 3.36Å; A10-L101 PolarHBondContact O-N 2.81Å; V12-L101 HydrophobicContact CB-CD1 4.02Å; V12-L101 HydrophobicContact CG2-CD1 3.6Å; F29-L101 HydrophobicContact CD1-CD2 4.23Å; F29-L101 HydrophobicContact CD2-CB 3.96Å; F29-L101 HydrophobicContact CE1-CB 4.44Å; F29-L101 HydrophobicContact CE1-CD2 4.12Å; F29-L101 HydrophobicContact CE2-CB 3.73Å; F29-L101 HydrophobicContact CG-CB 4.41Å; F29-L101 HydrophobicContact CZ-CB 3.98Å; F29-L101 HydrophobicContact CZ-CD2 4.42Å; I32-L101 HydrophobicContact CD1-CD2 3.59Å; L55-L101 HydrophobicContact CD1-CD2 4.29Å; L55-L101 HydrophobicContact CD2-CD2 4.09Å; V92-L101 HydrophobicContact CG1-CG 4.35Å; V92-L101 HydrophobicContact CG2-CD2 4.31Å; V92-L101 HydrophobicContact CG2-CG 4.16Å; L99-L101 HydrophobicContact CB-CD1 3.9Å
102	V	97.4	Very high	95.6	Very high	2 Å²	2	40.7 Å²	40.7	1%	0.012	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	129	177	-57.4	0	0	0	0	109.9	M1 I90 S91 V100 L113 A117	M1-V102 HydrophobicContact CE-CB 3.61Å; M1-V102 HydrophobicContact CE-CG1 3.28Å; M1-V102 HydrophobicContact SD-CB 4.3Å; M1-V102 HydrophobicContact SD-CG1 3.63Å; I90-V102 CarbonylContact C-O 3.54Å; I90-V102 VanDerWaalsContact CA-O 3.23Å; I90-V102 WeakPolarHBondContact CA-O 3.35Å; S91-V102 PolarHBondContact N-O 3.28Å; S91-V102 WeakPolarHBondContact O-CG2 3.48Å; S91-V102 PolarHBondContact O-N 2.76Å; V100-V102 HydrophobicContact CG1-CG1 4.23Å; V102-L113 HydrophobicContact CG2-CB 4.04Å; V102-L113 HydrophobicContact CG2-CD2 4.4Å; V102-A117 HydrophobicContact CG2-CB 4.01Å
103	M	97.5	Very high	95.5	Very high	6 Å²	6	40.7 Å²	40.7	3%	0.03	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	123.7	174.3	-171	-178.1	-57.2	0	0	109.5	C6 Q7 D8 F29 T79 Y88 I90	C6-M103 CarbonylContact C-O 3.48Å; C6-M103 WeakPolarHBondContact CA-O 3.49Å; C6-M103 WeakPolarHBondContact CB-O 3.3Å; Q7-M103 HydrophobicContact CG-CB 4.26Å; Q7-M103 HydrophobicContact CG-CG 3.99Å; Q7-M103 HydrophobicContact CG-SD 3.99Å; Q7-M103 PolarHBondContact N-O 3.34Å; D8-M103 HydrophobicContact CB-CB 3.9Å; D8-M103 PolarHBondContact N-O 3.03Å; D8-M103 PolarHBondContact O-N 3.38Å; F29-M103 HydrophobicContact CE1-CE 3.84Å; F29-M103 HydrophobicContact CE2-CB 3.92Å; F29-M103 HydrophobicContact CZ-CB 3.84Å; F29-M103 HydrophobicContact CZ-CE 3.83Å; T79-M103 HydrophobicContact CG2-CE 4.41Å; Y88-M103 HydrophobicContact CD2-SD 4.07Å; Y88-M103 HydrophobicContact CG-SD 4.28Å; I90-M103 HydrophobicContact CD1-CE 3.82Å; I90-M103 HydrophobicContact CG1-CB 4.15Å; I90-M103 HydrophobicContact CG1-CE 4.05Å; I90-M103 HydrophobicContact CG1-CG 3.87Å
104	G	96.7	Very high	95.5	Very high	0 Å²	0	41.7 Å²	41.7	0%	0	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	153.3	176.3	0	0	0	0	0	112.1	S5 Q7 N89	S5-G104 WeakPolarHBondContact O-CA 3.43Å; Q7-G104 PolarHBondContact NE2-O 3.46Å; N89-G104 PolarHBondContact O-N 2.92Å
105	K	95.1	Very high	95.4	Very high	101 Å²	101	45.6 Å²	45.6	44%	0.439	25%	0.254	S	S	.	.	P	Polyproline II helix	trans	-62.9	172.4	164.2	-72.2	178.8	-178	170.9	0	111.1	G4 S5 Q7 A107 V108	G4-K105 VanDerWaalsContact O-CD 3.26Å; G4-K105 WeakPolarHBondContact O-CD 3.46Å; G4-K105 WeakPolarHBondContact O-CE 3.45Å; G4-K105 PolarHBondContact O-NZ 2.92Å; S5-K105 PolarHBondContact O-N 3.16Å; Q7-K105 HydrophobicContact CB-CG 3.9Å; K105-A107 PolarHBondContact O-N 3.26Å; K105-V108 HydrophobicContact CB-CG2 3.96Å; K105-V108 WeakPolarHBondContact O-CB 3.12Å; K105-V108 WeakPolarHBondContact O-CG2 3.26Å; K105-V108 PolarHBondContact O-N 2.97Å; K105-V108 VanDerWaalsContact O-N 3.14Å
106	E	90.9	Very high	95.4	Very high	132 Å²	132	48.3 Å²	48.3	62%	0.617	27%	0.266	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.2	141	172.6	-165.1	171.8	-178.7	0	0	111.3	P86 Y88 V108	P86-E106 HydrophobicContact CB-CG 4.44Å; Y88-E106 HydrophobicContact CE1-CB 4.11Å; E106-V108 PolarHBondContact O-N 3.38Å
107	A	88.8	Confident	95.5	Very high	104 Å²	104	46.3 Å²	46.3	86%	0.86	25%	0.245	S	C	*	.	T	Hydrogen-bonded Turn	trans	62.4	1.5	-176.8	0	0	0	0	0	117	K105 H109	K105-A107 PolarHBondContact O-N 3.26Å; A107-H109 PolarHBondContact O-N 3.24Å
108	V	94.9	Very high	95.6	Very high	29 Å²	29	43.7 Å²	43.7	18%	0.176	24%	0.235	C	C	.	.			trans	-73.2	123.1	177.1	177.3	0	0	0	0	110.8	S5 N89 K105 E106 L113	S5-V108 WeakPolarHBondContact O-CG2 3.42Å; N89-V108 PolarHBondContact ND2-O 2.64Å; K105-V108 HydrophobicContact CB-CG2 3.96Å; K105-V108 WeakPolarHBondContact O-CB 3.12Å; K105-V108 WeakPolarHBondContact O-CG2 3.26Å; K105-V108 PolarHBondContact O-N 2.97Å; K105-V108 VanDerWaalsContact O-N 3.14Å; E106-V108 PolarHBondContact O-N 3.38Å; V108-L113 HydrophobicContact CG1-CD1 4.39Å; V108-L113 HydrophobicContact CG1-CD2 3.97Å; V108-L113 HydrophobicContact CG1-CG 4.02Å
109	H	94.2	Very high	95.5	Very high	130 Å²	130	46.2 Å²	46.2	60%	0.602	26%	0.256	S	S	*	.			trans	-69.6	135.9	-176.4	-168.3	73.1	0	0	0	112.7	A107 G111 N112	A107-H109 PolarHBondContact O-N 3.24Å; H109-G111 VanDerWaalsContact C-N 3.34Å; H109-G111 PolarHBondContact CD2-N 2.75Å; H109-G111 VanDerWaalsContact CD2-N 3.32Å; H109-G111 PolarHBondContact O-N 2.8Å; H109-N112 PolarHBondContact O-N 2.91Å; H109-N112 VanDerWaalsContact O-N 3.12Å
110	G	93.9	Very high	95.5	Very high	14 Å²	14	50 Å²	50	14%	0.144	27%	0.274	C	S	.	.	H	α-helix	trans	-58.8	-39.6	-176.2	0	0	0	0	0	113.5	N89 N112 L113 N114	N89-G110 PolarHBondContact ND2-N 3.14Å; G110-N112 PolarHBondContact O-N 3.28Å; G110-N112 VanDerWaalsContact O-N 3.15Å; G110-L113 WeakPolarHBondContact O-CB 3.17Å; G110-L113 PolarHBondContact O-N 3.12Å; G110-N114 WeakPolarHBondContact O-CB 3.46Å; G110-N114 PolarHBondContact O-N 2.63Å
111	G	94.4	Very high	95.4	Very high	30 Å²	30	49.7 Å²	49.7	31%	0.309	27%	0.273	S	S	.	.	H	α-helix	trans	-58.7	-29.6	177.6	0	0	0	0	0	114.3	H109 K115	H109-G111 VanDerWaalsContact C-N 3.34Å; H109-G111 PolarHBondContact CD2-N 2.75Å; H109-G111 VanDerWaalsContact CD2-N 3.32Å; H109-G111 PolarHBondContact O-N 2.8Å; G111-K115 WeakPolarHBondContact O-CG 3.43Å; G111-K115 PolarHBondContact O-N 2.96Å
112	N	94.1	Very high	95.4	Very high	90 Å²	90	53.1 Å²	53.1	48%	0.481	29%	0.288	S	S	.	.	H	α-helix	trans	-75.4	-36.2	176.1	-69.7	-12	0	0	0	111.8	H109 G110 K116	H109-N112 PolarHBondContact O-N 2.91Å; H109-N112 VanDerWaalsContact O-N 3.12Å; G110-N112 PolarHBondContact O-N 3.28Å; G110-N112 VanDerWaalsContact O-N 3.15Å; N112-K116 WeakPolarHBondContact O-CG 3.4Å; N112-K116 PolarHBondContact O-N 3.04Å
113	L	95.7	Very high	95.3	Very high	0 Å²	0	60.1 Å²	60.1	0%	0	32%	0.316	C	S	.	.	H	α-helix	trans	-68.8	-41.4	174.7	-63.4	174.4	0	0	0	111	C6 N89 S91 V102 V108 G110 K115 K116 A117	C6-L113 VanDerWaalsContact SG-CD2 3.56Å; N89-L113 HydrophobicContact CB-CD1 3.64Å; N89-L113 WeakPolarHBondContact O-CD1 3.23Å; S91-L113 WeakPolarHBondContact OG-CB 3.01Å; V102-L113 HydrophobicContact CG2-CB 4.04Å; V102-L113 HydrophobicContact CG2-CD2 4.4Å; V108-L113 HydrophobicContact CG1-CD1 4.39Å; V108-L113 HydrophobicContact CG1-CD2 3.97Å; V108-L113 HydrophobicContact CG1-CG 4.02Å; G110-L113 WeakPolarHBondContact O-CB 3.17Å; G110-L113 PolarHBondContact O-N 3.12Å; L113-K115 PolarHBondContact O-N 3.34Å; L113-K116 WeakPolarHBondContact O-CB 3.36Å; L113-K116 PolarHBondContact O-N 2.82Å; L113-K116 VanDerWaalsContact O-N 3.08Å; L113-A117 PolarHBondContact O-N 3.17Å
114	N	96.9	Very high	95.3	Very high	21 Å²	21	61 Å²	61	11%	0.112	32%	0.321	C	S	.	.	H	α-helix	trans	-58.4	-49.9	179.8	-173.2	-90.5	0	0	0	111.4	R64 T74 D76 S91 G110 K116 A117 H118	R64-N114 VanDerWaalsContact NH2-CG 3.31Å; R64-N114 PolarHBondContact NH2-ND2 3.22Å; R64-N114 PolarHBondContact NH2-OD1 3.09Å; T74-N114 VanDerWaalsContact CB-ND2 3.27Å; T74-N114 WeakPolarHBondContact CB-ND2 3.28Å; T74-N114 PolarHBondContact OG1-ND2 2.86Å; D76-N114 VanDerWaalsContact CG-ND2 3.34Å; D76-N114 WeakPolarHBondContact OD1-CB 3.39Å; D76-N114 PolarHBondContact OD1-ND2 3.3Å; D76-N114 PolarHBondContact OD2-ND2 3.24Å; S91-N114 VanDerWaalsContact OG-CA 3.31Å; S91-N114 WeakPolarHBondContact OG-CA 3.19Å; S91-N114 PolarHBondContact OG-N 3.38Å; S91-N114 VanDerWaalsContact OG-N 3.07Å; G110-N114 WeakPolarHBondContact O-CB 3.46Å; G110-N114 PolarHBondContact O-N 2.63Å; N114-K116 PolarHBondContact O-N 3.28Å; N114-A117 PolarHBondContact O-N 3.29Å; N114-A117 VanDerWaalsContact O-N 3.14Å; N114-H118 WeakPolarHBondContact O-CB 3.33Å; N114-H118 PolarHBondContact O-N 3.32Å
115	K	95.8	Very high	95.2	Very high	147 Å²	147	64.4 Å²	64.4	64%	0.639	33%	0.333	S	S	*	.	H	α-helix	trans	-55.5	-38.3	175.1	-71.5	175.7	-175.6	-177.6	0	112.8	G111 L113 A119	G111-K115 WeakPolarHBondContact O-CG 3.43Å; G111-K115 PolarHBondContact O-N 2.96Å; L113-K115 PolarHBondContact O-N 3.34Å; K115-A119 VanDerWaalsContact O-CB 3.32Å; K115-A119 WeakPolarHBondContact O-CB 3.32Å; K115-A119 PolarHBondContact O-N 3.48Å
116	K	95.4	Very high	95.2	Very high	57 Å²	57	66.8 Å²	66.8	25%	0.248	34%	0.344	C	S	.	.	H	α-helix	trans	-69.7	-44.6	177.7	-69.1	165.8	-177.4	-76.8	0	112	D3 S5 N112 L113 N114 M120	D3-K116 IonicContact OD1-NZ 3.88Å; D3-K116 PolarHBondContact OD1-NZ 3.47Å; D3-K116 IonicContact OD2-NZ 2.7Å; D3-K116 PolarHBondContact OD2-NZ 3.21Å; S5-K116 VanDerWaalsContact OG-CE 3.29Å; S5-K116 WeakPolarHBondContact OG-CE 3.43Å; N112-K116 WeakPolarHBondContact O-CG 3.4Å; N112-K116 PolarHBondContact O-N 3.04Å; L113-K116 WeakPolarHBondContact O-CB 3.36Å; L113-K116 PolarHBondContact O-N 2.82Å; L113-K116 VanDerWaalsContact O-N 3.08Å; N114-K116 PolarHBondContact O-N 3.28Å; K116-M120 WeakPolarHBondContact O-CB 3.18Å; K116-M120 PolarHBondContact O-N 3Å; K116-M120 VanDerWaalsContact O-N 3.1Å
117	A	96.9	Very high	95.5	Very high	0 Å²	0	63.1 Å²	63.1	0%	0	33%	0.332	C	S	.	.	H	α-helix	trans	-64	-44.6	178.1	0	0	0	0	0	111.1	V102 L113 N114 M120 A121	V102-A117 HydrophobicContact CG2-CB 4.01Å; L113-A117 PolarHBondContact O-N 3.17Å; N114-A117 PolarHBondContact O-N 3.29Å; N114-A117 VanDerWaalsContact O-N 3.14Å; A117-M120 PolarHBondContact O-N 2.73Å; A117-A121 VanDerWaalsContact O-CB 3.3Å; A117-A121 WeakPolarHBondContact O-CB 3.27Å; A117-A121 PolarHBondContact O-N 2.88Å
118	H	97.1	Very high	95.7	Very high	48 Å²	48	60.7 Å²	60.7	22%	0.222	32%	0.317	C	S	.	.	H	α-helix	trans	-57.4	-55.8	175.4	-175.8	-77.8	0	0	0	111.6	G71 D72 T74 N114 M120 A121 E122	G71-H118 PolarHBondContact O-NE2 2.94Å; D72-H118 PolarHBondContact O-CD2 2.86Å; D72-H118 PolarHBondContact O-NE2 3.27Å; T74-H118 HydrophobicContact CG2-CB 3.69Å; N114-H118 WeakPolarHBondContact O-CB 3.33Å; N114-H118 PolarHBondContact O-N 3.32Å; H118-M120 VanDerWaalsContact C-N 3.29Å; H118-M120 PolarHBondContact O-N 3.02Å; H118-A121 PolarHBondContact O-N 3.13Å; H118-A121 VanDerWaalsContact O-N 3.12Å; H118-E122 WeakPolarHBondContact O-CB 3.47Å; H118-E122 PolarHBondContact O-N 3.18Å
119	A	96.6	Very high	95.5	Very high	53 Å²	53	64.9 Å²	64.9	44%	0.438	33%	0.331	S	S	.	.	H	α-helix	trans	-59.9	-38.9	-178	0	0	0	0	0	112.5	K115 Y123	K115-A119 VanDerWaalsContact O-CB 3.32Å; K115-A119 WeakPolarHBondContact O-CB 3.32Å; K115-A119 PolarHBondContact O-N 3.48Å; A119-Y123 WeakPolarHBondContact O-CB 3.4Å; A119-Y123 PolarHBondContact O-N 2.58Å
120	M	96.8	Very high	95.6	Very high	79 Å²	79	61.6 Å²	61.6	39%	0.389	32%	0.317	S	S	.	.	H	α-helix	trans	-70.1	-41.4	176.4	-175.2	57.5	64.6	0	0	112.1	V100 K116 A117 H118 E122 Y123 L124	V100-M120 HydrophobicContact CB-CG 4.47Å; V100-M120 HydrophobicContact CG1-CB 4.03Å; V100-M120 HydrophobicContact CG1-CG 3.81Å; V100-M120 HydrophobicContact CG2-CB 4.3Å; V100-M120 HydrophobicContact CG2-CG 3.84Å; K116-M120 WeakPolarHBondContact O-CB 3.18Å; K116-M120 PolarHBondContact O-N 3Å; K116-M120 VanDerWaalsContact O-N 3.1Å; A117-M120 PolarHBondContact O-N 2.73Å; H118-M120 VanDerWaalsContact C-N 3.29Å; H118-M120 PolarHBondContact O-N 3.02Å; M120-E122 VanDerWaalsContact C-N 3.34Å; M120-Y123 PolarHBondContact O-N 3.28Å; M120-Y123 HydrophobicContact SD-CD1 4.16Å; M120-L124 HydrophobicContact CG-CD1 4.11Å; M120-L124 VanDerWaalsContact O-CG 3.31Å; M120-L124 WeakPolarHBondContact O-CG 3.34Å; M120-L124 PolarHBondContact O-N 2.82Å; M120-L124 HydrophobicContact SD-CD1 4.41Å; M120-L124 HydrophobicContact SD-CG 4.41Å
121	A	96.7	Very high	95.6	Very high	1 Å²	1	64.1 Å²	64.1	1%	0.008	33%	0.327	C	S	.	.	H	α-helix	trans	-63.1	-41.6	175.9	0	0	0	0	0	111.4	V100 A117 H118 L124 R125	V100-A121 HydrophobicContact CG2-CB 4.38Å; A117-A121 VanDerWaalsContact O-CB 3.3Å; A117-A121 WeakPolarHBondContact O-CB 3.27Å; A117-A121 PolarHBondContact O-N 2.88Å; H118-A121 PolarHBondContact O-N 3.13Å; H118-A121 VanDerWaalsContact O-N 3.12Å; A121-L124 PolarHBondContact O-N 3.13Å; A121-R125 VanDerWaalsContact O-CG 3.29Å; A121-R125 WeakPolarHBondContact O-CG 3.32Å; A121-R125 PolarHBondContact O-N 3.48Å
122	E	96.7	Very high	95.7	Very high	71 Å²	71	66 Å²	66	33%	0.332	33%	0.327	S	S	.	.	H	α-helix	trans	-61.8	-45.2	175.4	-166.7	-165.1	-166	0	0	111.6	H118 M120 L124 R125 K126	H118-E122 WeakPolarHBondContact O-CB 3.47Å; H118-E122 PolarHBondContact O-N 3.18Å; M120-E122 VanDerWaalsContact C-N 3.34Å; E122-L124 PolarHBondContact O-N 2.88Å; E122-R125 PolarHBondContact O-N 3.44Å; E122-K126 HydrophobicContact CG-CD 4.41Å; E122-K126 WeakPolarHBondContact O-CG 3.18Å; E122-K126 PolarHBondContact O-N 2.94Å; E122-K126 VanDerWaalsContact OE1-CE 3.3Å; E122-K126 WeakPolarHBondContact OE1-CE 3.26Å; E122-K126 IonicContact OE1-NZ 3.38Å; E122-K126 PolarHBondContact OE1-NZ 3.11Å; E122-K126 IonicContact OE2-NZ 2.71Å; E122-K126 PolarHBondContact OE2-NZ 3.13Å
123	Y	97.1	Very high	95.8	Very high	150 Å²	150	64.6 Å²	64.6	59%	0.588	32%	0.318	S	S	*	.	H	α-helix	trans	-58.3	-46	175.2	171.1	-98.1	0	0	0	112.1	A119 M120 K126 S127	A119-Y123 WeakPolarHBondContact O-CB 3.4Å; A119-Y123 PolarHBondContact O-N 2.58Å; M120-Y123 PolarHBondContact O-N 3.28Å; M120-Y123 HydrophobicContact SD-CD1 4.16Å; Y123-K126 PolarHBondContact O-N 3.34Å; Y123-S127 WeakPolarHBondContact O-CB 3.28Å; Y123-S127 PolarHBondContact O-N 2.8Å; Y123-S127 PolarHBondContact O-OG 2.92Å
124	L	96.6	Very high	95.8	Very high	24 Å²	24	68.6 Å²	68.6	13%	0.126	34%	0.338	C	S	.	.	H	α-helix	trans	-65.1	-41.2	179.7	-71	168.6	0	0	0	111.7	I11 A95 V98 V100 M120 A121 E122 K126 S127 G128 Y129	I11-L124 HydrophobicContact CD1-CD1 4.13Å; A95-L124 HydrophobicContact CB-CB 3.82Å; V98-L124 HydrophobicContact CG2-CB 4.46Å; V98-L124 HydrophobicContact CG2-CD1 3.8Å; V100-L124 HydrophobicContact CG2-CD1 3.52Å; M120-L124 HydrophobicContact CG-CD1 4.11Å; M120-L124 VanDerWaalsContact O-CG 3.31Å; M120-L124 WeakPolarHBondContact O-CG 3.34Å; M120-L124 PolarHBondContact O-N 2.82Å; M120-L124 HydrophobicContact SD-CD1 4.41Å; M120-L124 HydrophobicContact SD-CG 4.41Å; A121-L124 PolarHBondContact O-N 3.13Å; E122-L124 PolarHBondContact O-N 2.88Å; L124-K126 PolarHBondContact O-N 3.4Å; L124-S127 CarbonylContact O-C 3.43Å; L124-S127 WeakPolarHBondContact O-CA 3.46Å; L124-S127 WeakPolarHBondContact O-CB 3.16Å; L124-S127 PolarHBondContact O-N 2.78Å; L124-G128 PolarHBondContact O-N 3.17Å; L124-G128 VanDerWaalsContact O-N 3.16Å; L124-Y129 CarbonylContact C-O 3.57Å; L124-Y129 PolarHBondContact O-N 3.34Å
125	R	94.9	Very high	95.7	Very high	72 Å²	72	71.8 Å²	71.8	27%	0.272	35%	0.353	S	S	.	.	H	α-helix	trans	-57.1	-49.8	173.1	-74.2	171.2	173.6	-122.4	-2.8	112.1	W73 R94 A95 A121 E122 S127 G128 Y129	W73-R125 VanDerWaalsContact CD1-CZ 3.49Å; W73-R125 VanDerWaalsContact CD2-NH1 3.32Å; W73-R125 VanDerWaalsContact CE2-CZ 3.4Å; W73-R125 VanDerWaalsContact CZ2-NH1 3.27Å; R94-R125 VanDerWaalsContact O-CZ 3.25Å; R94-R125 PolarHBondContact O-NE 2.81Å; R94-R125 PolarHBondContact O-NH2 3.17Å; A95-R125 HydrophobicContact CB-CG 3.95Å; A121-R125 VanDerWaalsContact O-CG 3.29Å; A121-R125 WeakPolarHBondContact O-CG 3.32Å; A121-R125 PolarHBondContact O-N 3.48Å; E122-R125 PolarHBondContact O-N 3.44Å; R125-S127 PolarHBondContact O-N 2.6Å; R125-G128 PolarHBondContact O-N 3Å; R125-Y129 WeakPolarHBondContact CA-O 3.09Å
126	K	95.8	Very high	95.7	Very high	151 Å²	151	66.4 Å²	66.4	66%	0.657	33%	0.333	S	S	*	.	H	α-helix	trans	-61.4	-26.2	177.5	-71.1	173.5	-176.4	166.4	0	112.1	E122 Y123 L124	E122-K126 HydrophobicContact CG-CD 4.41Å; E122-K126 WeakPolarHBondContact O-CG 3.18Å; E122-K126 PolarHBondContact O-N 2.94Å; E122-K126 VanDerWaalsContact OE1-CE 3.3Å; E122-K126 WeakPolarHBondContact OE1-CE 3.26Å; E122-K126 IonicContact OE1-NZ 3.38Å; E122-K126 PolarHBondContact OE1-NZ 3.11Å; E122-K126 IonicContact OE2-NZ 2.71Å; E122-K126 PolarHBondContact OE2-NZ 3.13Å; Y123-K126 PolarHBondContact O-N 3.34Å; L124-K126 PolarHBondContact O-N 3.4Å
127	S	95.9	Very high	95.8	Very high	54 Å²	54	67.2 Å²	67.2	38%	0.378	34%	0.34	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.2	1.6	177.7	-53	0	0	0	0	113.9	Y123 L124 R125 Y129	Y123-S127 WeakPolarHBondContact O-CB 3.28Å; Y123-S127 PolarHBondContact O-N 2.8Å; Y123-S127 PolarHBondContact O-OG 2.92Å; L124-S127 CarbonylContact O-C 3.43Å; L124-S127 WeakPolarHBondContact O-CA 3.46Å; L124-S127 WeakPolarHBondContact O-CB 3.16Å; L124-S127 PolarHBondContact O-N 2.78Å; R125-S127 PolarHBondContact O-N 2.6Å; S127-Y129 WeakPolarHBondContact O-CD2 3.4Å
128	G	93.4	Very high	95.7	Very high	53 Å²	53	72.8 Å²	72.8	55%	0.546	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	85.4	15.8	178.8	0	0	0	0	0	115.4	L124 R125	L124-G128 PolarHBondContact O-N 3.17Å; L124-G128 VanDerWaalsContact O-N 3.16Å; R125-G128 PolarHBondContact O-N 3Å
129	Y	90.3	Very high	95.5	Very high	117 Å²	117	75 Å²	75	46%	0.459	38%	0.381	S	S	.	.			trans	-109.2	0	178.1	-69.7	-86.8	0	0	0	113.2	W21 G96 K97 V98 L124 R125 S127	W21-Y129 HydrophobicContact CH2-CD1 4.19Å; W21-Y129 HydrophobicContact CH2-CE1 4.49Å; W21-Y129 AromaticContact CZ3-CD1 3.8Å; W21-Y129 HydrophobicContact CZ3-CD1 3.8Å; W21-Y129 AromaticContact CZ3-CE1 3.99Å; W21-Y129 HydrophobicContact CZ3-CE1 3.99Å; G96-Y129 WeakPolarHBondContact CA-O 3.44Å; G96-Y129 PolarHBondContact N-O 3.13Å; G96-Y129 PolarHBondContact N-OXT 3.2Å; K97-Y129 WeakPolarHBondContact CA-OXT 3.34Å; K97-Y129 VanDerWaalsContact CB-OXT 3.3Å; K97-Y129 WeakPolarHBondContact CB-OXT 3.32Å; K97-Y129 PolarHBondContact N-OXT 2.88Å; V98-Y129 PolarHBondContact N-OXT 3.45Å; L124-Y129 CarbonylContact C-O 3.57Å; L124-Y129 PolarHBondContact O-N 3.34Å; R125-Y129 WeakPolarHBondContact CA-O 3.09Å; S127-Y129 WeakPolarHBondContact O-CD2 3.4Å

Retrieved 129 of 129 residues in 61.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).