A0A3B3VSK8_9TELE Loading...

Cytochrome c oxidase assembly factor 3

Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly. Required for assembly of cytochrome c oxidase (complex IV).

AlphaFold DB , UniProt , Accession A0A3B3VSK8, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 99 aa.

						>A0A3B3VSK8_9TELE|A0A3B3VSK8
MAEKKPPKSDSPFATRIYPAKENLSRDQMHFIKQAELEQWKKKTSKLRTRNVATGLAIGALVLGIYGYTFYSVSQERIMDEIDEEAKRARLKGPKTGAN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.7	Very low	55.7	Low	248 Å²	248	149.5 Å²	149.5	100%	1.222	80%	0.796	S	S	*	*				0	114.9	0	-78.7	152	156.7	0	0	107.5
2	A	49.6	Very low	56.2	Low	104 Å²	104	148 Å²	148	86%	0.86	80%	0.801	S	S	*	*			trans	-78.3	125.3	-176.7	0	0	0	0	0	110.5	K4	A2-K4 PolarHBondContact O-N 3.2Å
3	E	49.9	Very low	56.6	Low	183 Å²	183	148.1 Å²	148.1	86%	0.855	79%	0.79	S	S	*	*			trans	-64	102.1	169.1	-77	-178.1	163.5	0	0	109.6	K5	E3-K5 PolarHBondContact O-N 3.49Å; E3-K5 VanDerWaalsContact O-N 3.12Å
4	K	52.3	Low	57.3	Low	205 Å²	205	145 Å²	145	89%	0.891	80%	0.795	S	S	*	*			trans	-71.9	100.3	166.9	-117.9	178.1	178	177.4	0	107.5	A2	A2-K4 PolarHBondContact O-N 3.2Å
5	K	60	Low	58	Low	183 Å²	183	143.4 Å²	143.4	80%	0.796	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-57.4	136.7	167.3	-75.8	179.2	-179.6	174.2	0	109	E3	E3-K5 PolarHBondContact O-N 3.49Å; E3-K5 VanDerWaalsContact O-N 3.12Å
6	P	60.4	Low	58.6	Low	112 Å²	112	146.2 Å²	146.2	73%	0.727	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-61.6	146.8	-179.1	25	-32.8	0	0	0	110.6	K8	P6-K8 PolarHBondContact O-N 3.29Å
7	P	57.8	Low	59.2	Low	124 Å²	124	142.6 Å²	142.6	81%	0.805	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-59.2	133	178.2	24.7	-32.2	0	0	0	109.6	S9	P7-S9 PolarHBondContact O-N 2.97Å; P7-S9 VanDerWaalsContact O-N 3.11Å
8	K	60.1	Low	59.8	Low	198 Å²	198	140.5 Å²	140.5	86%	0.861	75%	0.746	S	S	*	*			trans	-59	115.8	171.9	-73	178.4	177.4	173.6	0	107.3	P6	P6-K8 PolarHBondContact O-N 3.29Å
9	S	59.1	Low	60.4	Low	74 Å²	74	136.4 Å²	136.4	52%	0.517	73%	0.729	S	S	.	*			trans	-78.9	124	174.1	73	0	0	0	0	109.2	P7 S11 F13	P7-S9 PolarHBondContact O-N 2.97Å; P7-S9 VanDerWaalsContact O-N 3.11Å; S9-S11 PolarHBondContact O-N 3.29Å; S9-S11 PolarHBondContact OG-OG 3.47Å; S9-F13 WeakPolarHBondContact OG-CE2 3.27Å
10	D	60.8	Low	61	Low	163 Å²	163	134.9 Å²	134.9	87%	0.872	74%	0.736	S	S	*	*			trans	-75.3	25.5	176.8	-67.9	-40.3	0	0	0	113
11	S	59.9	Low	61.5	Low	50 Å²	50	136.9 Å²	136.9	35%	0.35	74%	0.737	S	S	.	*	S	Bend	trans	-75.6	131	170.4	43.8	0	0	0	0	108.3	S9 F13	S9-S11 PolarHBondContact O-N 3.29Å; S9-S11 PolarHBondContact OG-OG 3.47Å; S11-F13 PolarHBondContact O-N 3.04Å; S11-F13 WeakPolarHBondContact OG-CD2 3.47Å; S11-F13 WeakPolarHBondContact OG-CE2 3.38Å; S11-F13 WeakPolarHBondContact OG-CZ 3.46Å
12	P	61.6	Low	62.9	Low	132 Å²	132	129 Å²	129	86%	0.857	70%	0.697	S	S	*	*			trans	-70.4	77.4	174.8	29.5	-32.8	0	0	0	108.6	A14	P12-A14 PolarHBondContact O-N 3.09Å
13	F	61.3	Low	64.1	Low	149 Å²	149	132.5 Å²	132.5	65%	0.654	70%	0.702	S	S	*	*			trans	-64.3	133.5	165.4	-63.6	-63.1	0	0	0	106.9	S9 S11 T15	S9-F13 WeakPolarHBondContact OG-CE2 3.27Å; S11-F13 PolarHBondContact O-N 3.04Å; S11-F13 WeakPolarHBondContact OG-CD2 3.47Å; S11-F13 WeakPolarHBondContact OG-CE2 3.38Å; S11-F13 WeakPolarHBondContact OG-CZ 3.46Å; F13-T15 PolarHBondContact O-N 3.25Å
14	A	66.6	Low	65.3	Low	105 Å²	105	125.3 Å²	125.3	87%	0.868	67%	0.669	S	S	*	*			trans	-54.8	107.5	170.1	0	0	0	0	0	107.6	P12 R16	P12-A14 PolarHBondContact O-N 3.09Å; A14-R16 PolarHBondContact O-N 2.97Å
15	T	68.4	Low	66.8	Low	121 Å²	121	118.5 Å²	118.5	74%	0.742	65%	0.647	S	S	*	*			trans	-66.5	132.8	178.6	-61.8	0	0	0	0	106.7	F13 I17	F13-T15 PolarHBondContact O-N 3.25Å; T15-I17 PolarHBondContact O-N 2.89Å
16	R	66.7	Low	67.9	Low	188 Å²	188	119.3 Å²	119.3	71%	0.709	65%	0.645	S	S	*	*			trans	-67.5	97.8	179	-173.6	-179.6	-171.3	-170.1	5.3	108.5	A14 Y18	A14-R16 PolarHBondContact O-N 2.97Å; R16-Y18 HydrophobicContact CG-CE2 4.32Å; R16-Y18 PolarHBondContact NH1-OH 3.41Å; R16-Y18 VanDerWaalsContact NH1-OH 3.12Å; R16-Y18 PolarHBondContact O-N 3.02Å
17	I	69.1	Low	69	Low	86 Å²	86	120 Å²	120	44%	0.441	64%	0.643	S	S	.	*			trans	-67.2	129.6	176	-67.9	168.4	0	0	0	108.4	T15 P19 E22 L24	T15-I17 PolarHBondContact O-N 2.89Å; I17-P19 WeakPolarHBondContact O-CD 3.25Å; I17-E22 WeakPolarHBondContact CA-OE1 3.37Å; I17-E22 WeakPolarHBondContact CG2-OE2 3.5Å; I17-L24 HydrophobicContact CG2-CD1 4.29Å; I17-L24 HydrophobicContact CG2-CD2 4.48Å
18	Y	70.2	Confident	70.2	Confident	104 Å²	104	119 Å²	119	41%	0.408	63%	0.627	S	S	.	*			trans	-102.3	101.8	169.7	-75.1	-82.9	0	0	0	108.9	R16 A20 K21 E22	R16-Y18 HydrophobicContact CG-CE2 4.32Å; R16-Y18 PolarHBondContact NH1-OH 3.41Å; R16-Y18 VanDerWaalsContact NH1-OH 3.12Å; R16-Y18 PolarHBondContact O-N 3.02Å; Y18-A20 PolarHBondContact O-N 3.43Å; Y18-K21 PolarHBondContact O-N 3.45Å; Y18-E22 PolarHBondContact N-OE1 3.01Å; Y18-E22 VanDerWaalsContact N-OE1 3.08Å; Y18-E22 PolarHBondContact O-N 2.98Å
19	P	70.9	Confident	71.4	Confident	63 Å²	63	113 Å²	113	41%	0.409	60%	0.603	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.3	-24.6	-170.9	-23.2	32.6	0	0	0	114.5	I17 L24	I17-P19 WeakPolarHBondContact O-CD 3.25Å; P19-L24 HydrophobicContact CB-CD1 3.9Å
20	A	72.8	Confident	72.7	Confident	105 Å²	105	115 Å²	115	87%	0.868	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-11.8	179	0	0	0	0	0	114.3	Y18	Y18-A20 PolarHBondContact O-N 3.43Å
21	K	71.4	Confident	74	Confident	178 Å²	178	114.1 Å²	114.1	77%	0.774	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.3	-14.4	-175.7	-60.9	-171.2	179.7	-172.1	0	113.1	Y18	Y18-K21 PolarHBondContact O-N 3.45Å
22	E	72.8	Confident	75.3	Confident	81 Å²	81	113.8 Å²	113.8	38%	0.379	59%	0.587	S	S	.	*	S	Bend	trans	-106.3	142.9	-176.7	-71	175.5	-142.1	0	0	111.3	I17 Y18 L24	I17-E22 WeakPolarHBondContact CA-OE1 3.37Å; I17-E22 WeakPolarHBondContact CG2-OE2 3.5Å; Y18-E22 PolarHBondContact N-OE1 3.01Å; Y18-E22 VanDerWaalsContact N-OE1 3.08Å; Y18-E22 PolarHBondContact O-N 2.98Å; E22-L24 HydrophobicContact CB-CG 4.35Å; E22-L24 PolarHBondContact O-N 3.39Å
23	N	73.1	Confident	76.6	Confident	179 Å²	179	113.5 Å²	113.5	96%	0.957	57%	0.572	S	S	*	*			trans	-74.8	76.9	173.7	-82	-56.8	0	0	0	110.1
24	L	77	Confident	78	Confident	32 Å²	32	112 Å²	112	17%	0.168	57%	0.567	C	S	.	*			trans	-79.8	138.9	176.4	-72.2	161.4	0	0	0	111	I17 P19 E22 Q28 M29 I32	I17-L24 HydrophobicContact CG2-CD1 4.29Å; I17-L24 HydrophobicContact CG2-CD2 4.48Å; P19-L24 HydrophobicContact CB-CD1 3.9Å; E22-L24 HydrophobicContact CB-CG 4.35Å; E22-L24 PolarHBondContact O-N 3.39Å; L24-Q28 HydrophobicContact CD2-CB 4.13Å; L24-M29 HydrophobicContact CB-CG 3.95Å; L24-M29 HydrophobicContact CD1-CG 4.36Å; L24-I32 HydrophobicContact CD1-CD1 3.98Å; L24-I32 HydrophobicContact CD2-CD1 4.25Å
25	S	83	Confident	79.1	Confident	62 Å²	62	108.5 Å²	108.5	43%	0.434	54%	0.539	S	S	.	.			trans	-63.1	152.1	168.6	-179.5	0	0	0	0	110.6	D27 Q28 M29	S25-D27 PolarHBondContact O-N 3.2Å; S25-Q28 WeakPolarHBondContact O-CB 3.49Å; S25-Q28 PolarHBondContact O-N 3.04Å; S25-Q28 VanDerWaalsContact O-N 3.09Å; S25-M29 PolarHBondContact O-N 2.93Å
26	R	82.8	Confident	80.1	Confident	199 Å²	199	108 Å²	108	75%	0.751	53%	0.527	S	S	*	.	H	α-helix	trans	-53.7	-42.4	178	-81.9	-176.9	174.8	174.1	-1.1	111.9	Q28 M29 H30	R26-Q28 VanDerWaalsContact C-N 3.34Å; R26-Q28 PolarHBondContact O-N 2.91Å; R26-M29 HydrophobicContact CG-CE 4.2Å; R26-M29 PolarHBondContact O-N 3Å; R26-H30 PolarHBondContact O-CD2 2.89Å; R26-H30 PolarHBondContact O-N 3.35Å
27	D	84.3	Confident	81.3	Confident	126 Å²	126	103.7 Å²	103.7	67%	0.674	52%	0.518	S	S	*	.	H	α-helix	trans	-66.7	-37.4	-179.3	-61	-24.3	0	0	0	112	S25 H30 F31	S25-D27 PolarHBondContact O-N 3.2Å; D27-H30 PolarHBondContact O-N 3.47Å; D27-F31 PolarHBondContact O-N 3.21Å
28	Q	82.6	Confident	82.4	Confident	103 Å²	103	105.1 Å²	105.1	48%	0.481	52%	0.523	S	S	.	.	H	α-helix	trans	-65.5	-42	175.5	-67.4	173.6	-38.2	0	0	111.3	L24 S25 R26 H30 F31 I32	L24-Q28 HydrophobicContact CD2-CB 4.13Å; S25-Q28 WeakPolarHBondContact O-CB 3.49Å; S25-Q28 PolarHBondContact O-N 3.04Å; S25-Q28 VanDerWaalsContact O-N 3.09Å; R26-Q28 VanDerWaalsContact C-N 3.34Å; R26-Q28 PolarHBondContact O-N 2.91Å; Q28-H30 VanDerWaalsContact C-N 3.35Å; Q28-H30 PolarHBondContact O-N 3.26Å; Q28-F31 PolarHBondContact O-N 3.48Å; Q28-I32 WeakPolarHBondContact O-CD1 3.42Å; Q28-I32 VanDerWaalsContact O-CG1 3.25Å; Q28-I32 WeakPolarHBondContact O-CG1 3.4Å; Q28-I32 PolarHBondContact O-N 3.08Å
29	M	85	Confident	83.3	Confident	73 Å²	73	106.9 Å²	106.9	36%	0.36	54%	0.535	S	S	.	.	H	α-helix	trans	-62.4	-41	173.1	-79.9	-170.3	-62.5	0	0	112.5	L24 S25 R26 I32 K33	L24-M29 HydrophobicContact CB-CG 3.95Å; L24-M29 HydrophobicContact CD1-CG 4.36Å; S25-M29 PolarHBondContact O-N 2.93Å; R26-M29 HydrophobicContact CG-CE 4.2Å; R26-M29 PolarHBondContact O-N 3Å; M29-I32 PolarHBondContact O-N 2.83Å; M29-K33 WeakPolarHBondContact O-CG 3.4Å; M29-K33 PolarHBondContact O-N 2.97Å
30	H	86.6	Confident	84.3	Confident	115 Å²	115	112.3 Å²	112.3	53%	0.532	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-44.2	177.6	-87.9	-76	0	0	0	111.4	R26 D27 Q28 K33 Q34	R26-H30 PolarHBondContact O-CD2 2.89Å; R26-H30 PolarHBondContact O-N 3.35Å; D27-H30 PolarHBondContact O-N 3.47Å; Q28-H30 VanDerWaalsContact C-N 3.35Å; Q28-H30 PolarHBondContact O-N 3.26Å; H30-K33 PolarHBondContact O-N 2.96Å; H30-Q34 WeakPolarHBondContact O-CG 3.47Å; H30-Q34 PolarHBondContact O-N 3.45Å
31	F	88.6	Confident	85.2	Confident	146 Å²	146	114.1 Å²	114.1	64%	0.64	54%	0.536	S	S	*	.	H	α-helix	trans	-62.1	-46.9	176.1	-179.5	-99.7	0	0	0	112.4	D27 Q28 K33 Q34 A35	D27-F31 PolarHBondContact O-N 3.21Å; Q28-F31 PolarHBondContact O-N 3.48Å; F31-K33 VanDerWaalsContact C-N 3.34Å; F31-K33 PolarHBondContact O-N 3.38Å; F31-Q34 PolarHBondContact O-N 3.12Å; F31-A35 WeakPolarHBondContact O-CB 3.32Å; F31-A35 PolarHBondContact O-N 3.3Å
32	I	87.4	Confident	86.2	Confident	42 Å²	42	112.9 Å²	112.9	22%	0.215	53%	0.53	C	S	.	.	H	α-helix	trans	-58.2	-47	177.9	-69.3	164.6	0	0	0	110.6	L24 Q28 M29 Q34 A35 E36	L24-I32 HydrophobicContact CD1-CD1 3.98Å; L24-I32 HydrophobicContact CD2-CD1 4.25Å; Q28-I32 WeakPolarHBondContact O-CD1 3.42Å; Q28-I32 VanDerWaalsContact O-CG1 3.25Å; Q28-I32 WeakPolarHBondContact O-CG1 3.4Å; Q28-I32 PolarHBondContact O-N 3.08Å; M29-I32 PolarHBondContact O-N 2.83Å; I32-Q34 VanDerWaalsContact C-N 3.34Å; I32-Q34 PolarHBondContact O-N 3.41Å; I32-A35 PolarHBondContact O-N 3.39Å; I32-E36 HydrophobicContact CG2-CG 4.4Å; I32-E36 WeakPolarHBondContact O-CB 3.49Å; I32-E36 WeakPolarHBondContact O-CG 3.5Å; I32-E36 PolarHBondContact O-N 2.88Å
33	K	88.1	Confident	87.1	Confident	126 Å²	126	116 Å²	116	55%	0.548	54%	0.543	S	S	.	.	H	α-helix	trans	-60.8	-41.5	177.9	-75.9	178.7	-179.5	178.3	0	112.4	M29 H30 F31 L37	M29-K33 WeakPolarHBondContact O-CG 3.4Å; M29-K33 PolarHBondContact O-N 2.97Å; H30-K33 PolarHBondContact O-N 2.96Å; F31-K33 VanDerWaalsContact C-N 3.34Å; F31-K33 PolarHBondContact O-N 3.38Å; K33-L37 WeakPolarHBondContact O-CB 3.28Å; K33-L37 VanDerWaalsContact O-CG 3.27Å; K33-L37 WeakPolarHBondContact O-CG 3.4Å; K33-L37 PolarHBondContact O-N 2.98Å
34	Q	89.9	Confident	88	Confident	117 Å²	117	110.5 Å²	110.5	55%	0.547	52%	0.516	S	S	.	.	H	α-helix	trans	-64.7	-46.5	177.3	-73	179.6	12.3	0	0	111.4	H30 F31 I32 E36 L37 E38	H30-Q34 WeakPolarHBondContact O-CG 3.47Å; H30-Q34 PolarHBondContact O-N 3.45Å; F31-Q34 PolarHBondContact O-N 3.12Å; I32-Q34 VanDerWaalsContact C-N 3.34Å; I32-Q34 PolarHBondContact O-N 3.41Å; Q34-E36 PolarHBondContact O-N 2.87Å; Q34-L37 PolarHBondContact O-N 3.47Å; Q34-E38 WeakPolarHBondContact O-CG 3.43Å; Q34-E38 PolarHBondContact O-N 2.77Å
35	A	90.1	Very high	88.6	Confident	33 Å²	33	112.5 Å²	112.5	27%	0.273	53%	0.532	S	S	.	.	H	α-helix	trans	-61.7	-42.3	177.9	0	0	0	0	0	112.1	F31 I32 E38 Q39	F31-A35 WeakPolarHBondContact O-CB 3.32Å; F31-A35 PolarHBondContact O-N 3.3Å; I32-A35 PolarHBondContact O-N 3.39Å; A35-E38 PolarHBondContact O-N 2.89Å; A35-Q39 WeakPolarHBondContact O-CB 3.28Å; A35-Q39 WeakPolarHBondContact O-CG 3.42Å; A35-Q39 PolarHBondContact O-N 3.42Å
36	E	88.9	Confident	89.1	Confident	109 Å²	109	116.4 Å²	116.4	51%	0.509	54%	0.541	S	S	.	.	H	α-helix	trans	-61.6	-44.8	174.9	-77.6	-177.4	170.5	0	0	111.9	I32 Q34 E38 Q39 W40	I32-E36 HydrophobicContact CG2-CG 4.4Å; I32-E36 WeakPolarHBondContact O-CB 3.49Å; I32-E36 WeakPolarHBondContact O-CG 3.5Å; I32-E36 PolarHBondContact O-N 2.88Å; Q34-E36 PolarHBondContact O-N 2.87Å; E36-E38 PolarHBondContact O-N 3.42Å; E36-Q39 PolarHBondContact O-N 2.95Å; E36-W40 VanDerWaalsContact O-CB 3.28Å; E36-W40 WeakPolarHBondContact O-CB 3.25Å; E36-W40 PolarHBondContact O-N 3.32Å
37	L	92.3	Very high	89.6	Confident	99 Å²	99	110.8 Å²	110.8	52%	0.518	53%	0.526	S	S	.	.	H	α-helix	trans	-61.8	-42.5	177.3	-75.6	173.1	0	0	0	111.9	K33 Q34 W40 K41	K33-L37 WeakPolarHBondContact O-CB 3.28Å; K33-L37 VanDerWaalsContact O-CG 3.27Å; K33-L37 WeakPolarHBondContact O-CG 3.4Å; K33-L37 PolarHBondContact O-N 2.98Å; Q34-L37 PolarHBondContact O-N 3.47Å; L37-W40 PolarHBondContact O-N 3.48Å; L37-K41 WeakPolarHBondContact O-CB 3.31Å; L37-K41 VanDerWaalsContact O-CG 3.28Å; L37-K41 WeakPolarHBondContact O-CG 3.35Å; L37-K41 PolarHBondContact O-N 3.49Å
38	E	91.9	Very high	90	Very high	116 Å²	116	113.8 Å²	113.8	54%	0.542	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-44.3	176.6	-73.9	-171.4	-180	0	0	112.4	Q34 A35 E36 W40 K41 K42	Q34-E38 WeakPolarHBondContact O-CG 3.43Å; Q34-E38 PolarHBondContact O-N 2.77Å; A35-E38 PolarHBondContact O-N 2.89Å; E36-E38 PolarHBondContact O-N 3.42Å; E38-W40 VanDerWaalsContact C-N 3.31Å; E38-W40 PolarHBondContact O-N 3.38Å; E38-K41 PolarHBondContact O-N 2.91Å; E38-K42 WeakPolarHBondContact O-CB 3.34Å; E38-K42 WeakPolarHBondContact O-CG 3.5Å; E38-K42 PolarHBondContact O-N 3.44Å
39	Q	90.6	Very high	90.6	Very high	140 Å²	140	113.3 Å²	113.3	65%	0.654	53%	0.532	S	S	*	.	H	α-helix	trans	-61.8	-42.3	175.3	-74.3	-174.8	-3.5	0	0	111.3	A35 E36 K42 K43	A35-Q39 WeakPolarHBondContact O-CB 3.28Å; A35-Q39 WeakPolarHBondContact O-CG 3.42Å; A35-Q39 PolarHBondContact O-N 3.42Å; E36-Q39 PolarHBondContact O-N 2.95Å; Q39-K42 PolarHBondContact O-N 3.05Å; Q39-K43 VanDerWaalsContact O-CB 3.31Å; Q39-K43 WeakPolarHBondContact O-CB 3.35Å; Q39-K43 PolarHBondContact O-N 3.26Å
40	W	91.3	Very high	91.2	Very high	177 Å²	177	117.2 Å²	117.2	67%	0.67	54%	0.543	S	S	*	.	H	α-helix	trans	-64.9	-43.4	178.6	-167.8	69	0	0	0	111.7	E36 L37 E38 K43 T44	E36-W40 VanDerWaalsContact O-CB 3.28Å; E36-W40 WeakPolarHBondContact O-CB 3.25Å; E36-W40 PolarHBondContact O-N 3.32Å; L37-W40 PolarHBondContact O-N 3.48Å; E38-W40 VanDerWaalsContact C-N 3.31Å; E38-W40 PolarHBondContact O-N 3.38Å; W40-K43 PolarHBondContact O-N 2.95Å; W40-T44 VanDerWaalsContact O-CB 3.25Å; W40-T44 WeakPolarHBondContact O-CB 3.35Å; W40-T44 PolarHBondContact O-N 3.27Å; W40-T44 PolarHBondContact O-OG1 3.42Å
41	K	91.8	Very high	91.7	Very high	144 Å²	144	117.2 Å²	117.2	63%	0.626	55%	0.546	S	S	*	.	H	α-helix	trans	-59.4	-49.2	174	-76.6	176.9	-177.9	-178.5	0	111.8	L37 E38 K43 T44 S45	L37-K41 WeakPolarHBondContact O-CB 3.31Å; L37-K41 VanDerWaalsContact O-CG 3.28Å; L37-K41 WeakPolarHBondContact O-CG 3.35Å; L37-K41 PolarHBondContact O-N 3.49Å; E38-K41 PolarHBondContact O-N 2.91Å; K41-K43 PolarHBondContact O-N 2.95Å; K41-T44 PolarHBondContact O-N 3.34Å; K41-S45 WeakPolarHBondContact O-CB 3.33Å; K41-S45 PolarHBondContact O-N 2.95Å
42	K	91.3	Very high	92.1	Very high	152 Å²	152	114.1 Å²	114.1	66%	0.661	54%	0.539	S	S	*	.	H	α-helix	trans	-60.3	-46.3	178.3	-75.3	178.7	-178.6	175.2	0	111.7	E38 Q39 K46	E38-K42 WeakPolarHBondContact O-CB 3.34Å; E38-K42 WeakPolarHBondContact O-CG 3.5Å; E38-K42 PolarHBondContact O-N 3.44Å; Q39-K42 PolarHBondContact O-N 3.05Å; K42-K46 WeakPolarHBondContact O-CB 3.4Å; K42-K46 PolarHBondContact O-N 3.41Å
43	K	92.1	Very high	92.6	Very high	147 Å²	147	114.7 Å²	114.7	64%	0.639	55%	0.55	S	S	*	*	H	α-helix	trans	-65.3	-44.1	-179.6	-167.5	175	-177	-178.5	0	111.6	Q39 W40 K41 K46 L47	Q39-K43 VanDerWaalsContact O-CB 3.31Å; Q39-K43 WeakPolarHBondContact O-CB 3.35Å; Q39-K43 PolarHBondContact O-N 3.26Å; W40-K43 PolarHBondContact O-N 2.95Å; K41-K43 PolarHBondContact O-N 2.95Å; K43-K46 PolarHBondContact O-N 3.46Å; K43-L47 HydrophobicContact CG-CD1 4.29Å; K43-L47 WeakPolarHBondContact O-CG 3.45Å; K43-L47 PolarHBondContact O-N 2.94Å
44	T	92	Very high	93.1	Very high	63 Å²	63	112.5 Å²	112.5	39%	0.387	55%	0.548	S	S	.	.	H	α-helix	trans	-65.1	-45.5	179.9	-58.4	0	0	0	0	111.4	W40 K41 K46 L47 R48	W40-T44 VanDerWaalsContact O-CB 3.25Å; W40-T44 WeakPolarHBondContact O-CB 3.35Å; W40-T44 PolarHBondContact O-N 3.27Å; W40-T44 PolarHBondContact O-OG1 3.42Å; K41-T44 PolarHBondContact O-N 3.34Å; T44-K46 PolarHBondContact O-N 3.32Å; T44-L47 PolarHBondContact O-N 3.49Å; T44-R48 WeakPolarHBondContact O-CB 3.39Å; T44-R48 PolarHBondContact O-N 2.85Å
45	S	90.2	Very high	93.5	Very high	73 Å²	73	109 Å²	109	51%	0.51	54%	0.542	S	S	.	.	H	α-helix	trans	-58.7	-47.6	175.8	-178.4	0	0	0	0	111.5	K41 L47 R48 T49	K41-S45 WeakPolarHBondContact O-CB 3.33Å; K41-S45 PolarHBondContact O-N 2.95Å; S45-L47 PolarHBondContact O-N 3.43Å; S45-R48 PolarHBondContact O-N 3.39Å; S45-T49 PolarHBondContact O-N 3.4Å; S45-T49 PolarHBondContact O-OG1 2.69Å; S45-T49 VanDerWaalsContact O-OG1 3.12Å
46	K	92.4	Very high	93.9	Very high	144 Å²	144	113.2 Å²	113.2	63%	0.626	56%	0.56	S	S	*	*	H	α-helix	trans	-60	-43.2	178.1	-174.2	172.3	-176.6	174.3	0	112.8	K42 K43 T44 R50	K42-K46 WeakPolarHBondContact O-CB 3.4Å; K42-K46 PolarHBondContact O-N 3.41Å; K43-K46 PolarHBondContact O-N 3.46Å; T44-K46 PolarHBondContact O-N 3.32Å; K46-R50 WeakPolarHBondContact O-CG 3.33Å; K46-R50 PolarHBondContact O-N 3.48Å; K46-R50 VanDerWaalsContact O-N 3.15Å
47	L	93.4	Very high	94.4	Very high	82 Å²	82	111 Å²	111	43%	0.429	56%	0.56	S	S	.	*	H	α-helix	trans	-65.7	-43.9	177.9	-72.7	171.8	0	0	0	111.6	K43 T44 S45 T49 R50 N51	K43-L47 HydrophobicContact CG-CD1 4.29Å; K43-L47 WeakPolarHBondContact O-CG 3.45Å; K43-L47 PolarHBondContact O-N 2.94Å; T44-L47 PolarHBondContact O-N 3.49Å; S45-L47 PolarHBondContact O-N 3.43Å; L47-T49 PolarHBondContact O-N 3.15Å; L47-R50 PolarHBondContact O-N 3.12Å; L47-N51 VanDerWaalsContact O-CG 3.25Å; L47-N51 PolarHBondContact O-N 2.89Å; L47-N51 PolarHBondContact O-OD1 2.97Å
48	R	94.1	Very high	94.7	Very high	189 Å²	189	111.1 Å²	111.1	71%	0.713	56%	0.56	S	S	*	*	H	α-helix	trans	-60.3	-47.2	177.6	-179	176.6	159.9	-167.2	-6	111.7	T44 S45 R50 N51 V52	T44-R48 WeakPolarHBondContact O-CB 3.39Å; T44-R48 PolarHBondContact O-N 2.85Å; S45-R48 PolarHBondContact O-N 3.39Å; R48-R50 VanDerWaalsContact C-N 3.33Å; R48-R50 PolarHBondContact O-N 3Å; R48-N51 PolarHBondContact O-N 3.24Å; R48-V52 WeakPolarHBondContact O-CG2 3.15Å; R48-V52 PolarHBondContact O-N 2.99Å
49	T	95.5	Very high	95	Very high	92 Å²	92	107 Å²	107	56%	0.564	55%	0.549	S	S	*	.	H	α-helix	trans	-61.1	-42.5	178.5	-57.3	0	0	0	0	111.8	S45 L47 V52 A53	S45-T49 PolarHBondContact O-N 3.4Å; S45-T49 PolarHBondContact O-OG1 2.69Å; S45-T49 VanDerWaalsContact O-OG1 3.12Å; L47-T49 PolarHBondContact O-N 3.15Å; T49-V52 PolarHBondContact O-N 3.3Å; T49-A53 WeakPolarHBondContact O-CB 3.01Å; T49-A53 PolarHBondContact O-N 3.44Å
50	R	96.1	Very high	95.3	Very high	156 Å²	156	103.4 Å²	103.4	59%	0.589	54%	0.543	S	S	*	.	H	α-helix	trans	-62.3	-45.3	176.3	-73.1	176.1	67.5	-178.2	2.9	111.7	K46 L47 R48 V52 A53 T54	K46-R50 WeakPolarHBondContact O-CG 3.33Å; K46-R50 PolarHBondContact O-N 3.48Å; K46-R50 VanDerWaalsContact O-N 3.15Å; L47-R50 PolarHBondContact O-N 3.12Å; R48-R50 VanDerWaalsContact C-N 3.33Å; R48-R50 PolarHBondContact O-N 3Å; R50-V52 VanDerWaalsContact C-N 3.34Å; R50-V52 PolarHBondContact O-N 3.48Å; R50-A53 PolarHBondContact O-N 3.5Å; R50-T54 WeakPolarHBondContact O-CB 3.4Å; R50-T54 PolarHBondContact O-N 3.02Å; R50-T54 PolarHBondContact O-OG1 2.91Å
51	N	97.3	Very high	95.7	Very high	114 Å²	114	100.3 Å²	100.3	61%	0.61	54%	0.539	S	S	*	.	H	α-helix	trans	-64	-40.7	179.9	-69.2	-0.3	0	0	0	111.8	L47 R48 T54 G55	L47-N51 VanDerWaalsContact O-CG 3.25Å; L47-N51 PolarHBondContact O-N 2.89Å; L47-N51 PolarHBondContact O-OD1 2.97Å; R48-N51 PolarHBondContact O-N 3.24Å; N51-T54 PolarHBondContact O-N 2.89Å; N51-G55 PolarHBondContact O-N 3.43Å
52	V	97.9	Very high	96	Very high	82 Å²	82	96.6 Å²	96.6	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-62.6	-48.7	174.6	171.5	0	0	0	0	110.6	R48 T49 R50 T54 G55 L56	R48-V52 WeakPolarHBondContact O-CG2 3.15Å; R48-V52 PolarHBondContact O-N 2.99Å; T49-V52 PolarHBondContact O-N 3.3Å; R50-V52 VanDerWaalsContact C-N 3.34Å; R50-V52 PolarHBondContact O-N 3.48Å; V52-T54 VanDerWaalsContact C-N 3.35Å; V52-T54 PolarHBondContact O-N 3.04Å; V52-G55 PolarHBondContact O-N 2.87Å; V52-L56 HydrophobicContact CG1-CD1 4.04Å; V52-L56 HydrophobicContact CG1-CG 4.41Å; V52-L56 WeakPolarHBondContact O-CG 3.37Å; V52-L56 PolarHBondContact O-N 2.93Å
53	A	98.3	Very high	96.3	Very high	54 Å²	54	95.7 Å²	95.7	45%	0.446	53%	0.53	S	S	.	.	H	α-helix	trans	-60.1	-44.2	179	0	0	0	0	0	112	T49 R50 L56 A57	T49-A53 WeakPolarHBondContact O-CB 3.01Å; T49-A53 PolarHBondContact O-N 3.44Å; R50-A53 PolarHBondContact O-N 3.5Å; A53-L56 PolarHBondContact O-N 3.29Å; A53-A57 WeakPolarHBondContact O-CB 2.89Å; A53-A57 PolarHBondContact O-N 3.01Å
54	T	98.1	Very high	96.5	Very high	80 Å²	80	90.7 Å²	90.7	49%	0.491	52%	0.52	S	S	.	.	H	α-helix	trans	-63.5	-43.6	176	-60.2	0	0	0	0	111.6	R50 N51 V52 L56 A57 I58	R50-T54 WeakPolarHBondContact O-CB 3.4Å; R50-T54 PolarHBondContact O-N 3.02Å; R50-T54 PolarHBondContact O-OG1 2.91Å; N51-T54 PolarHBondContact O-N 2.89Å; V52-T54 VanDerWaalsContact C-N 3.35Å; V52-T54 PolarHBondContact O-N 3.04Å; T54-L56 PolarHBondContact O-N 2.86Å; T54-A57 PolarHBondContact O-N 2.96Å; T54-I58 HydrophobicContact CG2-CD1 3.88Å; T54-I58 HydrophobicContact CG2-CG1 4.5Å; T54-I58 WeakPolarHBondContact O-CG1 3.3Å; T54-I58 PolarHBondContact O-N 3.41Å
55	G	98.3	Very high	96.7	Very high	42 Å²	42	92.2 Å²	92.2	43%	0.433	53%	0.525	S	S	.	.	H	α-helix	trans	-61	-43	176.5	0	0	0	0	0	112.7	N51 V52 I58 G59	N51-G55 PolarHBondContact O-N 3.43Å; V52-G55 PolarHBondContact O-N 2.87Å; G55-I58 PolarHBondContact O-N 3.29Å; G55-G59 PolarHBondContact O-N 3.4Å
56	L	98.6	Very high	96.9	Very high	122 Å²	122	96 Å²	96	64%	0.639	53%	0.529	S	S	*	.	H	α-helix	trans	-64.4	-42	175.5	-70.9	175.1	0	0	0	112.2	V52 A53 T54 G59 A60	V52-L56 HydrophobicContact CG1-CD1 4.04Å; V52-L56 HydrophobicContact CG1-CG 4.41Å; V52-L56 WeakPolarHBondContact O-CG 3.37Å; V52-L56 PolarHBondContact O-N 2.93Å; A53-L56 PolarHBondContact O-N 3.29Å; T54-L56 PolarHBondContact O-N 2.86Å; L56-G59 PolarHBondContact O-N 3.35Å; L56-A60 WeakPolarHBondContact O-CB 3.34Å; L56-A60 PolarHBondContact O-N 3.34Å
57	A	98.5	Very high	97	Very high	62 Å²	62	91 Å²	91	51%	0.512	52%	0.518	S	S	.	.	H	α-helix	trans	-62.5	-45.6	177.7	0	0	0	0	0	111.8	A53 T54 A60 L61	A53-A57 WeakPolarHBondContact O-CB 2.89Å; A53-A57 PolarHBondContact O-N 3.01Å; T54-A57 PolarHBondContact O-N 2.96Å; A57-A60 PolarHBondContact O-N 3.26Å; A57-L61 WeakPolarHBondContact O-CB 3.44Å; A57-L61 PolarHBondContact O-N 3.46Å
58	I	98.5	Very high	96.9	Very high	102 Å²	102	94.6 Å²	94.6	52%	0.523	53%	0.527	S	S	.	.	H	α-helix	trans	-63.4	-45.5	176.1	-66.1	168.4	0	0	0	110.2	T54 G55 A60 L61 V62	T54-I58 HydrophobicContact CG2-CD1 3.88Å; T54-I58 HydrophobicContact CG2-CG1 4.5Å; T54-I58 WeakPolarHBondContact O-CG1 3.3Å; T54-I58 PolarHBondContact O-N 3.41Å; G55-I58 PolarHBondContact O-N 3.29Å; I58-A60 PolarHBondContact O-N 2.98Å; I58-L61 WeakPolarHBondContact O-CB 3.01Å; I58-L61 PolarHBondContact O-N 3.36Å; I58-V62 HydrophobicContact CG2-CG2 4.43Å; I58-V62 WeakPolarHBondContact O-CG2 3.33Å; I58-V62 PolarHBondContact O-N 3.11Å
59	G	98.3	Very high	96.6	Very high	30 Å²	30	88.8 Å²	88.8	31%	0.309	51%	0.513	S	S	.	.	H	α-helix	trans	-59	-46.4	178	0	0	0	0	0	112.6	G55 L56 L61 V62 L63	G55-G59 PolarHBondContact O-N 3.4Å; L56-G59 PolarHBondContact O-N 3.35Å; G59-L61 PolarHBondContact O-N 2.98Å; G59-V62 PolarHBondContact O-N 3.24Å; G59-L63 WeakPolarHBondContact O-CB 3.37Å; G59-L63 VanDerWaalsContact O-CG 3.3Å; G59-L63 WeakPolarHBondContact O-CG 3.36Å; G59-L63 PolarHBondContact O-N 3Å
60	A	98.4	Very high	96	Very high	64 Å²	64	91.4 Å²	91.4	53%	0.529	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-40.3	177	0	0	0	0	0	112.2	L56 A57 I58 G64	L56-A60 WeakPolarHBondContact O-CB 3.34Å; L56-A60 PolarHBondContact O-N 3.34Å; A57-A60 PolarHBondContact O-N 3.26Å; I58-A60 PolarHBondContact O-N 2.98Å; A60-G64 PolarHBondContact O-N 3.12Å
61	L	98.2	Very high	95.3	Very high	113 Å²	113	91 Å²	91	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-61.4	-48.9	175.9	-178.3	71.3	0	0	0	111.4	A57 I58 G59 G64 I65	A57-L61 WeakPolarHBondContact O-CB 3.44Å; A57-L61 PolarHBondContact O-N 3.46Å; I58-L61 WeakPolarHBondContact O-CB 3.01Å; I58-L61 PolarHBondContact O-N 3.36Å; G59-L61 PolarHBondContact O-N 2.98Å; L61-G64 PolarHBondContact O-N 3.47Å; L61-I65 HydrophobicContact CD1-CD1 4.42Å; L61-I65 HydrophobicContact CG-CD1 4.17Å; L61-I65 WeakPolarHBondContact O-CG1 3.42Å; L61-I65 PolarHBondContact O-N 2.85Å
62	V	98.1	Very high	94.3	Very high	66 Å²	66	87.2 Å²	87.2	40%	0.4	50%	0.499	S	S	.	.	H	α-helix	trans	-61.7	-49.5	179.4	172.9	0	0	0	0	110.4	I58 G59 G64 I65 Y66	I58-V62 HydrophobicContact CG2-CG2 4.43Å; I58-V62 WeakPolarHBondContact O-CG2 3.33Å; I58-V62 PolarHBondContact O-N 3.11Å; G59-V62 PolarHBondContact O-N 3.24Å; V62-G64 VanDerWaalsContact C-N 3.26Å; V62-G64 PolarHBondContact O-N 2.83Å; V62-I65 PolarHBondContact O-N 2.78Å; V62-Y66 HydrophobicContact CG1-CD2 3.72Å; V62-Y66 HydrophobicContact CG1-CE2 3.87Å; V62-Y66 WeakPolarHBondContact O-CD2 3.45Å; V62-Y66 PolarHBondContact O-N 3.47Å
63	L	97.8	Very high	92.9	Very high	132 Å²	132	87 Å²	87	69%	0.691	50%	0.498	S	S	*	.	H	α-helix	trans	-59.9	-37.2	176.6	-70.8	173.9	0	0	0	112.1	G59 G67	G59-L63 WeakPolarHBondContact O-CB 3.37Å; G59-L63 VanDerWaalsContact O-CG 3.3Å; G59-L63 WeakPolarHBondContact O-CG 3.36Å; G59-L63 PolarHBondContact O-N 3Å; L63-G67 WeakPolarHBondContact O-CA 3.5Å; L63-G67 PolarHBondContact O-N 3.47Å
64	G	96.9	Very high	91.2	Very high	42 Å²	42	87 Å²	87	43%	0.433	49%	0.494	S	S	.	.	H	α-helix	trans	-64.6	-46.9	176.5	0	0	0	0	0	112.7	A60 L61 V62 Y68	A60-G64 PolarHBondContact O-N 3.12Å; L61-G64 PolarHBondContact O-N 3.47Å; V62-G64 VanDerWaalsContact C-N 3.26Å; V62-G64 PolarHBondContact O-N 2.83Å; G64-Y68 WeakPolarHBondContact O-CB 3.49Å; G64-Y68 PolarHBondContact O-N 2.71Å
65	I	96.1	Very high	89.2	Confident	96 Å²	96	87.7 Å²	87.7	49%	0.492	49%	0.492	S	S	.	.	H	α-helix	trans	-62.2	-54.2	178	-66.3	167.1	0	0	0	109.9	L61 V62 G67 Y68 T69	L61-I65 HydrophobicContact CD1-CD1 4.42Å; L61-I65 HydrophobicContact CG-CD1 4.17Å; L61-I65 WeakPolarHBondContact O-CG1 3.42Å; L61-I65 PolarHBondContact O-N 2.85Å; V62-I65 PolarHBondContact O-N 2.78Å; I65-G67 PolarHBondContact O-N 3.2Å; I65-Y68 PolarHBondContact O-N 3.41Å; I65-T69 WeakPolarHBondContact O-CB 3.3Å; I65-T69 PolarHBondContact O-N 2.97Å; I65-T69 PolarHBondContact O-OG1 2.87Å
66	Y	93.5	Very high	87.3	Confident	151 Å²	151	92.5 Å²	92.5	59%	0.592	50%	0.503	S	S	*	.	H	α-helix	trans	-63.5	-45.2	-179.1	-81.9	-77.1	0	0	0	111.8	V62 Y68 T69 F70	V62-Y66 HydrophobicContact CG1-CD2 3.72Å; V62-Y66 HydrophobicContact CG1-CE2 3.87Å; V62-Y66 WeakPolarHBondContact O-CD2 3.45Å; V62-Y66 PolarHBondContact O-N 3.47Å; Y66-Y68 VanDerWaalsContact C-N 3.31Å; Y66-Y68 PolarHBondContact O-N 3.32Å; Y66-T69 PolarHBondContact O-N 3.49Å; Y66-F70 HydrophobicContact CD1-CE2 4.18Å; Y66-F70 WeakPolarHBondContact O-CD2 3.18Å; Y66-F70 PolarHBondContact O-N 2.95Å
67	G	94.8	Very high	85.5	Confident	39 Å²	39	95 Å²	95	40%	0.402	50%	0.504	S	S	.	.	H	α-helix	trans	-58.6	-43.6	177.4	0	0	0	0	0	112.1	L63 I65 Y71	L63-G67 WeakPolarHBondContact O-CA 3.5Å; L63-G67 PolarHBondContact O-N 3.47Å; I65-G67 PolarHBondContact O-N 3.2Å; G67-Y71 VanDerWaalsContact O-CB 3.3Å; G67-Y71 WeakPolarHBondContact O-CB 3.2Å; G67-Y71 PolarHBondContact O-N 3Å
68	Y	92.1	Very high	83.6	Confident	158 Å²	158	96.2 Å²	96.2	62%	0.62	50%	0.501	S	S	*	.	H	α-helix	trans	-64.6	-45.3	174.6	180	-102.1	0	0	0	111.9	G64 I65 Y66 F70 Y71 S72	G64-Y68 WeakPolarHBondContact O-CB 3.49Å; G64-Y68 PolarHBondContact O-N 2.71Å; I65-Y68 PolarHBondContact O-N 3.41Å; Y66-Y68 VanDerWaalsContact C-N 3.31Å; Y66-Y68 PolarHBondContact O-N 3.32Å; Y68-F70 PolarHBondContact O-N 3.03Å; Y68-Y71 PolarHBondContact O-N 3.43Å; Y68-S72 WeakPolarHBondContact O-CB 3.42Å; Y68-S72 PolarHBondContact O-N 3.5Å; Y68-S72 PolarHBondContact O-OG 2.73Å
69	T	87.3	Confident	82	Confident	67 Å²	67	96.9 Å²	96.9	41%	0.411	50%	0.503	S	S	.	.	H	α-helix	trans	-59.9	-45.6	177.3	-59.2	0	0	0	0	111.8	I65 Y66 Y71 S72 V73	I65-T69 WeakPolarHBondContact O-CB 3.3Å; I65-T69 PolarHBondContact O-N 2.97Å; I65-T69 PolarHBondContact O-OG1 2.87Å; Y66-T69 PolarHBondContact O-N 3.49Å; T69-Y71 PolarHBondContact O-N 3.24Å; T69-S72 WeakPolarHBondContact CA-OG 3.4Å; T69-S72 PolarHBondContact O-N 2.97Å; T69-S72 PolarHBondContact O-OG 3.2Å; T69-V73 HydrophobicContact CG2-CG2 4.45Å; T69-V73 WeakPolarHBondContact O-CB 3.48Å; T69-V73 WeakPolarHBondContact O-CG2 3.27Å; T69-V73 PolarHBondContact O-N 2.87Å
70	F	81.9	Confident	80.5	Confident	148 Å²	148	100.7 Å²	100.7	65%	0.649	52%	0.517	S	S	*	.	H	α-helix	trans	-62.4	-43.6	175.9	-76.3	-64.3	0	0	0	111.8	Y66 Y68 S74	Y66-F70 HydrophobicContact CD1-CE2 4.18Å; Y66-F70 WeakPolarHBondContact O-CD2 3.18Å; Y66-F70 PolarHBondContact O-N 2.95Å; Y68-F70 PolarHBondContact O-N 3.03Å; F70-S74 PolarHBondContact O-N 2.98Å
71	Y	82.1	Confident	79.1	Confident	146 Å²	146	103.3 Å²	103.3	57%	0.573	52%	0.518	S	S	*	.	H	α-helix	trans	-63.9	-44.3	177.3	178.8	-100.2	0	0	0	112.2	G67 Y68 T69 S74 Q75	G67-Y71 VanDerWaalsContact O-CB 3.3Å; G67-Y71 WeakPolarHBondContact O-CB 3.2Å; G67-Y71 PolarHBondContact O-N 3Å; Y68-Y71 PolarHBondContact O-N 3.43Å; T69-Y71 PolarHBondContact O-N 3.24Å; Y71-S74 PolarHBondContact O-N 3.39Å; Y71-S74 PolarHBondContact O-OG 3.37Å; Y71-Q75 PolarHBondContact O-N 3.19Å
72	S	76.3	Confident	77.8	Confident	35 Å²	35	102.1 Å²	102.1	25%	0.245	51%	0.511	C	S	.	.	H	α-helix	trans	-66.9	-38.4	179.7	66	0	0	0	0	112.1	Y68 T69 S74 Q75	Y68-S72 WeakPolarHBondContact O-CB 3.42Å; Y68-S72 PolarHBondContact O-N 3.5Å; Y68-S72 PolarHBondContact O-OG 2.73Å; T69-S72 WeakPolarHBondContact CA-OG 3.4Å; T69-S72 PolarHBondContact O-N 2.97Å; T69-S72 PolarHBondContact O-OG 3.2Å; S72-S74 VanDerWaalsContact C-N 3.26Å; S72-S74 PolarHBondContact O-N 2.92Å; S72-Q75 WeakPolarHBondContact O-CB 3.49Å; S72-Q75 PolarHBondContact O-N 3.3Å; S72-Q75 VanDerWaalsContact O-N 3.16Å
73	V	67.8	Low	76.7	Confident	79 Å²	79	102.8 Å²	102.8	48%	0.479	51%	0.513	S	S	.	.	H	α-helix	trans	-64.8	-30.9	175.1	170.3	0	0	0	0	111.8	T69 Q75 E76	T69-V73 HydrophobicContact CG2-CG2 4.45Å; T69-V73 WeakPolarHBondContact O-CB 3.48Å; T69-V73 WeakPolarHBondContact O-CG2 3.27Å; T69-V73 PolarHBondContact O-N 2.87Å; V73-Q75 VanDerWaalsContact C-N 3.28Å; V73-Q75 PolarHBondContact O-N 3.43Å; V73-E76 PolarHBondContact O-N 3.45Å
74	S	63	Low	75.7	Confident	52 Å²	52	101.4 Å²	101.4	36%	0.364	50%	0.503	S	S	.	.	H	α-helix	trans	-67.6	-27.7	175.2	80.9	0	0	0	0	113.3	F70 Y71 S72 E76 R77 I78	F70-S74 PolarHBondContact O-N 2.98Å; Y71-S74 PolarHBondContact O-N 3.39Å; Y71-S74 PolarHBondContact O-OG 3.37Å; S72-S74 VanDerWaalsContact C-N 3.26Å; S72-S74 PolarHBondContact O-N 2.92Å; S74-E76 VanDerWaalsContact C-N 3.35Å; S74-E76 PolarHBondContact O-N 3.24Å; S74-R77 PolarHBondContact O-N 3.49Å; S74-I78 WeakPolarHBondContact O-CG1 3.37Å; S74-I78 PolarHBondContact O-N 3.47Å
75	Q	57.2	Low	74.6	Confident	95 Å²	95	105.8 Å²	105.8	44%	0.444	51%	0.512	S	S	.	.	H	α-helix	trans	-69.6	-32.1	-179.5	-70.3	-179.5	70.8	0	0	112.4	Y71 S72 V73 R77 I78 M79	Y71-Q75 PolarHBondContact O-N 3.19Å; S72-Q75 WeakPolarHBondContact O-CB 3.49Å; S72-Q75 PolarHBondContact O-N 3.3Å; S72-Q75 VanDerWaalsContact O-N 3.16Å; V73-Q75 VanDerWaalsContact C-N 3.28Å; V73-Q75 PolarHBondContact O-N 3.43Å; Q75-R77 VanDerWaalsContact C-N 3.29Å; Q75-R77 PolarHBondContact O-N 3.49Å; Q75-I78 PolarHBondContact O-N 3.38Å; Q75-M79 PolarHBondContact O-N 3.17Å
76	E	57.2	Low	73.6	Confident	144 Å²	144	103.4 Å²	103.4	67%	0.673	51%	0.506	S	S	*	.	H	α-helix	trans	-63	-38.4	173.5	-67.3	-178.7	177.7	0	0	111.1	V73 S74 M79 D80	V73-E76 PolarHBondContact O-N 3.45Å; S74-E76 VanDerWaalsContact C-N 3.35Å; S74-E76 PolarHBondContact O-N 3.24Å; E76-M79 PolarHBondContact O-N 2.77Å; E76-D80 PolarHBondContact O-N 3Å
77	R	60.6	Low	72.8	Confident	175 Å²	175	102.1 Å²	102.1	66%	0.66	50%	0.504	S	S	*	.	H	α-helix	trans	-71.1	-32.5	177.2	-70.7	-152.4	-177.5	-179.6	1.6	114.3	S74 Q75 M79 D80 E81	S74-R77 PolarHBondContact O-N 3.49Å; Q75-R77 VanDerWaalsContact C-N 3.29Å; Q75-R77 PolarHBondContact O-N 3.49Å; R77-M79 VanDerWaalsContact C-N 3.28Å; R77-M79 PolarHBondContact O-N 3.41Å; R77-D80 PolarHBondContact O-N 3.16Å; R77-E81 WeakPolarHBondContact O-CB 3.38Å; R77-E81 WeakPolarHBondContact O-CG 3.39Å; R77-E81 PolarHBondContact O-N 2.87Å
78	I	60.5	Low	72	Confident	86 Å²	86	107.1 Å²	107.1	44%	0.441	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-38.5	177.8	-68.7	170.1	0	0	0	110.3	S74 Q75 E81 I82	S74-I78 WeakPolarHBondContact O-CG1 3.37Å; S74-I78 PolarHBondContact O-N 3.47Å; Q75-I78 PolarHBondContact O-N 3.38Å; I78-E81 PolarHBondContact O-N 3.43Å; I78-I82 HydrophobicContact CG2-CD1 3.77Å; I78-I82 HydrophobicContact CG2-CG1 4.4Å; I78-I82 WeakPolarHBondContact O-CD1 3.49Å; I78-I82 VanDerWaalsContact O-CG1 3.23Å; I78-I82 WeakPolarHBondContact O-CG1 3.46Å; I78-I82 PolarHBondContact O-N 3.23Å
79	M	64.1	Low	71.1	Confident	116 Å²	116	102.6 Å²	102.6	57%	0.571	51%	0.506	S	S	*	.	H	α-helix	trans	-67	-39.7	178	-164	60	-163.1	0	0	111.9	Q75 E76 R77 I82 D83	Q75-M79 PolarHBondContact O-N 3.17Å; E76-M79 PolarHBondContact O-N 2.77Å; R77-M79 VanDerWaalsContact C-N 3.28Å; R77-M79 PolarHBondContact O-N 3.41Å; M79-I82 PolarHBondContact O-N 3.5Å; M79-D83 WeakPolarHBondContact O-CB 3.44Å; M79-D83 PolarHBondContact O-N 2.88Å
80	D	66.8	Low	70.3	Confident	110 Å²	110	109.7 Å²	109.7	59%	0.588	53%	0.525	S	S	*	.	H	α-helix	trans	-65	-39.7	174.5	-72	-22.2	0	0	0	112.4	E76 R77 D83 E84	E76-D80 PolarHBondContact O-N 3Å; R77-D80 PolarHBondContact O-N 3.16Å; D80-D83 PolarHBondContact O-N 3.3Å; D80-E84 WeakPolarHBondContact O-CB 3.23Å; D80-E84 PolarHBondContact O-N 3.03Å
81	E	68.3	Low	69.8	Low	119 Å²	119	109.5 Å²	109.5	56%	0.556	53%	0.53	S	S	*	.	H	α-helix	trans	-64.2	-42.8	176.1	-76.3	175.5	-168.5	0	0	111.7	R77 I78 D83 E84 E85	R77-E81 WeakPolarHBondContact O-CB 3.38Å; R77-E81 WeakPolarHBondContact O-CG 3.39Å; R77-E81 PolarHBondContact O-N 2.87Å; I78-E81 PolarHBondContact O-N 3.43Å; E81-D83 PolarHBondContact O-N 2.91Å; E81-E84 PolarHBondContact O-N 3.44Å; E81-E85 WeakPolarHBondContact O-CB 3.46Å; E81-E85 WeakPolarHBondContact O-CG 3.47Å; E81-E85 PolarHBondContact O-N 2.98Å
82	I	72.4	Confident	69	Low	89 Å²	89	111.3 Å²	111.3	46%	0.456	54%	0.541	S	S	.	.	H	α-helix	trans	-63.4	-41.9	175.8	-68.4	166	0	0	0	110.9	I78 M79 E85 A86	I78-I82 HydrophobicContact CG2-CD1 3.77Å; I78-I82 HydrophobicContact CG2-CG1 4.4Å; I78-I82 WeakPolarHBondContact O-CD1 3.49Å; I78-I82 VanDerWaalsContact O-CG1 3.23Å; I78-I82 WeakPolarHBondContact O-CG1 3.46Å; I78-I82 PolarHBondContact O-N 3.23Å; M79-I82 PolarHBondContact O-N 3.5Å; I82-E85 PolarHBondContact O-N 3.44Å; I82-A86 WeakPolarHBondContact O-CB 3.32Å; I82-A86 PolarHBondContact O-N 3.45Å
83	D	73.8	Confident	68.5	Low	79 Å²	79	111 Å²	111	42%	0.422	54%	0.544	S	S	.	.	H	α-helix	trans	-70.5	-36.5	-179.2	-136.8	48.4	0	0	0	111.6	M79 D80 E81 K87	M79-D83 WeakPolarHBondContact O-CB 3.44Å; M79-D83 PolarHBondContact O-N 2.88Å; D80-D83 PolarHBondContact O-N 3.3Å; E81-D83 PolarHBondContact O-N 2.91Å; D83-K87 WeakPolarHBondContact O-CB 3.34Å; D83-K87 VanDerWaalsContact O-CG 3.32Å; D83-K87 WeakPolarHBondContact O-CG 3.48Å; D83-K87 PolarHBondContact O-N 3.38Å; D83-K87 IonicContact OD2-NZ 3.88Å
84	E	77.3	Confident	68.3	Low	103 Å²	103	112.7 Å²	112.7	48%	0.481	56%	0.556	S	S	.	*	H	α-helix	trans	-65.1	-44	169.9	-87.1	-142.2	171.1	0	0	112.6	D80 E81 K87 R88	D80-E84 WeakPolarHBondContact O-CB 3.23Å; D80-E84 PolarHBondContact O-N 3.03Å; E81-E84 PolarHBondContact O-N 3.44Å; E84-K87 PolarHBondContact O-N 3.45Å; E84-R88 WeakPolarHBondContact O-CB 3.31Å; E84-R88 VanDerWaalsContact O-CG 3.27Å; E84-R88 WeakPolarHBondContact O-CG 3.47Å; E84-R88 PolarHBondContact O-N 3.47Å; E84-R88 IonicContact OE2-CZ 3.5Å; E84-R88 IonicContact OE2-NE 3.65Å; E84-R88 IonicContact OE2-NH2 2.73Å; E84-R88 PolarHBondContact OE2-NH2 3.48Å
85	E	73.7	Confident	68.2	Low	135 Å²	135	120 Å²	120	63%	0.631	58%	0.581	S	S	*	*	H	α-helix	trans	-62.6	-42.2	176.2	-78.3	-171.7	171.9	0	0	111.7	E81 I82 K87 R88 A89	E81-E85 WeakPolarHBondContact O-CB 3.46Å; E81-E85 WeakPolarHBondContact O-CG 3.47Å; E81-E85 PolarHBondContact O-N 2.98Å; I82-E85 PolarHBondContact O-N 3.44Å; E85-K87 PolarHBondContact O-N 3.26Å; E85-R88 PolarHBondContact O-N 3.33Å; E85-A89 WeakPolarHBondContact O-CB 3.47Å; E85-A89 PolarHBondContact O-N 3.4Å
86	A	75	Confident	68.5	Low	45 Å²	45	121.5 Å²	121.5	37%	0.372	60%	0.597	S	S	.	*	H	α-helix	trans	-63	-41.2	175	0	0	0	0	0	112	I82 A89 R90	I82-A86 WeakPolarHBondContact O-CB 3.32Å; I82-A86 PolarHBondContact O-N 3.45Å; A86-A89 PolarHBondContact O-N 2.81Å; A86-R90 WeakPolarHBondContact O-CG 3.46Å; A86-R90 PolarHBondContact O-N 3.27Å
87	K	77.7	Confident	68.2	Low	124 Å²	124	117.9 Å²	117.9	54%	0.539	60%	0.598	S	S	.	*	H	α-helix	trans	-63.2	-44.4	173.2	-77.4	172.4	-172.4	166	0	111.7	D83 E84 E85 A89 R90 L91	D83-K87 WeakPolarHBondContact O-CB 3.34Å; D83-K87 VanDerWaalsContact O-CG 3.32Å; D83-K87 WeakPolarHBondContact O-CG 3.48Å; D83-K87 PolarHBondContact O-N 3.38Å; D83-K87 IonicContact OD2-NZ 3.88Å; E84-K87 PolarHBondContact O-N 3.45Å; E85-K87 PolarHBondContact O-N 3.26Å; K87-A89 VanDerWaalsContact C-N 3.34Å; K87-A89 PolarHBondContact O-N 3.42Å; K87-R90 PolarHBondContact O-N 2.98Å; K87-L91 VanDerWaalsContact O-CG 3.31Å; K87-L91 WeakPolarHBondContact O-CG 3.38Å; K87-L91 PolarHBondContact O-N 3.06Å
88	R	76.7	Confident	67.5	Low	145 Å²	145	114.3 Å²	114.3	55%	0.547	61%	0.606	S	S	.	*	H	α-helix	trans	-64	-38.5	176.4	-70.9	173.5	-169.2	-168.9	6.2	111.9	E84 E85 L91 K92	E84-R88 WeakPolarHBondContact O-CB 3.31Å; E84-R88 VanDerWaalsContact O-CG 3.27Å; E84-R88 WeakPolarHBondContact O-CG 3.47Å; E84-R88 PolarHBondContact O-N 3.47Å; E84-R88 IonicContact OE2-CZ 3.5Å; E84-R88 IonicContact OE2-NE 3.65Å; E84-R88 IonicContact OE2-NH2 2.73Å; E84-R88 PolarHBondContact OE2-NH2 3.48Å; E85-R88 PolarHBondContact O-N 3.33Å; R88-L91 PolarHBondContact O-N 2.95Å; R88-K92 WeakPolarHBondContact O-CB 3.35Å; R88-K92 WeakPolarHBondContact O-CG 3.33Å; R88-K92 PolarHBondContact O-N 2.89Å
89	A	73.5	Confident	66.8	Low	63 Å²	63	121.4 Å²	121.4	52%	0.521	65%	0.645	S	S	.	*	H	α-helix	trans	-66.3	-40.6	175.8	0	0	0	0	0	112	E85 A86 K87 K92 G93	E85-A89 WeakPolarHBondContact O-CB 3.47Å; E85-A89 PolarHBondContact O-N 3.4Å; A86-A89 PolarHBondContact O-N 2.81Å; K87-A89 VanDerWaalsContact C-N 3.34Å; K87-A89 PolarHBondContact O-N 3.42Å; A89-K92 CarbonylContact O-C 3.53Å; A89-K92 PolarHBondContact O-N 3.39Å; A89-G93 PolarHBondContact O-N 3.33Å
90	R	71.1	Confident	67	Low	216 Å²	216	121.7 Å²	121.7	82%	0.815	65%	0.649	S	S	*	*	H	α-helix	trans	-65	-38.7	173.6	-75.4	-179.8	175.4	-174.8	0.7	112.9	A86 K87 K92 G93	A86-R90 WeakPolarHBondContact O-CG 3.46Å; A86-R90 PolarHBondContact O-N 3.27Å; K87-R90 PolarHBondContact O-N 2.98Å; R90-K92 VanDerWaalsContact C-N 3.27Å; R90-K92 PolarHBondContact O-N 2.91Å; R90-G93 PolarHBondContact O-N 3.49Å
91	L	70.1	Confident	67	Low	144 Å²	144	122.3 Å²	122.3	75%	0.754	65%	0.652	S	S	*	*	H	α-helix	trans	-68.3	-27	175.4	-71.7	168.3	0	0	0	112.9	K87 R88	K87-L91 VanDerWaalsContact O-CG 3.31Å; K87-L91 WeakPolarHBondContact O-CG 3.38Å; K87-L91 PolarHBondContact O-N 3.06Å; R88-L91 PolarHBondContact O-N 2.95Å
92	K	66.6	Low	66.9	Low	183 Å²	183	122.4 Å²	122.4	80%	0.796	66%	0.657	S	S	*	*	H	α-helix	trans	-91.9	-9	175.4	-69.8	179.7	-178.4	-177.8	0	113.9	R88 A89 R90	R88-K92 WeakPolarHBondContact O-CB 3.35Å; R88-K92 WeakPolarHBondContact O-CG 3.33Å; R88-K92 PolarHBondContact O-N 2.89Å; A89-K92 CarbonylContact O-C 3.53Å; A89-K92 PolarHBondContact O-N 3.39Å; R90-K92 VanDerWaalsContact C-N 3.27Å; R90-K92 PolarHBondContact O-N 2.91Å
93	G	66.4	Low	66.6	Low	30 Å²	30	124.4 Å²	124.4	31%	0.309	67%	0.669	S	S	.	*	S	Bend	trans	-62.3	146.5	175.5	0	0	0	0	0	111	A89 R90 K95	A89-G93 PolarHBondContact O-N 3.33Å; R90-G93 PolarHBondContact O-N 3.49Å; G93-K95 PolarHBondContact O-N 3.12Å; G93-K95 VanDerWaalsContact O-N 3.12Å
94	P	62.8	Low	66.1	Low	113 Å²	113	127.3 Å²	127.3	73%	0.734	68%	0.684	S	S	*	*			trans	-59.1	122.8	-174.9	23.3	-31.3	0	0	0	109.3	T96	P94-T96 HydrophobicContact CB-CG2 4.47Å; P94-T96 PolarHBondContact O-N 2.9Å
95	K	61.5	Low	65.4	Low	206 Å²	206	128.9 Å²	128.9	90%	0.896	70%	0.698	S	S	*	*			trans	-68.2	80.8	168.5	-68.2	-167.2	-178.1	179.9	0	108.1	G93 G97	G93-K95 PolarHBondContact O-N 3.12Å; G93-K95 VanDerWaalsContact O-N 3.12Å; K95-G97 PolarHBondContact O-N 2.8Å
96	T	61.8	Low	64.8	Low	126 Å²	126	128.4 Å²	128.4	77%	0.773	70%	0.703	S	S	*	*			trans	-75.8	74.8	163.1	57.4	0	0	0	0	107.1	P94 A98	P94-T96 HydrophobicContact CB-CG2 4.47Å; P94-T96 PolarHBondContact O-N 2.9Å; T96-A98 VanDerWaalsContact C-N 3.35Å; T96-A98 PolarHBondContact O-N 3.46Å; T96-A98 VanDerWaalsContact O-N 3.16Å
97	G	51.4	Low	64	Low	68 Å²	68	134.8 Å²	134.8	70%	0.701	73%	0.728	S	S	*	*			trans	-70.9	95.9	161.8	0	0	0	0	0	107.6	K95 N99	K95-G97 PolarHBondContact O-N 2.8Å; G97-N99 PolarHBondContact O-N 3.16Å
98	A	47.3	Very low	62.9	Low	100 Å²	100	135.8 Å²	135.8	83%	0.826	74%	0.744	S	S	*	*			trans	-82.3	99.8	156.2	0	0	0	0	0	106.5	T96	T96-A98 VanDerWaalsContact C-N 3.35Å; T96-A98 PolarHBondContact O-N 3.46Å; T96-A98 VanDerWaalsContact O-N 3.16Å
99	N	45.4	Very low	61.6	Low	235 Å²	235	134.9 Å²	134.9	100%	1.257	76%	0.762	S	S	*	*			trans	-78.8	0	150.7	-69.1	-39	0	0	0	108.1	G97	G97-N99 PolarHBondContact O-N 3.16Å

Retrieved 99 of 99 residues in 26.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).