A0A3B3VRZ7_9TELE Loading...

ATP synthase subunit g

AlphaFold DB , UniProt , Accession A0A3B3VRZ7, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 103 aa.

						>A0A3B3VRZ7_9TELE|A0A3B3VRZ7
MAQKVQKLVAKVPTLLGAAVTYSKPRLATFWYYARVELVPPSPSEIPTAIEAAKGLVRSYQTGRFGQTTVKEAFRNGLVATEVLMWFFIGECIGKGGLIGYNV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.7	Low	78.3	Confident	194 Å²	194	123.8 Å²	123.8	96%	0.956	65%	0.646	S	S	*	*				0	-49.5	0	-69.3	-63.7	-92.1	0	0	112.4	Q3 K4 V5	M1-Q3 PolarHBondContact O-N 3.1Å; M1-K4 PolarHBondContact O-N 3.42Å; M1-V5 PolarHBondContact O-N 3.32Å
2	A	72.1	Confident	79.3	Confident	74 Å²	74	119.3 Å²	119.3	61%	0.612	63%	0.628	S	S	*	*	H	α-helix	trans	-54.8	-45.5	-177.6	0	0	0	0	0	115.9	K4 V5 Q6	A2-K4 PolarHBondContact O-N 3.28Å; A2-V5 PolarHBondContact O-N 3.27Å; A2-Q6 PolarHBondContact O-N 3.17Å
3	Q	73.6	Confident	80.2	Confident	145 Å²	145	116.9 Å²	116.9	68%	0.678	62%	0.623	S	S	*	*	H	α-helix	trans	-67.4	-31.5	179.3	-76.7	-169.2	-16.9	0	0	114.2	M1 K7	M1-Q3 PolarHBondContact O-N 3.1Å; Q3-K7 WeakPolarHBondContact O-CB 3.4Å; Q3-K7 WeakPolarHBondContact O-CG 3.39Å; Q3-K7 PolarHBondContact O-N 2.88Å
4	K	75.1	Confident	81.1	Confident	169 Å²	169	115.4 Å²	115.4	74%	0.735	62%	0.62	S	S	*	*	H	α-helix	trans	-70	-38.7	175.6	-72.5	-174.1	177.2	-177.2	0	110.7	M1 A2 K7 L8	M1-K4 PolarHBondContact O-N 3.42Å; A2-K4 PolarHBondContact O-N 3.28Å; K4-K7 PolarHBondContact O-N 3.43Å; K4-L8 PolarHBondContact O-N 3.14Å
5	V	80.5	Confident	81.8	Confident	84 Å²	84	115.5 Å²	115.5	51%	0.509	62%	0.62	S	S	.	*	H	α-helix	trans	-65.7	-45.6	173.4	176.9	0	0	0	0	110.8	M1 A2 K7 L8 V9	M1-V5 PolarHBondContact O-N 3.32Å; A2-V5 PolarHBondContact O-N 3.27Å; V5-K7 VanDerWaalsContact C-N 3.34Å; V5-K7 PolarHBondContact O-N 3.47Å; V5-L8 WeakPolarHBondContact O-CB 3.46Å; V5-L8 PolarHBondContact O-N 3.13Å; V5-V9 HydrophobicContact CG1-CG2 4.26Å; V5-V9 WeakPolarHBondContact O-CG2 3.29Å; V5-V9 PolarHBondContact O-N 3.16Å
6	Q	78.7	Confident	82.5	Confident	133 Å²	133	115 Å²	115	62%	0.621	62%	0.617	S	S	*	*	H	α-helix	trans	-58.9	-42.1	175.3	-80.4	174.6	-31.6	0	0	112.8	A2 L8 V9 A10	A2-Q6 PolarHBondContact O-N 3.17Å; Q6-L8 VanDerWaalsContact C-N 3.3Å; Q6-L8 PolarHBondContact O-N 3.04Å; Q6-V9 PolarHBondContact O-N 3.28Å; Q6-A10 WeakPolarHBondContact O-CB 3.35Å; Q6-A10 PolarHBondContact O-N 3.2Å
7	K	81.6	Confident	83.1	Confident	147 Å²	147	110.4 Å²	110.4	64%	0.639	60%	0.602	S	S	*	*	H	α-helix	trans	-65.5	-31.2	174.6	-74.7	-179.7	-178.3	-175.5	0	113	Q3 K4 V5 K11	Q3-K7 WeakPolarHBondContact O-CB 3.4Å; Q3-K7 WeakPolarHBondContact O-CG 3.39Å; Q3-K7 PolarHBondContact O-N 2.88Å; K4-K7 PolarHBondContact O-N 3.43Å; V5-K7 VanDerWaalsContact C-N 3.34Å; V5-K7 PolarHBondContact O-N 3.47Å; K7-K11 WeakPolarHBondContact O-CG 3.48Å
8	L	81.3	Confident	83.7	Confident	118 Å²	118	107.4 Å²	107.4	62%	0.618	60%	0.595	S	S	*	*	H	α-helix	trans	-73.9	-45.4	176.1	-165.3	73.7	0	0	0	111.1	K4 V5 Q6 A10 K11 V12	K4-L8 PolarHBondContact O-N 3.14Å; V5-L8 WeakPolarHBondContact O-CB 3.46Å; V5-L8 PolarHBondContact O-N 3.13Å; Q6-L8 VanDerWaalsContact C-N 3.3Å; Q6-L8 PolarHBondContact O-N 3.04Å; L8-A10 VanDerWaalsContact C-N 3.28Å; L8-A10 PolarHBondContact O-N 3.3Å; L8-K11 WeakPolarHBondContact O-CB 3.33Å; L8-K11 PolarHBondContact O-N 2.95Å; L8-V12 PolarHBondContact O-N 3.06Å
9	V	84.3	Confident	84.3	Confident	93 Å²	93	104.4 Å²	104.4	56%	0.564	59%	0.586	S	S	*	*	H	α-helix	trans	-58.6	-41.2	174.8	173.4	0	0	0	0	110.7	V5 Q6 K11 V12 P13	V5-V9 HydrophobicContact CG1-CG2 4.26Å; V5-V9 WeakPolarHBondContact O-CG2 3.29Å; V5-V9 PolarHBondContact O-N 3.16Å; Q6-V9 PolarHBondContact O-N 3.28Å; V9-K11 PolarHBondContact O-N 3.06Å; V9-K11 VanDerWaalsContact O-N 3.17Å; V9-V12 WeakPolarHBondContact O-CB 3.46Å; V9-V12 PolarHBondContact O-N 2.95Å; V9-P13 WeakPolarHBondContact O-CD 3.48Å
10	A	85.3	Confident	84.8	Confident	73 Å²	73	103.9 Å²	103.9	60%	0.603	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	-20.6	175.8	0	0	0	0	0	114	Q6 L8	Q6-A10 WeakPolarHBondContact O-CB 3.35Å; Q6-A10 PolarHBondContact O-N 3.2Å; L8-A10 VanDerWaalsContact C-N 3.28Å; L8-A10 PolarHBondContact O-N 3.3Å
11	K	89.4	Confident	85.4	Confident	132 Å²	132	104.1 Å²	104.1	57%	0.574	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.3	-7.8	175.6	-69.3	-176.2	177.9	-168.1	0	113.6	K7 L8 V9 T14 L15	K7-K11 WeakPolarHBondContact O-CG 3.48Å; L8-K11 WeakPolarHBondContact O-CB 3.33Å; L8-K11 PolarHBondContact O-N 2.95Å; V9-K11 PolarHBondContact O-N 3.06Å; V9-K11 VanDerWaalsContact O-N 3.17Å; K11-T14 PolarHBondContact O-N 3.23Å; K11-T14 PolarHBondContact O-OG1 3.24Å; K11-L15 WeakPolarHBondContact O-CG 3.49Å; K11-L15 PolarHBondContact O-N 3.28Å; K11-L15 VanDerWaalsContact O-N 3.08Å
12	V	90.3	Very high	87	Confident	70 Å²	70	101.4 Å²	101.4	42%	0.424	57%	0.569	S	S	.	*	H	α-helix	trans	-59.8	-45.4	177.3	173.5	0	0	0	0	111.7	L8 V9 T14 L15 L16	L8-V12 PolarHBondContact O-N 3.06Å; V9-V12 WeakPolarHBondContact O-CB 3.46Å; V9-V12 PolarHBondContact O-N 2.95Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 2.99Å; V12-L15 PolarHBondContact O-N 3.43Å; V12-L16 HydrophobicContact CG1-CD1 3.86Å; V12-L16 HydrophobicContact CG1-CG 4.24Å; V12-L16 WeakPolarHBondContact O-CG 3.44Å; V12-L16 PolarHBondContact O-N 3.15Å
13	P	91.4	Very high	88.2	Confident	88 Å²	88	100.2 Å²	100.2	57%	0.571	56%	0.556	S	S	*	*	H	α-helix	trans	-61.7	-36.8	178.9	-24.2	35.1	0	0	0	113.3	V9 L16 G17	V9-P13 WeakPolarHBondContact O-CD 3.48Å; P13-L16 PolarHBondContact O-N 2.82Å; P13-G17 PolarHBondContact O-N 2.89Å
14	T	91.8	Very high	89.3	Confident	95 Å²	95	100.4 Å²	100.4	58%	0.583	56%	0.555	S	S	*	*	H	α-helix	trans	-71	-38.6	179	57.9	0	0	0	0	111.7	K11 V12 G17 A18	K11-T14 PolarHBondContact O-N 3.23Å; K11-T14 PolarHBondContact O-OG1 3.24Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 2.99Å; T14-G17 PolarHBondContact O-N 3.44Å; T14-A18 WeakPolarHBondContact O-CB 3.31Å; T14-A18 PolarHBondContact O-N 3.49Å
15	L	92.5	Very high	90.3	Very high	117 Å²	117	95.8 Å²	95.8	61%	0.613	54%	0.542	S	S	*	.	H	α-helix	trans	-65.9	-41.1	174	-69.7	174.2	0	0	0	112.2	K11 V12 A18 A19	K11-L15 WeakPolarHBondContact O-CG 3.49Å; K11-L15 PolarHBondContact O-N 3.28Å; K11-L15 VanDerWaalsContact O-N 3.08Å; V12-L15 PolarHBondContact O-N 3.43Å; L15-A18 PolarHBondContact O-N 2.93Å; L15-A19 WeakPolarHBondContact O-CB 3.46Å; L15-A19 PolarHBondContact O-N 2.95Å
16	L	92.8	Very high	91	Very high	108 Å²	108	97.8 Å²	97.8	57%	0.565	54%	0.54	S	S	*	.	H	α-helix	trans	-62.8	-44.9	174.1	-70.4	172.9	0	0	0	111.4	V12 P13 A18 A19 V20	V12-L16 HydrophobicContact CG1-CD1 3.86Å; V12-L16 HydrophobicContact CG1-CG 4.24Å; V12-L16 WeakPolarHBondContact O-CG 3.44Å; V12-L16 PolarHBondContact O-N 3.15Å; P13-L16 PolarHBondContact O-N 2.82Å; L16-A18 VanDerWaalsContact C-N 3.33Å; L16-A18 PolarHBondContact O-N 3.32Å; L16-A19 PolarHBondContact O-N 2.91Å; L16-V20 WeakPolarHBondContact O-CG2 3.47Å; L16-V20 PolarHBondContact O-N 3.4Å
17	G	93.3	Very high	91.8	Very high	36 Å²	36	96.7 Å²	96.7	37%	0.371	54%	0.538	S	S	.	.	H	α-helix	trans	-59.9	-41.8	175.5	0	0	0	0	0	112.6	P13 T14 V20 T21	P13-G17 PolarHBondContact O-N 2.89Å; T14-G17 PolarHBondContact O-N 3.44Å; G17-V20 PolarHBondContact O-N 2.91Å; G17-T21 WeakPolarHBondContact O-CB 3.42Å; G17-T21 PolarHBondContact O-N 3.47Å; G17-T21 PolarHBondContact O-OG1 3.01Å
18	A	94	Very high	92.5	Very high	58 Å²	58	92.5 Å²	92.5	48%	0.479	53%	0.531	S	S	.	.	H	α-helix	trans	-64.1	-44.2	174.3	0	0	0	0	0	112	T14 L15 L16 V20 T21 Y22	T14-A18 WeakPolarHBondContact O-CB 3.31Å; T14-A18 PolarHBondContact O-N 3.49Å; L15-A18 PolarHBondContact O-N 2.93Å; L16-A18 VanDerWaalsContact C-N 3.33Å; L16-A18 PolarHBondContact O-N 3.32Å; A18-V20 PolarHBondContact O-N 3.42Å; A18-T21 PolarHBondContact O-N 3.41Å; A18-Y22 WeakPolarHBondContact O-CB 3.45Å; A18-Y22 PolarHBondContact O-N 3.44Å
19	A	94.6	Very high	93.2	Very high	50 Å²	50	90.7 Å²	90.7	41%	0.413	53%	0.525	S	S	.	.	H	α-helix	trans	-62	-42.9	177.4	0	0	0	0	0	111.9	L15 L16 Y22 S23	L15-A19 WeakPolarHBondContact O-CB 3.46Å; L15-A19 PolarHBondContact O-N 2.95Å; L16-A19 PolarHBondContact O-N 2.91Å; A19-Y22 PolarHBondContact O-N 3.44Å; A19-S23 VanDerWaalsContact O-CB 3.26Å; A19-S23 WeakPolarHBondContact O-CB 3.46Å; A19-S23 PolarHBondContact O-N 2.99Å; A19-S23 PolarHBondContact O-OG 2.78Å
20	V	94.8	Very high	93.8	Very high	94 Å²	94	92.1 Å²	92.1	57%	0.57	52%	0.524	S	S	*	.	H	α-helix	trans	-63.5	-46.2	175.9	171.5	0	0	0	0	110.8	L16 G17 A18 Y22 S23 K24	L16-V20 WeakPolarHBondContact O-CG2 3.47Å; L16-V20 PolarHBondContact O-N 3.4Å; G17-V20 PolarHBondContact O-N 2.91Å; A18-V20 PolarHBondContact O-N 3.42Å; V20-Y22 VanDerWaalsContact C-N 3.27Å; V20-Y22 PolarHBondContact O-N 3.22Å; V20-S23 PolarHBondContact O-N 3.17Å; V20-K24 WeakPolarHBondContact O-CB 3.4Å; V20-K24 PolarHBondContact O-N 3.49Å
21	T	95.8	Very high	94.3	Very high	108 Å²	108	95.5 Å²	95.5	66%	0.663	52%	0.521	S	S	*	.	H	α-helix	trans	-61.9	-37.3	-180	-56	0	0	0	0	111.5	G17 A18 P25	G17-T21 WeakPolarHBondContact O-CB 3.42Å; G17-T21 PolarHBondContact O-N 3.47Å; G17-T21 PolarHBondContact O-OG1 3.01Å; A18-T21 PolarHBondContact O-N 3.41Å; T21-P25 WeakPolarHBondContact O-CD 3.49Å
22	Y	95.1	Very high	94.6	Very high	137 Å²	137	96.8 Å²	96.8	54%	0.537	52%	0.523	S	S	.	.	H	α-helix	trans	-72.5	-44.3	176.8	-180	-93.1	0	0	0	113.1	A18 A19 V20 R26	A18-Y22 WeakPolarHBondContact O-CB 3.45Å; A18-Y22 PolarHBondContact O-N 3.44Å; A19-Y22 PolarHBondContact O-N 3.44Å; V20-Y22 VanDerWaalsContact C-N 3.27Å; V20-Y22 PolarHBondContact O-N 3.22Å; Y22-R26 VanDerWaalsContact CD2-NH1 3.28Å; Y22-R26 PolarHBondContact O-NH1 3.35Å; Y22-R26 PolarHBondContact OH-NE 3.01Å; Y22-R26 PolarHBondContact OH-NH2 3.29Å
23	S	96.2	Very high	94.9	Very high	49 Å²	49	99.1 Å²	99.1	34%	0.343	53%	0.525	S	S	.	.	H	α-helix	trans	-80.5	-34.4	-172.4	-63.1	0	0	0	0	113	A19 V20 R26 L27	A19-S23 VanDerWaalsContact O-CB 3.26Å; A19-S23 WeakPolarHBondContact O-CB 3.46Å; A19-S23 PolarHBondContact O-N 2.99Å; A19-S23 PolarHBondContact O-OG 2.78Å; V20-S23 PolarHBondContact O-N 3.17Å; S23-R26 PolarHBondContact O-N 2.91Å; S23-R26 VanDerWaalsContact O-N 3.16Å; S23-L27 WeakPolarHBondContact O-CG 3.48Å; S23-L27 PolarHBondContact O-N 3.46Å
24	K	96.4	Very high	94.9	Very high	150 Å²	150	95.6 Å²	95.6	65%	0.652	50%	0.504	S	S	*	.	H	α-helix	trans	-54.1	-51.7	-176.1	-172.7	174	-176.4	178.2	0	114.3	V20 R26 L27 A28	V20-K24 WeakPolarHBondContact O-CB 3.4Å; V20-K24 PolarHBondContact O-N 3.49Å; K24-R26 VanDerWaalsContact C-N 3.32Å; K24-R26 PolarHBondContact O-N 3.4Å; K24-L27 PolarHBondContact O-N 3.19Å; K24-A28 WeakPolarHBondContact O-CB 3.4Å; K24-A28 PolarHBondContact O-N 3.19Å
25	P	96.8	Very high	95	Very high	71 Å²	71	98.9 Å²	98.9	46%	0.461	51%	0.505	S	S	.	.	H	α-helix	trans	-65.6	-34.5	179.2	25.2	-34	0	0	0	112.6	T21 A28 T29	T21-P25 WeakPolarHBondContact O-CD 3.49Å; P25-A28 WeakPolarHBondContact O-CB 3.36Å; P25-A28 PolarHBondContact O-N 3.05Å; P25-T29 PolarHBondContact O-N 3.48Å; P25-T29 PolarHBondContact O-OG1 3.4Å
26	R	95.4	Very high	95	Very high	127 Å²	127	98.1 Å²	98.1	48%	0.479	51%	0.506	S	S	.	.	H	α-helix	trans	-68.5	-43	178.8	-68.6	173.4	171.4	72.2	5.1	112	Y22 S23 K24 A28 T29 F30	Y22-R26 VanDerWaalsContact CD2-NH1 3.28Å; Y22-R26 PolarHBondContact O-NH1 3.35Å; Y22-R26 PolarHBondContact OH-NE 3.01Å; Y22-R26 PolarHBondContact OH-NH2 3.29Å; S23-R26 PolarHBondContact O-N 2.91Å; S23-R26 VanDerWaalsContact O-N 3.16Å; K24-R26 VanDerWaalsContact C-N 3.32Å; K24-R26 PolarHBondContact O-N 3.4Å; R26-A28 VanDerWaalsContact C-N 3.29Å; R26-A28 PolarHBondContact O-N 3.15Å; R26-T29 PolarHBondContact O-N 3.26Å; R26-F30 WeakPolarHBondContact O-CB 3.35Å; R26-F30 PolarHBondContact O-N 2.94Å
27	L	95.8	Very high	95.1	Very high	109 Å²	109	99.9 Å²	99.9	57%	0.571	51%	0.511	S	S	*	.	H	α-helix	trans	-65.3	-34.6	174.1	-69.9	176	0	0	0	111.5	S23 K24 F30 W31	S23-L27 WeakPolarHBondContact O-CG 3.48Å; S23-L27 PolarHBondContact O-N 3.46Å; K24-L27 PolarHBondContact O-N 3.19Å; L27-F30 PolarHBondContact O-N 3.43Å; L27-W31 WeakPolarHBondContact O-CB 3.38Å; L27-W31 PolarHBondContact O-N 3.08Å
28	A	96.3	Very high	95	Very high	60 Å²	60	102.7 Å²	102.7	50%	0.496	52%	0.517	S	S	.	.	H	α-helix	trans	-64.2	-44.3	174.2	0	0	0	0	0	111.8	K24 P25 R26 W31 Y32	K24-A28 WeakPolarHBondContact O-CB 3.4Å; K24-A28 PolarHBondContact O-N 3.19Å; P25-A28 WeakPolarHBondContact O-CB 3.36Å; P25-A28 PolarHBondContact O-N 3.05Å; R26-A28 VanDerWaalsContact C-N 3.29Å; R26-A28 PolarHBondContact O-N 3.15Å; A28-W31 PolarHBondContact O-N 3.11Å; A28-Y32 PolarHBondContact O-N 3.28Å
29	T	96.1	Very high	95	Very high	80 Å²	80	104 Å²	104	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-62.9	-45.7	174.3	-56.4	0	0	0	0	111.7	P25 R26 W31 Y32 Y33	P25-T29 PolarHBondContact O-N 3.48Å; P25-T29 PolarHBondContact O-OG1 3.4Å; R26-T29 PolarHBondContact O-N 3.26Å; T29-W31 VanDerWaalsContact C-N 3.32Å; T29-W31 PolarHBondContact O-N 2.91Å; T29-Y32 WeakPolarHBondContact O-CB 3.43Å; T29-Y32 PolarHBondContact O-N 3.09Å; T29-Y33 HydrophobicContact CG2-CD2 4.09Å; T29-Y33 HydrophobicContact CG2-CE2 3.72Å; T29-Y33 VanDerWaalsContact O-CD2 3.24Å; T29-Y33 WeakPolarHBondContact O-CD2 3.42Å; T29-Y33 PolarHBondContact O-N 2.93Å
30	F	95.1	Very high	94.8	Very high	123 Å²	123	106.8 Å²	106.8	54%	0.539	53%	0.533	S	S	.	.	H	α-helix	trans	-56.8	-47.1	174.6	169.4	-101.6	0	0	0	111.4	R26 L27 Y32 Y33 A34	R26-F30 WeakPolarHBondContact O-CB 3.35Å; R26-F30 PolarHBondContact O-N 2.94Å; L27-F30 PolarHBondContact O-N 3.43Å; F30-Y32 VanDerWaalsContact C-N 3.32Å; F30-Y32 PolarHBondContact O-N 3.36Å; F30-Y33 PolarHBondContact O-N 3.21Å; F30-A34 HydrophobicContact CE1-CB 4.19Å; F30-A34 HydrophobicContact CE2-CB 4.41Å; F30-A34 HydrophobicContact CZ-CB 4.11Å; F30-A34 VanDerWaalsContact O-CB 3.22Å; F30-A34 WeakPolarHBondContact O-CB 3.4Å; F30-A34 PolarHBondContact O-N 3.26Å
31	W	95.9	Very high	94.7	Very high	143 Å²	143	106.7 Å²	106.7	54%	0.542	53%	0.534	S	S	.	.	H	α-helix	trans	-64	-36.3	-179	-173.6	-107.7	0	0	0	113.1	L27 A28 T29 R35	L27-W31 WeakPolarHBondContact O-CB 3.38Å; L27-W31 PolarHBondContact O-N 3.08Å; A28-W31 PolarHBondContact O-N 3.11Å; T29-W31 VanDerWaalsContact C-N 3.32Å; T29-W31 PolarHBondContact O-N 2.91Å; W31-R35 HydrophobicContact CD2-CG 4.45Å; W31-R35 VanDerWaalsContact CE2-NE 3.26Å; W31-R35 HydrophobicContact CZ2-CG 4.29Å; W31-R35 VanDerWaalsContact NE1-CZ 3.28Å; W31-R35 WeakPolarHBondContact O-CG 3.45Å; W31-R35 PolarHBondContact O-N 3.27Å; W31-R35 VanDerWaalsContact O-N 3.12Å
32	Y	95.8	Very high	94.5	Very high	159 Å²	159	103.6 Å²	103.6	62%	0.624	52%	0.517	S	S	*	.	H	α-helix	trans	-58.1	-49.8	175.4	174.1	-98.7	0	0	0	111.7	A28 T29 F30	A28-Y32 PolarHBondContact O-N 3.28Å; T29-Y32 WeakPolarHBondContact O-CB 3.43Å; T29-Y32 PolarHBondContact O-N 3.09Å; F30-Y32 VanDerWaalsContact C-N 3.32Å; F30-Y32 PolarHBondContact O-N 3.36Å
33	Y	96.3	Very high	94.4	Very high	119 Å²	119	102.2 Å²	102.2	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-73.9	-42.2	178.6	-66.6	-66.7	0	0	0	112.5	T29 F30 R35 V36 E37	T29-Y33 HydrophobicContact CG2-CD2 4.09Å; T29-Y33 HydrophobicContact CG2-CE2 3.72Å; T29-Y33 VanDerWaalsContact O-CD2 3.24Å; T29-Y33 WeakPolarHBondContact O-CD2 3.42Å; T29-Y33 PolarHBondContact O-N 2.93Å; F30-Y33 PolarHBondContact O-N 3.21Å; Y33-R35 PolarHBondContact O-N 3.47Å; Y33-R35 VanDerWaalsContact O-N 3.15Å; Y33-V36 WeakPolarHBondContact O-CG2 3.44Å; Y33-V36 PolarHBondContact O-N 3.05Å; Y33-E37 PolarHBondContact O-N 3.39Å
34	A	93.3	Very high	94.3	Very high	15 Å²	15	104.2 Å²	104.2	12%	0.124	54%	0.539	C	S	.	.	H	α-helix	trans	-57.7	-33.8	-179.8	0	0	0	0	0	112.4	F30 V36 L38	F30-A34 HydrophobicContact CE1-CB 4.19Å; F30-A34 HydrophobicContact CE2-CB 4.41Å; F30-A34 HydrophobicContact CZ-CB 4.11Å; F30-A34 VanDerWaalsContact O-CB 3.22Å; F30-A34 WeakPolarHBondContact O-CB 3.4Å; F30-A34 PolarHBondContact O-N 3.26Å; A34-V36 VanDerWaalsContact C-N 3.26Å; A34-V36 PolarHBondContact O-N 3.49Å; A34-L38 HydrophobicContact CB-CD1 4.04Å; A34-L38 WeakPolarHBondContact O-CA 3.5Å; A34-L38 WeakPolarHBondContact O-CB 3.35Å; A34-L38 PolarHBondContact O-N 3.15Å
35	R	92.8	Very high	94.2	Very high	163 Å²	163	102.1 Å²	102.1	62%	0.615	53%	0.531	S	S	*	.	H	α-helix	trans	-66.5	-23	177.7	-85.9	-161.9	176.5	-178.7	5.4	114.9	W31 Y33	W31-R35 HydrophobicContact CD2-CG 4.45Å; W31-R35 VanDerWaalsContact CE2-NE 3.26Å; W31-R35 HydrophobicContact CZ2-CG 4.29Å; W31-R35 VanDerWaalsContact NE1-CZ 3.28Å; W31-R35 WeakPolarHBondContact O-CG 3.45Å; W31-R35 PolarHBondContact O-N 3.27Å; W31-R35 VanDerWaalsContact O-N 3.12Å; Y33-R35 PolarHBondContact O-N 3.47Å; Y33-R35 VanDerWaalsContact O-N 3.15Å
36	V	93.3	Very high	94.1	Very high	102 Å²	102	103.1 Å²	103.1	62%	0.618	53%	0.532	S	S	*	.	H	α-helix	trans	-109.4	-31	-178	-59.4	0	0	0	0	112.3	Y33 A34	Y33-V36 WeakPolarHBondContact O-CG2 3.44Å; Y33-V36 PolarHBondContact O-N 3.05Å; A34-V36 VanDerWaalsContact C-N 3.26Å; A34-V36 PolarHBondContact O-N 3.49Å
37	E	93.2	Very high	94.1	Very high	144 Å²	144	100.7 Å²	100.7	67%	0.673	53%	0.533	S	S	*	.	H	α-helix	trans	-97.6	-28.4	-176.3	-57.5	-174.2	171.2	0	0	113.7	Y33	Y33-E37 PolarHBondContact O-N 3.39Å
38	L	92.4	Very high	94.1	Very high	96 Å²	96	100.4 Å²	100.4	50%	0.503	54%	0.535	S	S	.	.	S	Bend	trans	-110	10.7	-175.9	-57.7	178	0	0	0	113.1	A34 W86	A34-L38 HydrophobicContact CB-CD1 4.04Å; A34-L38 WeakPolarHBondContact O-CA 3.5Å; A34-L38 WeakPolarHBondContact O-CB 3.35Å; A34-L38 PolarHBondContact O-N 3.15Å; L38-W86 HydrophobicContact CD2-CZ2 4.06Å
39	V	93.2	Very high	94	Very high	84 Å²	84	100.5 Å²	100.5	51%	0.509	54%	0.536	S	S	.	.	S	Bend	trans	-75.5	140.5	175.4	66.6	0	0	0	0	109.6
40	P	91.5	Very high	94	Very high	109 Å²	109	100.8 Å²	100.8	71%	0.708	53%	0.534	S	S	*	.	P	Polyproline II helix	trans	-53.8	135.7	169.6	-25.9	34.9	0	0	0	110.3
41	P	91.6	Very high	94.1	Very high	93 Å²	93	99.8 Å²	99.8	60%	0.604	53%	0.531	S	S	*	.	P	Polyproline II helix	trans	-63	152.2	-179	27.6	-35.2	0	0	0	110.8	E45	P41-E45 HydrophobicContact CB-CB 4.48Å
42	S	93.1	Very high	94	Very high	43 Å²	43	95.9 Å²	95.9	30%	0.301	53%	0.529	S	S	.	.	P	Polyproline II helix	trans	-68.2	148.7	170.8	67.8	0	0	0	0	110.5	S44 E45	S42-S44 PolarHBondContact O-N 3.33Å; S42-S44 VanDerWaalsContact O-N 3.07Å; S42-S44 PolarHBondContact OG-OG 2.97Å; S42-E45 WeakPolarHBondContact CB-OE2 2.85Å; S42-E45 PolarHBondContact N-OE2 2.93Å; S42-E45 PolarHBondContact O-N 3.49Å; S42-E45 WeakPolarHBondContact OG-CG 3.49Å; S42-E45 PolarHBondContact OG-OE2 3.5Å
43	P	92.6	Very high	94	Very high	108 Å²	108	90.9 Å²	90.9	70%	0.701	52%	0.52	S	S	*	.	G	3₁₀ helix	trans	-56.1	-28.5	177.7	-28	35.8	0	0	0	114.1	E45 I46	P43-E45 VanDerWaalsContact C-N 3.27Å; P43-E45 PolarHBondContact O-N 3.28Å; P43-I46 PolarHBondContact O-N 2.96Å
44	S	94	Very high	93.9	Very high	91 Å²	91	89.8 Å²	89.8	64%	0.636	52%	0.518	S	S	*	.	G	3₁₀ helix	trans	-67.1	-21.3	176.3	37.8	0	0	0	0	114.6	S42 P47	S42-S44 PolarHBondContact O-N 3.33Å; S42-S44 VanDerWaalsContact O-N 3.07Å; S42-S44 PolarHBondContact OG-OG 2.97Å; S44-P47 WeakPolarHBondContact O-CD 3.35Å
45	E	93.6	Very high	94	Very high	105 Å²	105	90.7 Å²	90.7	49%	0.491	53%	0.529	S	S	.	.	G	3₁₀ helix	trans	-85.8	-17	-179.6	-70.5	162.1	135.6	0	0	112.4	P41 S42 P43 T48 A49	P41-E45 HydrophobicContact CB-CB 4.48Å; S42-E45 WeakPolarHBondContact CB-OE2 2.85Å; S42-E45 PolarHBondContact N-OE2 2.93Å; S42-E45 PolarHBondContact O-N 3.49Å; S42-E45 WeakPolarHBondContact OG-CG 3.49Å; S42-E45 PolarHBondContact OG-OE2 3.5Å; P43-E45 VanDerWaalsContact C-N 3.27Å; P43-E45 PolarHBondContact O-N 3.28Å; E45-T48 WeakPolarHBondContact O-CB 3.42Å; E45-T48 PolarHBondContact O-N 2.98Å; E45-A49 PolarHBondContact O-N 3.08Å
46	I	94.7	Very high	93.9	Very high	92 Å²	92	89.2 Å²	89.2	47%	0.472	53%	0.533	S	S	.	.	H	α-helix	trans	-61.1	-47.1	-178	-58.8	174.8	0	0	0	112.2	P43 T48 A49 I50	P43-I46 PolarHBondContact O-N 2.96Å; I46-T48 VanDerWaalsContact C-N 3.27Å; I46-T48 PolarHBondContact O-N 3.38Å; I46-A49 PolarHBondContact O-N 3.23Å; I46-I50 HydrophobicContact CG2-CD1 3.94Å; I46-I50 HydrophobicContact CG2-CG1 4.45Å; I46-I50 WeakPolarHBondContact O-CG1 3.46Å; I46-I50 PolarHBondContact O-N 2.92Å
47	P	96.4	Very high	93.9	Very high	77 Å²	77	88 Å²	88	50%	0.5	53%	0.526	S	S	.	.	H	α-helix	trans	-58.6	-39.7	177.3	-24.7	35.6	0	0	0	112.6	S44 I50 E51	S44-P47 WeakPolarHBondContact O-CD 3.35Å; P47-I50 PolarHBondContact O-N 3.15Å; P47-E51 PolarHBondContact O-N 3.47Å
48	T	95.6	Very high	93.9	Very high	102 Å²	102	88.6 Å²	88.6	63%	0.626	52%	0.522	S	S	*	.	H	α-helix	trans	-63.3	-42.6	177.3	-52.7	0	0	0	0	111.4	E45 I46 I50 E51 A52	E45-T48 WeakPolarHBondContact O-CB 3.42Å; E45-T48 PolarHBondContact O-N 2.98Å; I46-T48 VanDerWaalsContact C-N 3.27Å; I46-T48 PolarHBondContact O-N 3.38Å; T48-I50 PolarHBondContact O-N 3.39Å; T48-E51 PolarHBondContact O-N 3.28Å; T48-A52 WeakPolarHBondContact O-CB 3.48Å; T48-A52 PolarHBondContact O-N 2.93Å
49	A	94.4	Very high	93.8	Very high	63 Å²	63	85.9 Å²	85.9	52%	0.521	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-40.1	175.8	0	0	0	0	0	112.3	E45 I46 A52 A53	E45-A49 PolarHBondContact O-N 3.08Å; I46-A49 PolarHBondContact O-N 3.23Å; A49-A52 PolarHBondContact O-N 3.41Å; A49-A53 PolarHBondContact O-N 3.04Å
50	I	95.8	Very high	93.6	Very high	85 Å²	85	90.2 Å²	90.2	44%	0.436	52%	0.519	S	S	.	.	H	α-helix	trans	-63.6	-45.1	176.1	-68.4	168.5	0	0	0	110.9	I46 P47 T48 A52 A53 K54	I46-I50 HydrophobicContact CG2-CD1 3.94Å; I46-I50 HydrophobicContact CG2-CG1 4.45Å; I46-I50 WeakPolarHBondContact O-CG1 3.46Å; I46-I50 PolarHBondContact O-N 2.92Å; P47-I50 PolarHBondContact O-N 3.15Å; T48-I50 PolarHBondContact O-N 3.39Å; I50-A52 VanDerWaalsContact C-N 3.34Å; I50-A52 PolarHBondContact O-N 3.08Å; I50-A53 PolarHBondContact O-N 2.95Å; I50-K54 HydrophobicContact CG2-CD 4.42Å; I50-K54 WeakPolarHBondContact O-CG 3.38Å; I50-K54 PolarHBondContact O-N 3.38Å
51	E	96.6	Very high	93.5	Very high	102 Å²	102	92 Å²	92	48%	0.477	52%	0.518	S	S	.	.	H	α-helix	trans	-64.5	-38.7	177.4	-72	-54.5	128.6	0	0	112	P47 T48 A53 K54 G55	P47-E51 PolarHBondContact O-N 3.47Å; T48-E51 PolarHBondContact O-N 3.28Å; E51-A53 PolarHBondContact O-N 3.47Å; E51-K54 PolarHBondContact O-N 3.09Å; E51-K54 IonicContact OE1-NZ 3.67Å; E51-K54 PolarHBondContact OE1-NZ 3.33Å; E51-G55 PolarHBondContact O-N 3.46Å
52	A	94.2	Very high	93.6	Very high	62 Å²	62	92.7 Å²	92.7	51%	0.512	52%	0.521	S	S	.	.	H	α-helix	trans	-60.7	-44.3	173	0	0	0	0	0	111.9	T48 A49 I50 G55 L56	T48-A52 WeakPolarHBondContact O-CB 3.48Å; T48-A52 PolarHBondContact O-N 2.93Å; A49-A52 PolarHBondContact O-N 3.41Å; I50-A52 VanDerWaalsContact C-N 3.34Å; I50-A52 PolarHBondContact O-N 3.08Å; A52-G55 WeakPolarHBondContact O-CA 3.41Å; A52-G55 PolarHBondContact O-N 2.72Å; A52-G55 VanDerWaalsContact O-N 3.15Å; A52-L56 PolarHBondContact O-N 3.37Å
53	A	94.6	Very high	93.3	Very high	53 Å²	53	93 Å²	93	44%	0.438	53%	0.53	S	S	.	.	H	α-helix	trans	-62	-43.5	176.3	0	0	0	0	0	112.2	A49 I50 E51 G55 L56 V57	A49-A53 PolarHBondContact O-N 3.04Å; I50-A53 PolarHBondContact O-N 2.95Å; E51-A53 PolarHBondContact O-N 3.47Å; A53-G55 VanDerWaalsContact C-N 3.28Å; A53-G55 PolarHBondContact O-N 2.98Å; A53-L56 WeakPolarHBondContact O-CB 3.45Å; A53-L56 PolarHBondContact O-N 3.28Å; A53-V57 PolarHBondContact O-N 3.5Å; A53-V57 VanDerWaalsContact O-N 3.17Å
54	K	96.1	Very high	92.9	Very high	96 Å²	96	95.5 Å²	95.5	42%	0.417	53%	0.526	S	S	.	.	H	α-helix	trans	-60	-39.1	173.2	-70.7	174.5	-173.2	168.2	0	111.8	I50 E51 L56 V57 R58	I50-K54 HydrophobicContact CG2-CD 4.42Å; I50-K54 WeakPolarHBondContact O-CG 3.38Å; I50-K54 PolarHBondContact O-N 3.38Å; E51-K54 PolarHBondContact O-N 3.09Å; E51-K54 IonicContact OE1-NZ 3.67Å; E51-K54 PolarHBondContact OE1-NZ 3.33Å; K54-L56 VanDerWaalsContact C-N 3.34Å; K54-L56 PolarHBondContact O-N 3.01Å; K54-V57 PolarHBondContact O-N 3.18Å; K54-R58 WeakPolarHBondContact O-CG 3.45Å; K54-R58 PolarHBondContact O-N 3.06Å
55	G	94	Very high	92.1	Very high	35 Å²	35	97.3 Å²	97.3	36%	0.361	52%	0.522	S	S	.	.	H	α-helix	trans	-59.2	-42.3	174.7	0	0	0	0	0	112.9	E51 A52 A53 R58 S59	E51-G55 PolarHBondContact O-N 3.46Å; A52-G55 WeakPolarHBondContact O-CA 3.41Å; A52-G55 PolarHBondContact O-N 2.72Å; A52-G55 VanDerWaalsContact O-N 3.15Å; A53-G55 VanDerWaalsContact C-N 3.28Å; A53-G55 PolarHBondContact O-N 2.98Å; G55-R58 PolarHBondContact O-N 3.46Å; G55-S59 WeakPolarHBondContact O-CB 3.39Å; G55-S59 PolarHBondContact O-N 3.19Å
56	L	91.7	Very high	91.6	Very high	131 Å²	131	95.7 Å²	95.7	69%	0.686	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-44.3	175.1	-67.4	173.7	0	0	0	111.8	A52 A53 K54 R58 S59 Y60	A52-L56 PolarHBondContact O-N 3.37Å; A53-L56 WeakPolarHBondContact O-CB 3.45Å; A53-L56 PolarHBondContact O-N 3.28Å; K54-L56 VanDerWaalsContact C-N 3.34Å; K54-L56 PolarHBondContact O-N 3.01Å; L56-R58 PolarHBondContact O-N 2.82Å; L56-S59 WeakPolarHBondContact O-CB 3.45Å; L56-S59 PolarHBondContact O-N 3.18Å; L56-Y60 PolarHBondContact O-N 3.41Å
57	V	93	Very high	91.3	Very high	78 Å²	78	98.6 Å²	98.6	47%	0.473	55%	0.546	S	S	.	.	H	α-helix	trans	-60.8	-44.5	176.7	176.1	0	0	0	0	111.3	A53 K54 S59 Y60 Q61	A53-V57 PolarHBondContact O-N 3.5Å; A53-V57 VanDerWaalsContact O-N 3.17Å; K54-V57 PolarHBondContact O-N 3.18Å; V57-S59 PolarHBondContact O-N 2.84Å; V57-Y60 WeakPolarHBondContact O-CB 3.4Å; V57-Y60 PolarHBondContact O-N 3.26Å; V57-Q61 HydrophobicContact CG1-CG 4.49Å; V57-Q61 WeakPolarHBondContact O-CG 3.49Å; V57-Q61 PolarHBondContact O-N 3.34Å
58	R	93.1	Very high	91	Very high	155 Å²	155	97.4 Å²	97.4	59%	0.585	54%	0.537	S	S	*	.	H	α-helix	trans	-63.5	-40.3	175.9	-70.7	176.8	-178.4	164.9	1.9	112.3	K54 G55 L56 Y60 Q61 T62	K54-R58 WeakPolarHBondContact O-CG 3.45Å; K54-R58 PolarHBondContact O-N 3.06Å; G55-R58 PolarHBondContact O-N 3.46Å; L56-R58 PolarHBondContact O-N 2.82Å; R58-Y60 VanDerWaalsContact C-N 3.28Å; R58-Y60 PolarHBondContact O-N 3.32Å; R58-Q61 PolarHBondContact O-N 3.34Å; R58-T62 WeakPolarHBondContact O-CB 3.24Å; R58-T62 WeakPolarHBondContact O-CG2 3.4Å; R58-T62 PolarHBondContact O-N 2.97Å; R58-T62 PolarHBondContact O-OG1 3.23Å
59	S	89.4	Confident	90.9	Very high	39 Å²	39	96.2 Å²	96.2	27%	0.273	53%	0.53	S	S	.	.	H	α-helix	trans	-61.9	-38.4	176.6	-172.3	0	0	0	0	111.7	G55 L56 V57 T62 R64	G55-S59 WeakPolarHBondContact O-CB 3.39Å; G55-S59 PolarHBondContact O-N 3.19Å; L56-S59 WeakPolarHBondContact O-CB 3.45Å; L56-S59 PolarHBondContact O-N 3.18Å; V57-S59 PolarHBondContact O-N 2.84Å; S59-T62 PolarHBondContact O-OG1 3.29Å; S59-R64 PolarHBondContact O-N 3.01Å; S59-R64 VanDerWaalsContact O-N 3.15Å
60	Y	88.8	Confident	91	Very high	176 Å²	176	99.2 Å²	99.2	69%	0.69	54%	0.542	S	S	*	.	H	α-helix	trans	-65.8	-49.3	173.4	-180	-100.4	0	0	0	111.8	L56 V57 R58 T62 G63	L56-Y60 PolarHBondContact O-N 3.41Å; V57-Y60 WeakPolarHBondContact O-CB 3.4Å; V57-Y60 PolarHBondContact O-N 3.26Å; R58-Y60 VanDerWaalsContact C-N 3.28Å; R58-Y60 PolarHBondContact O-N 3.32Å; Y60-T62 VanDerWaalsContact C-N 3.3Å; Y60-T62 PolarHBondContact O-N 3.06Å; Y60-G63 PolarHBondContact O-N 3.38Å; Y60-G63 VanDerWaalsContact O-N 3.1Å
61	Q	91.3	Very high	91	Very high	146 Å²	146	103.7 Å²	103.7	68%	0.682	56%	0.558	S	S	*	*	H	α-helix	trans	-61.4	-34.7	-179.9	-72.9	173.3	-17.7	0	0	113.6	V57 R58 G63	V57-Q61 HydrophobicContact CG1-CG 4.49Å; V57-Q61 WeakPolarHBondContact O-CG 3.49Å; V57-Q61 PolarHBondContact O-N 3.34Å; R58-Q61 PolarHBondContact O-N 3.34Å; Q61-G63 PolarHBondContact O-N 3.07Å
62	T	92.3	Very high	90.8	Very high	108 Å²	108	102.6 Å²	102.6	66%	0.663	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	1.1	179.5	53.5	0	0	0	0	113.4	R58 S59 Y60 R64	R58-T62 WeakPolarHBondContact O-CB 3.24Å; R58-T62 WeakPolarHBondContact O-CG2 3.4Å; R58-T62 PolarHBondContact O-N 2.97Å; R58-T62 PolarHBondContact O-OG1 3.23Å; S59-T62 PolarHBondContact O-OG1 3.29Å; Y60-T62 VanDerWaalsContact C-N 3.3Å; Y60-T62 PolarHBondContact O-N 3.06Å; T62-R64 PolarHBondContact O-N 2.75Å
63	G	86.5	Confident	90.8	Very high	48 Å²	48	101.8 Å²	101.8	50%	0.495	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	74.6	4.5	179.5	0	0	0	0	0	114.6	Y60 Q61 F65 G66	Y60-G63 PolarHBondContact O-N 3.38Å; Y60-G63 VanDerWaalsContact O-N 3.1Å; Q61-G63 PolarHBondContact O-N 3.07Å; G63-F65 PolarHBondContact O-N 2.91Å; G63-F65 VanDerWaalsContact O-N 3.16Å; G63-G66 PolarHBondContact O-N 2.84Å; G63-G66 VanDerWaalsContact O-N 3.17Å
64	R	84.2	Confident	90.9	Very high	161 Å²	161	106 Å²	106	61%	0.608	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-64.5	-19.4	-179.9	-171.6	175.6	176.5	-179.1	-2.4	112.8	S59 T62 G66 Q67	S59-R64 PolarHBondContact O-N 3.01Å; S59-R64 VanDerWaalsContact O-N 3.15Å; T62-R64 PolarHBondContact O-N 2.75Å; R64-G66 PolarHBondContact O-N 3.42Å; R64-Q67 WeakPolarHBondContact O-CB 3.32Å; R64-Q67 PolarHBondContact O-N 2.67Å
65	F	78.7	Confident	91	Very high	129 Å²	129	108.6 Å²	108.6	57%	0.566	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-56.2	-33.9	172.9	-174.2	-100.6	0	0	0	113.2	G63 Q67 T68	G63-F65 PolarHBondContact O-N 2.91Å; G63-F65 VanDerWaalsContact O-N 3.16Å; F65-Q67 PolarHBondContact O-N 3.21Å; F65-Q67 VanDerWaalsContact O-N 3.13Å; F65-T68 WeakPolarHBondContact O-CB 3.43Å; F65-T68 PolarHBondContact O-N 3.36Å; F65-T68 VanDerWaalsContact O-N 3.14Å; F65-T68 PolarHBondContact O-OG1 3.22Å
66	G	81.9	Confident	91	Very high	72 Å²	72	111 Å²	111	74%	0.742	57%	0.566	S	S	*	*	G	3₁₀ helix	trans	-67.2	-10.9	177.4	0	0	0	0	0	114.4	G63 R64	G63-G66 PolarHBondContact O-N 2.84Å; G63-G66 VanDerWaalsContact O-N 3.17Å; R64-G66 PolarHBondContact O-N 3.42Å
67	Q	88.1	Confident	91.2	Very high	153 Å²	153	106.3 Å²	106.3	72%	0.715	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-93	-3.8	177.5	-56.3	176.1	3.9	0	0	112.5	R64 F65	R64-Q67 WeakPolarHBondContact O-CB 3.32Å; R64-Q67 PolarHBondContact O-N 2.67Å; F65-Q67 PolarHBondContact O-N 3.21Å; F65-Q67 VanDerWaalsContact O-N 3.13Å
68	T	90	Very high	91.4	Very high	52 Å²	52	107.2 Å²	107.2	32%	0.319	55%	0.551	S	S	.	*			trans	-74.4	132.3	179.9	-58.4	0	0	0	0	110.8	F65 E72 A73	F65-T68 WeakPolarHBondContact O-CB 3.43Å; F65-T68 PolarHBondContact O-N 3.36Å; F65-T68 VanDerWaalsContact O-N 3.14Å; F65-T68 PolarHBondContact O-OG1 3.22Å; T68-E72 HydrophobicContact CG2-CB 3.59Å; T68-A73 HydrophobicContact CG2-CB 4.29Å
69	T	94.9	Very high	91.6	Very high	76 Å²	76	103.4 Å²	103.4	47%	0.466	55%	0.545	S	S	.	.			trans	-72.5	154.9	177.7	64.5	0	0	0	0	111.2	K71 E72 A73	T69-K71 PolarHBondContact O-N 3.32Å; T69-E72 PolarHBondContact N-OE2 3.35Å; T69-E72 PolarHBondContact O-N 3.45Å; T69-E72 VanDerWaalsContact OG1-CG 3.31Å; T69-E72 WeakPolarHBondContact OG1-CG 3.2Å; T69-E72 PolarHBondContact OG1-N 3.4Å; T69-E72 PolarHBondContact OG1-OE2 3.4Å; T69-A73 PolarHBondContact O-N 3.12Å
70	V	95.3	Very high	91.9	Very high	127 Å²	127	104.4 Å²	104.4	77%	0.77	56%	0.556	S	S	*	*	H	α-helix	trans	-56.4	-37.8	178.3	178.3	0	0	0	0	111.8	E72 A73 F74	V70-E72 PolarHBondContact O-N 3.15Å; V70-A73 PolarHBondContact O-N 3.33Å; V70-F74 VanDerWaalsContact O-CB 3.29Å; V70-F74 WeakPolarHBondContact O-CB 3.41Å; V70-F74 PolarHBondContact O-N 2.85Å
71	K	95.8	Very high	92.4	Very high	178 Å²	178	99.7 Å²	99.7	77%	0.774	55%	0.545	S	S	*	.	H	α-helix	trans	-60.7	-44.5	177.1	-178.7	-179.7	177	-178.1	0	112	T69 R75	T69-K71 PolarHBondContact O-N 3.32Å; K71-R75 WeakPolarHBondContact O-CB 3.5Å; K71-R75 PolarHBondContact O-N 2.92Å
72	E	93.8	Very high	92.6	Very high	80 Å²	80	98.1 Å²	98.1	37%	0.374	54%	0.538	S	S	.	.	H	α-helix	trans	-69.8	-43.6	179	-71.4	168	148	0	0	111.5	T68 T69 V70 F74 R75 N76	T68-E72 HydrophobicContact CG2-CB 3.59Å; T69-E72 PolarHBondContact N-OE2 3.35Å; T69-E72 PolarHBondContact O-N 3.45Å; T69-E72 VanDerWaalsContact OG1-CG 3.31Å; T69-E72 WeakPolarHBondContact OG1-CG 3.2Å; T69-E72 PolarHBondContact OG1-N 3.4Å; T69-E72 PolarHBondContact OG1-OE2 3.4Å; V70-E72 PolarHBondContact O-N 3.15Å; E72-F74 VanDerWaalsContact C-N 3.29Å; E72-F74 PolarHBondContact O-N 3.31Å; E72-R75 PolarHBondContact O-N 3.34Å; E72-N76 WeakPolarHBondContact O-CB 3.45Å; E72-N76 PolarHBondContact O-N 2.89Å; E72-N76 PolarHBondContact O-ND2 2.81Å; E72-N76 PolarHBondContact O-OD1 3Å
73	A	93.7	Very high	92.8	Very high	44 Å²	44	97.4 Å²	97.4	36%	0.364	53%	0.533	S	S	.	.	H	α-helix	trans	-58	-44.8	175.8	0	0	0	0	0	110.9	T68 T69 V70 N76 G77	T68-A73 HydrophobicContact CG2-CB 4.29Å; T69-A73 PolarHBondContact O-N 3.12Å; V70-A73 PolarHBondContact O-N 3.33Å; A73-N76 PolarHBondContact O-N 3Å; A73-G77 PolarHBondContact O-N 2.89Å
74	F	96.7	Very high	93.3	Very high	141 Å²	141	99.4 Å²	99.4	62%	0.618	53%	0.532	S	S	*	.	H	α-helix	trans	-64.7	-46.7	177.9	-171	-108.4	0	0	0	112.3	V70 E72 N76 G77 L78	V70-F74 VanDerWaalsContact O-CB 3.29Å; V70-F74 WeakPolarHBondContact O-CB 3.41Å; V70-F74 PolarHBondContact O-N 2.85Å; E72-F74 VanDerWaalsContact C-N 3.29Å; E72-F74 PolarHBondContact O-N 3.31Å; F74-N76 VanDerWaalsContact C-N 3.34Å; F74-N76 PolarHBondContact O-N 3.48Å; F74-G77 PolarHBondContact O-N 2.89Å; F74-L78 HydrophobicContact CD1-CD1 4.05Å; F74-L78 HydrophobicContact CD1-CG 4.42Å; F74-L78 HydrophobicContact CE1-CD1 3.67Å; F74-L78 HydrophobicContact CE1-CD2 4.43Å; F74-L78 HydrophobicContact CE1-CG 4.13Å; F74-L78 HydrophobicContact CZ-CD1 4.26Å; F74-L78 HydrophobicContact CZ-CD2 4.2Å; F74-L78 HydrophobicContact CZ-CG 4.31Å; F74-L78 WeakPolarHBondContact O-CG 3.22Å; F74-L78 PolarHBondContact O-N 3.49Å
75	R	97	Very high	93.9	Very high	152 Å²	152	96.2 Å²	96.2	57%	0.574	53%	0.525	S	S	*	.	H	α-helix	trans	-57.2	-47.5	175.6	-176.9	-171.7	67.9	-171.8	-2.9	111.6	K71 E72 G77 L78 V79	K71-R75 WeakPolarHBondContact O-CB 3.5Å; K71-R75 PolarHBondContact O-N 2.92Å; E72-R75 PolarHBondContact O-N 3.34Å; R75-G77 VanDerWaalsContact C-N 3.3Å; R75-G77 PolarHBondContact O-N 3.46Å; R75-L78 PolarHBondContact O-N 2.91Å; R75-V79 PolarHBondContact O-N 3.16Å; R75-V79 VanDerWaalsContact O-N 3.15Å
76	N	94.6	Very high	94.7	Very high	85 Å²	85	96.3 Å²	96.3	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-66.1	-35.8	-179.9	-64.3	-10.4	0	0	0	111.2	E72 A73 F74 V79 A80	E72-N76 WeakPolarHBondContact O-CB 3.45Å; E72-N76 PolarHBondContact O-N 2.89Å; E72-N76 PolarHBondContact O-ND2 2.81Å; E72-N76 PolarHBondContact O-OD1 3Å; A73-N76 PolarHBondContact O-N 3Å; F74-N76 VanDerWaalsContact C-N 3.34Å; F74-N76 PolarHBondContact O-N 3.48Å; N76-V79 PolarHBondContact O-N 3.42Å; N76-A80 WeakPolarHBondContact O-CB 3.35Å; N76-A80 PolarHBondContact O-N 3.31Å
77	G	96	Very high	95.4	Very high	32 Å²	32	99.8 Å²	99.8	33%	0.33	52%	0.517	S	S	.	.	H	α-helix	trans	-63.5	-39.4	173.3	0	0	0	0	0	113.3	A73 F74 R75 A80 T81	A73-G77 PolarHBondContact O-N 2.89Å; F74-G77 PolarHBondContact O-N 2.89Å; R75-G77 VanDerWaalsContact C-N 3.3Å; R75-G77 PolarHBondContact O-N 3.46Å; G77-A80 PolarHBondContact O-N 3.19Å; G77-T81 WeakPolarHBondContact O-CB 3.39Å; G77-T81 PolarHBondContact O-N 3.02Å; G77-T81 PolarHBondContact O-OG1 3.42Å
78	L	98.1	Very high	95.8	Very high	97 Å²	97	96.8 Å²	96.8	51%	0.508	50%	0.502	S	S	.	.	H	α-helix	trans	-62.8	-46.1	174.2	-70.3	176.5	0	0	0	111.5	F74 R75 A80 T81 E82	F74-L78 HydrophobicContact CD1-CD1 4.05Å; F74-L78 HydrophobicContact CD1-CG 4.42Å; F74-L78 HydrophobicContact CE1-CD1 3.67Å; F74-L78 HydrophobicContact CE1-CD2 4.43Å; F74-L78 HydrophobicContact CE1-CG 4.13Å; F74-L78 HydrophobicContact CZ-CD1 4.26Å; F74-L78 HydrophobicContact CZ-CD2 4.2Å; F74-L78 HydrophobicContact CZ-CG 4.31Å; F74-L78 WeakPolarHBondContact O-CG 3.22Å; F74-L78 PolarHBondContact O-N 3.49Å; R75-L78 PolarHBondContact O-N 2.91Å; L78-A80 PolarHBondContact O-N 3.33Å; L78-T81 WeakPolarHBondContact O-CB 3.34Å; L78-T81 PolarHBondContact O-N 3.35Å; L78-E82 PolarHBondContact O-N 2.9Å
79	V	96.6	Very high	96	Very high	76 Å²	76	98 Å²	98	46%	0.461	51%	0.505	S	S	.	.	H	α-helix	trans	-62.6	-42.6	176.4	176.6	0	0	0	0	111	R75 N76 T81 E82 V83	R75-V79 PolarHBondContact O-N 3.16Å; R75-V79 VanDerWaalsContact O-N 3.15Å; N76-V79 PolarHBondContact O-N 3.42Å; V79-T81 VanDerWaalsContact C-N 3.3Å; V79-T81 PolarHBondContact O-N 3.3Å; V79-E82 WeakPolarHBondContact O-CB 3.26Å; V79-E82 PolarHBondContact O-N 3.29Å; V79-V83 WeakPolarHBondContact O-CG2 3.46Å; V79-V83 PolarHBondContact O-N 3.48Å
80	A	96.4	Very high	96.1	Very high	60 Å²	60	96.3 Å²	96.3	50%	0.496	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-39.2	176.1	0	0	0	0	0	112.1	N76 G77 L78 V83 L84	N76-A80 WeakPolarHBondContact O-CB 3.35Å; N76-A80 PolarHBondContact O-N 3.31Å; G77-A80 PolarHBondContact O-N 3.19Å; L78-A80 PolarHBondContact O-N 3.33Å; A80-V83 PolarHBondContact O-N 3.01Å; A80-L84 WeakPolarHBondContact O-CB 3.48Å; A80-L84 PolarHBondContact O-N 3.44Å; A80-L84 VanDerWaalsContact O-N 3.08Å
81	T	97.8	Very high	96.1	Very high	77 Å²	77	93.1 Å²	93.1	47%	0.472	48%	0.479	S	S	.	.	H	α-helix	trans	-66.2	-42	176.3	-55.7	0	0	0	0	111.2	G77 L78 V79 V83 L84 M85	G77-T81 WeakPolarHBondContact O-CB 3.39Å; G77-T81 PolarHBondContact O-N 3.02Å; G77-T81 PolarHBondContact O-OG1 3.42Å; L78-T81 WeakPolarHBondContact O-CB 3.34Å; L78-T81 PolarHBondContact O-N 3.35Å; V79-T81 VanDerWaalsContact C-N 3.3Å; V79-T81 PolarHBondContact O-N 3.3Å; T81-V83 PolarHBondContact O-N 2.98Å; T81-L84 PolarHBondContact O-N 3.43Å; T81-M85 WeakPolarHBondContact O-CG 3.34Å; T81-M85 PolarHBondContact O-N 3.05Å
82	E	96.9	Very high	96.1	Very high	112 Å²	112	86.3 Å²	86.3	52%	0.523	45%	0.454	S	S	.	.	H	α-helix	trans	-57.7	-48.1	175.1	-176.4	-171.7	180	0	0	111.7	L78 V79 L84 M85 W86	L78-E82 PolarHBondContact O-N 2.9Å; V79-E82 WeakPolarHBondContact O-CB 3.26Å; V79-E82 PolarHBondContact O-N 3.29Å; E82-L84 VanDerWaalsContact C-N 3.28Å; E82-L84 PolarHBondContact O-N 2.86Å; E82-M85 WeakPolarHBondContact O-CB 3.37Å; E82-M85 PolarHBondContact O-N 3.38Å; E82-M85 VanDerWaalsContact O-N 3.09Å; E82-W86 PolarHBondContact O-N 3.38Å; E82-W86 VanDerWaalsContact O-N 3.11Å
83	V	95.6	Very high	96.2	Very high	94 Å²	94	88.7 Å²	88.7	57%	0.57	47%	0.468	S	S	*	.	H	α-helix	trans	-61.2	-37.6	177	175.6	0	0	0	0	111.6	V79 A80 T81 W86 F87	V79-V83 WeakPolarHBondContact O-CG2 3.46Å; V79-V83 PolarHBondContact O-N 3.48Å; A80-V83 PolarHBondContact O-N 3.01Å; T81-V83 PolarHBondContact O-N 2.98Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.95Å; V83-F87 PolarHBondContact O-N 2.99Å
84	L	96.9	Very high	96.3	Very high	90 Å²	90	90 Å²	90	47%	0.471	49%	0.486	S	S	.	.	H	α-helix	trans	-68.2	-33.5	175.5	177.5	146.4	0	0	0	112.2	A80 T81 E82 W86 F87 F88	A80-L84 WeakPolarHBondContact O-CB 3.48Å; A80-L84 PolarHBondContact O-N 3.44Å; A80-L84 VanDerWaalsContact O-N 3.08Å; T81-L84 PolarHBondContact O-N 3.43Å; E82-L84 VanDerWaalsContact C-N 3.28Å; E82-L84 PolarHBondContact O-N 2.86Å; L84-W86 VanDerWaalsContact C-N 3.33Å; L84-F87 WeakPolarHBondContact O-CB 3.49Å; L84-F87 PolarHBondContact O-N 3.06Å; L84-F88 HydrophobicContact CD2-CD2 4.05Å; L84-F88 HydrophobicContact CD2-CE2 3.57Å; L84-F88 HydrophobicContact CG-CE2 4.23Å; L84-F88 WeakPolarHBondContact O-CD2 3.36Å
85	M	97.4	Very high	96.2	Very high	93 Å²	93	85.4 Å²	85.4	46%	0.458	47%	0.466	S	S	.	.	H	α-helix	trans	-66.8	-33.7	172.5	-66.3	-70.9	112.8	0	0	112.1	T81 E82 F87 F88 I89	T81-M85 WeakPolarHBondContact O-CG 3.34Å; T81-M85 PolarHBondContact O-N 3.05Å; E82-M85 WeakPolarHBondContact O-CB 3.37Å; E82-M85 PolarHBondContact O-N 3.38Å; E82-M85 VanDerWaalsContact O-N 3.09Å; M85-F87 VanDerWaalsContact C-N 3.25Å; M85-F87 PolarHBondContact O-N 3.17Å; M85-F88 HydrophobicContact CE-CD2 3.92Å; M85-F88 HydrophobicContact CE-CE2 4.16Å; M85-F88 PolarHBondContact O-N 3.05Å; M85-F88 VanDerWaalsContact O-N 3.09Å; M85-I89 WeakPolarHBondContact O-CG1 3.32Å; M85-I89 PolarHBondContact O-N 3.32Å
86	W	95.9	Very high	96.1	Very high	131 Å²	131	81.6 Å²	81.6	50%	0.496	47%	0.473	S	S	.	.	H	α-helix	trans	-59.3	-34.7	173	-81.7	107.7	0	0	0	113	L38 E82 V83 L84 I89 G90	L38-W86 HydrophobicContact CD2-CZ2 4.06Å; E82-W86 PolarHBondContact O-N 3.38Å; E82-W86 VanDerWaalsContact O-N 3.11Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.95Å; L84-W86 VanDerWaalsContact C-N 3.33Å; W86-I89 HydrophobicContact CD2-CD1 4.29Å; W86-I89 HydrophobicContact CE3-CB 4.48Å; W86-I89 HydrophobicContact CE3-CD1 3.94Å; W86-I89 HydrophobicContact CE3-CG2 4.47Å; W86-I89 HydrophobicContact CZ3-CD1 4.23Å; W86-I89 PolarHBondContact O-N 2.94Å; W86-G90 PolarHBondContact O-N 3.33Å
87	F	95.7	Very high	96	Very high	145 Å²	145	78.9 Å²	78.9	64%	0.636	47%	0.465	S	S	*	.	H	α-helix	trans	-60.6	-46.1	172.1	170.5	-94	0	0	0	111.8	V83 L84 M85 I89 G90 E91	V83-F87 PolarHBondContact O-N 2.99Å; L84-F87 WeakPolarHBondContact O-CB 3.49Å; L84-F87 PolarHBondContact O-N 3.06Å; M85-F87 VanDerWaalsContact C-N 3.25Å; M85-F87 PolarHBondContact O-N 3.17Å; F87-I89 PolarHBondContact O-N 3.27Å; F87-G90 CarbonylContact O-C 3.57Å; F87-G90 WeakPolarHBondContact O-CA 3.46Å; F87-G90 PolarHBondContact O-N 2.84Å; F87-G90 VanDerWaalsContact O-N 3.08Å; F87-E91 PolarHBondContact O-N 3.34Å
88	F	95.8	Very high	95.9	Very high	91 Å²	91	84.6 Å²	84.6	40%	0.399	49%	0.488	S	S	.	.	H	α-helix	trans	-69.2	-30.1	178.1	-69.8	-65.5	0	0	0	113.5	L84 M85 G90 E91 C92	L84-F88 HydrophobicContact CD2-CD2 4.05Å; L84-F88 HydrophobicContact CD2-CE2 3.57Å; L84-F88 HydrophobicContact CG-CE2 4.23Å; L84-F88 WeakPolarHBondContact O-CD2 3.36Å; M85-F88 HydrophobicContact CE-CD2 3.92Å; M85-F88 HydrophobicContact CE-CE2 4.16Å; M85-F88 PolarHBondContact O-N 3.05Å; M85-F88 VanDerWaalsContact O-N 3.09Å; F88-G90 VanDerWaalsContact C-N 3.29Å; F88-E91 WeakPolarHBondContact CD1-OE2 3.35Å; F88-E91 WeakPolarHBondContact O-CB 3.5Å; F88-E91 PolarHBondContact O-N 3.08Å; F88-C92 PolarHBondContact O-N 2.88Å; F88-C92 PolarHBondContact O-SG 2.94Å; F88-C92 VanDerWaalsContact O-SG 3.41Å
89	I	96.1	Very high	95.7	Very high	78 Å²	78	87.8 Å²	87.8	40%	0.4	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-43.5	168.7	-66.5	169.6	0	0	0	109.6	M85 W86 F87 E91 C92 I93	M85-I89 WeakPolarHBondContact O-CG1 3.32Å; M85-I89 PolarHBondContact O-N 3.32Å; W86-I89 HydrophobicContact CD2-CD1 4.29Å; W86-I89 HydrophobicContact CE3-CB 4.48Å; W86-I89 HydrophobicContact CE3-CD1 3.94Å; W86-I89 HydrophobicContact CE3-CG2 4.47Å; W86-I89 HydrophobicContact CZ3-CD1 4.23Å; W86-I89 PolarHBondContact O-N 2.94Å; F87-I89 PolarHBondContact O-N 3.27Å; I89-E91 VanDerWaalsContact C-N 3.34Å; I89-E91 PolarHBondContact O-N 3.42Å; I89-C92 WeakPolarHBondContact O-CB 3.47Å; I89-C92 PolarHBondContact O-N 3.37Å; I89-I93 HydrophobicContact CG2-CD1 4.21Å; I89-I93 WeakPolarHBondContact O-CG1 3.42Å; I89-I93 PolarHBondContact O-N 2.98Å
90	G	95.8	Very high	95.5	Very high	40 Å²	40	86.2 Å²	86.2	41%	0.412	50%	0.503	S	S	.	.	H	α-helix	trans	-58.7	-42.2	172.7	0	0	0	0	0	113	W86 F87 F88 I93 G94	W86-G90 PolarHBondContact O-N 3.33Å; F87-G90 CarbonylContact O-C 3.57Å; F87-G90 WeakPolarHBondContact O-CA 3.46Å; F87-G90 PolarHBondContact O-N 2.84Å; F87-G90 VanDerWaalsContact O-N 3.08Å; F88-G90 VanDerWaalsContact C-N 3.29Å; G90-I93 PolarHBondContact O-N 3.48Å; G90-G94 PolarHBondContact O-N 2.9Å
91	E	96.2	Very high	95.2	Very high	59 Å²	59	90.4 Å²	90.4	28%	0.276	51%	0.507	S	S	.	.	H	α-helix	trans	-61.3	-44.5	173.8	-170.2	-159	122	0	0	111.8	F87 F88 I89 I93 G94 K95	F87-E91 PolarHBondContact O-N 3.34Å; F88-E91 WeakPolarHBondContact CD1-OE2 3.35Å; F88-E91 WeakPolarHBondContact O-CB 3.5Å; F88-E91 PolarHBondContact O-N 3.08Å; I89-E91 VanDerWaalsContact C-N 3.34Å; I89-E91 PolarHBondContact O-N 3.42Å; E91-I93 VanDerWaalsContact C-N 3.3Å; E91-I93 PolarHBondContact O-N 2.93Å; E91-G94 PolarHBondContact O-N 3.5Å; E91-G94 VanDerWaalsContact O-N 3.15Å; E91-K95 WeakPolarHBondContact O-CB 3.36Å; E91-K95 WeakPolarHBondContact O-CG 3.39Å; E91-K95 PolarHBondContact O-N 3.22Å; E91-K95 IonicContact OE1-NZ 2.72Å
92	C	96.1	Very high	94.8	Very high	36 Å²	36	94.7 Å²	94.7	24%	0.243	53%	0.527	C	S	.	.	H	α-helix	trans	-59.8	-39.4	175.8	-73.8	0	0	0	0	112.6	F88 I89 G96 G97	F88-C92 PolarHBondContact O-N 2.88Å; F88-C92 PolarHBondContact O-SG 2.94Å; F88-C92 VanDerWaalsContact O-SG 3.41Å; I89-C92 WeakPolarHBondContact O-CB 3.47Å; I89-C92 PolarHBondContact O-N 3.37Å; C92-G96 PolarHBondContact O-N 2.75Å; C92-G97 PolarHBondContact O-N 3.35Å
93	I	95.1	Very high	94.1	Very high	130 Å²	130	98.6 Å²	98.6	67%	0.667	56%	0.558	S	S	*	*	H	α-helix	trans	-66.1	-47.2	173	-64.9	166.8	0	0	0	110.1	I89 G90 E91 K95 G96	I89-I93 HydrophobicContact CG2-CD1 4.21Å; I89-I93 WeakPolarHBondContact O-CG1 3.42Å; I89-I93 PolarHBondContact O-N 2.98Å; G90-I93 PolarHBondContact O-N 3.48Å; E91-I93 VanDerWaalsContact C-N 3.3Å; E91-I93 PolarHBondContact O-N 2.93Å; I93-K95 PolarHBondContact O-N 3.43Å; I93-G96 PolarHBondContact O-N 2.92Å
94	G	94.9	Very high	94.1	Very high	72 Å²	72	98.9 Å²	98.9	74%	0.742	56%	0.558	S	S	*	*	H	α-helix	trans	-64.3	-37.1	-177.6	0	0	0	0	0	114	G90 E91 G96	G90-G94 PolarHBondContact O-N 2.9Å; E91-G94 PolarHBondContact O-N 3.5Å; E91-G94 VanDerWaalsContact O-N 3.15Å; G94-G96 VanDerWaalsContact C-N 3.35Å
95	K	94.9	Very high	93.9	Very high	44 Å²	44	99.3 Å²	99.3	19%	0.191	56%	0.562	C	S	.	*	H	α-helix	trans	-81.7	-13.2	175.6	78.5	-165.8	-173.8	-169	0	113.7	E91 I93 G97 G100 Y101	E91-K95 WeakPolarHBondContact O-CB 3.36Å; E91-K95 WeakPolarHBondContact O-CG 3.39Å; E91-K95 PolarHBondContact O-N 3.22Å; E91-K95 IonicContact OE1-NZ 2.72Å; I93-K95 PolarHBondContact O-N 3.43Å; K95-G97 WeakPolarHBondContact CE-O 3.19Å; K95-G100 WeakPolarHBondContact CD-O 3.48Å; K95-G100 WeakPolarHBondContact CE-O 3.18Å; K95-Y101 HydrophobicContact CB-CD1 3.67Å; K95-Y101 HydrophobicContact CB-CE1 3.46Å; K95-Y101 VanDerWaalsContact CB-CE1 3.46Å; K95-Y101 HydrophobicContact CD-CE1 4.41Å
96	G	94.4	Very high	93.7	Very high	71 Å²	71	99.7 Å²	99.7	73%	0.732	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.3	25.7	178.6	0	0	0	0	0	114.8	C92 I93 G94	C92-G96 PolarHBondContact O-N 2.75Å; I93-G96 PolarHBondContact O-N 2.92Å; G94-G96 VanDerWaalsContact C-N 3.35Å
97	G	93.1	Very high	93.6	Very high	28 Å²	28	97.8 Å²	97.8	29%	0.289	57%	0.572	S	S	.	*	S	Bend	trans	-163.1	157.7	-176.6	0	0	0	0	0	112.9	C92 K95	C92-G97 PolarHBondContact O-N 3.35Å; K95-G97 WeakPolarHBondContact CE-O 3.19Å
98	L	93.8	Very high	93.5	Very high	152 Å²	152	94.9 Å²	94.9	80%	0.796	57%	0.568	S	S	*	*	S	Bend	trans	-83.7	-28.7	177.1	-64.5	180	0	0	0	112.4
99	I	94.4	Very high	93.3	Very high	164 Å²	164	95.1 Å²	95.1	84%	0.841	58%	0.58	S	S	*	*	S	Bend	trans	-125.5	119.8	-171.3	-55.7	174.5	0	0	0	109.1
100	G	91.9	Very high	93.1	Very high	44 Å²	44	96.4 Å²	96.4	45%	0.454	59%	0.592	S	S	.	*	S	Bend	trans	60.9	-176.9	176.3	0	0	0	0	0	114.3	K95	K95-G100 WeakPolarHBondContact CD-O 3.48Å; K95-G100 WeakPolarHBondContact CE-O 3.18Å
101	Y	91.7	Very high	92.9	Very high	147 Å²	147	100.7 Å²	100.7	58%	0.576	61%	0.606	S	S	*	*			trans	-94.8	141.6	164.4	-75.4	-89.3	0	0	0	108.4	K95 V103	K95-Y101 HydrophobicContact CB-CD1 3.67Å; K95-Y101 HydrophobicContact CB-CE1 3.46Å; K95-Y101 VanDerWaalsContact CB-CE1 3.46Å; K95-Y101 HydrophobicContact CD-CE1 4.41Å; Y101-V103 VanDerWaalsContact C-N 3.32Å; Y101-V103 PolarHBondContact O-N 2.99Å; Y101-V103 VanDerWaalsContact O-N 3.08Å
102	N	88.2	Confident	92.6	Very high	168 Å²	168	104.2 Å²	104.2	90%	0.898	63%	0.634	S	S	*	*			trans	-80.8	84.4	171.2	-170.1	26.4	0	0	0	108.6
103	V	82.9	Confident	92.3	Very high	194 Å²	194	110.4 Å²	110.4	100%	1.176	67%	0.669	S	S	*	*			trans	-91.7	0	179.3	-64.9	0	0	0	0	112.2	Y101	Y101-V103 VanDerWaalsContact C-N 3.32Å; Y101-V103 PolarHBondContact O-N 2.99Å; Y101-V103 VanDerWaalsContact O-N 3.08Å

Retrieved 103 of 103 residues in 154.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).