A0A3B3VYB9_9TELE Loading...

Reprimo-like

AlphaFold DB , UniProt , Accession A0A3B3VYB9, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 111 aa.

						>A0A3B3VYB9_9TELE|A0A3B3VYB9
MNVSLFNMTQGVLFNGSQTLAGALDTYSSNSSETVMTDDGGGSLVLLQDERKLFVMRVVQIAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKDRRPSKDVETVMIGLG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.1	Very low	49.4	Very low	250 Å²	250	121.7 Å²	121.7	100%	1.232	66%	0.66	S	S	*	*				0	92.3	0	-66.8	140.6	171.6	0	0	108.5
2	N	37.9	Very low	49.6	Very low	108 Å²	108	119.4 Å²	119.4	58%	0.578	65%	0.653	S	S	*	*			trans	-156.3	18.8	176.1	-156.8	-2.9	0	0	0	113.5
3	V	51.6	Low	50	Low	127 Å²	127	120.7 Å²	120.7	77%	0.77	66%	0.657	S	S	*	*	H	α-helix	trans	-87.9	-28.7	-178.1	-173.3	0	0	0	0	111	N7	V3-N7 WeakPolarHBondContact O-CB 3.34Å; V3-N7 PolarHBondContact O-N 3.2Å
4	S	52.3	Low	50.5	Low	100 Å²	100	122.4 Å²	122.4	70%	0.699	66%	0.655	S	S	*	*	H	α-helix	trans	-73.6	-35.7	-175.1	-141.9	0	0	0	0	113.8	N7 M8	S4-N7 PolarHBondContact O-N 3.3Å; S4-M8 PolarHBondContact O-N 2.98Å
5	L	49.2	Very low	50.7	Low	116 Å²	116	120.9 Å²	120.9	61%	0.607	65%	0.647	S	S	*	*	H	α-helix	trans	-73	-38.3	-177	-147.1	167.1	0	0	0	111.4	M8 T9	L5-M8 PolarHBondContact O-N 3.43Å; L5-T9 PolarHBondContact O-N 3.34Å; L5-T9 PolarHBondContact O-OG1 2.86Å
6	F	50.1	Low	50.9	Low	152 Å²	152	115.3 Å²	115.3	67%	0.667	63%	0.628	S	S	*	*	H	α-helix	trans	-65.9	-38.6	171.5	-101.7	-88.7	0	0	0	112.4	T9 Q10	F6-T9 PolarHBondContact O-OG1 3.41Å; F6-Q10 WeakPolarHBondContact O-CB 3.47Å; F6-Q10 PolarHBondContact O-N 2.72Å
7	N	52.5	Low	51.2	Low	108 Å²	108	112.6 Å²	112.6	58%	0.578	62%	0.619	S	S	*	*	H	α-helix	trans	-68.2	-36.2	176.6	-168.3	44	0	0	0	112.4	V3 S4 G11	V3-N7 WeakPolarHBondContact O-CB 3.34Å; V3-N7 PolarHBondContact O-N 3.2Å; S4-N7 PolarHBondContact O-N 3.3Å; N7-G11 PolarHBondContact O-N 3.43Å
8	M	48.4	Very low	51.5	Low	132 Å²	132	112.7 Å²	112.7	65%	0.65	61%	0.614	S	S	*	*	H	α-helix	trans	-66.2	-43.2	176.8	-176.1	-168.9	166.5	0	0	112	S4 L5 G11 V12	S4-M8 PolarHBondContact O-N 2.98Å; L5-M8 PolarHBondContact O-N 3.43Å; M8-G11 PolarHBondContact O-N 3.2Å; M8-V12 WeakPolarHBondContact O-CG2 3.44Å; M8-V12 PolarHBondContact O-N 3.22Å
9	T	52.1	Low	51.7	Low	74 Å²	74	111.5 Å²	111.5	45%	0.454	61%	0.611	S	S	.	*	H	α-helix	trans	-68.9	-36.4	177.9	29.9	0	0	0	0	112.1	L5 F6 V12 L13	L5-T9 PolarHBondContact O-N 3.34Å; L5-T9 PolarHBondContact O-OG1 2.86Å; F6-T9 PolarHBondContact O-OG1 3.41Å; T9-V12 PolarHBondContact O-N 3.46Å; T9-L13 PolarHBondContact O-N 2.97Å
10	Q	53.8	Low	51.8	Low	132 Å²	132	111.9 Å²	111.9	62%	0.617	61%	0.612	S	S	*	*	H	α-helix	trans	-64.7	-41.5	172.3	-165.3	171	15.6	0	0	111.6	F6 F14	F6-Q10 WeakPolarHBondContact O-CB 3.47Å; F6-Q10 PolarHBondContact O-N 2.72Å; Q10-F14 VanDerWaalsContact O-CB 3.22Å; Q10-F14 WeakPolarHBondContact O-CB 2.85Å; Q10-F14 PolarHBondContact O-N 3.46Å
11	G	50.9	Low	52.1	Low	40 Å²	40	109.3 Å²	109.3	41%	0.412	61%	0.605	S	S	.	*	H	α-helix	trans	-63.7	-38.9	175.1	0	0	0	0	0	113.6	N7 M8 N15	N7-G11 PolarHBondContact O-N 3.43Å; M8-G11 PolarHBondContact O-N 3.2Å; G11-N15 VanDerWaalsContact O-CB 3.23Å; G11-N15 WeakPolarHBondContact O-CB 3.5Å; G11-N15 PolarHBondContact O-N 3.12Å
12	V	51.5	Low	52.6	Low	94 Å²	94	99.2 Å²	99.2	57%	0.57	57%	0.565	S	S	*	*	H	α-helix	trans	-70.6	-42	177.8	170.9	0	0	0	0	112	M8 T9 N15 G16	M8-V12 WeakPolarHBondContact O-CG2 3.44Å; M8-V12 PolarHBondContact O-N 3.22Å; T9-V12 PolarHBondContact O-N 3.46Å; V12-N15 PolarHBondContact O-N 3.4Å; V12-G16 PolarHBondContact O-N 3.48Å
13	L	54.6	Low	53.5	Low	136 Å²	136	96.7 Å²	96.7	71%	0.712	56%	0.56	S	S	*	*	H	α-helix	trans	-64.8	-40	174	-79.8	169.1	0	0	0	111.8	T9 G16 S17	T9-L13 PolarHBondContact O-N 2.97Å; L13-G16 PolarHBondContact O-N 2.79Å; L13-S17 PolarHBondContact O-N 2.83Å
14	F	56.6	Low	53.7	Low	144 Å²	144	96.6 Å²	96.6	63%	0.632	55%	0.554	S	S	*	*	H	α-helix	trans	-69.3	-34.7	177	-157.5	-94.3	0	0	0	112.1	Q10 S17 Q18	Q10-F14 VanDerWaalsContact O-CB 3.22Å; Q10-F14 WeakPolarHBondContact O-CB 2.85Å; Q10-F14 PolarHBondContact O-N 3.46Å; F14-S17 PolarHBondContact O-N 2.76Å; F14-Q18 WeakPolarHBondContact O-CG 2.97Å; F14-Q18 PolarHBondContact O-N 3.1Å; F14-Q18 PolarHBondContact O-NE2 3.04Å
15	N	53.5	Low	53.9	Low	100 Å²	100	96.9 Å²	96.9	54%	0.535	55%	0.548	S	S	.	.	H	α-helix	trans	-68.3	-41.3	172.6	-166.3	54.1	0	0	0	111.6	G11 V12 S17 Q18 T19	G11-N15 VanDerWaalsContact O-CB 3.23Å; G11-N15 WeakPolarHBondContact O-CB 3.5Å; G11-N15 PolarHBondContact O-N 3.12Å; V12-N15 PolarHBondContact O-N 3.4Å; N15-S17 VanDerWaalsContact C-N 3.32Å; N15-S17 PolarHBondContact O-N 3.48Å; N15-Q18 WeakPolarHBondContact O-CB 3.45Å; N15-Q18 PolarHBondContact O-N 3.42Å; N15-T19 PolarHBondContact O-N 3.23Å; N15-T19 VanDerWaalsContact O-N 3.15Å
16	G	53.7	Low	54.2	Low	32 Å²	32	95.4 Å²	95.4	33%	0.33	54%	0.544	S	S	.	.	H	α-helix	trans	-64.8	-32.4	174.1	0	0	0	0	0	113.5	V12 L13 Q18 T19 L20	V12-G16 PolarHBondContact O-N 3.48Å; L13-G16 PolarHBondContact O-N 2.79Å; G16-Q18 VanDerWaalsContact C-N 3.33Å; G16-T19 PolarHBondContact O-N 2.66Å; G16-T19 PolarHBondContact O-OG1 3.28Å; G16-L20 PolarHBondContact O-N 2.7Å; G16-L20 VanDerWaalsContact O-N 3.1Å
17	S	56.9	Low	54.2	Low	70 Å²	70	97.5 Å²	97.5	49%	0.49	55%	0.549	S	S	.	.	H	α-helix	trans	-68.9	-31.8	173	-170.9	0	0	0	0	112.6	L13 F14 N15 A21	L13-S17 PolarHBondContact O-N 2.83Å; F14-S17 PolarHBondContact O-N 2.76Å; N15-S17 VanDerWaalsContact C-N 3.32Å; N15-S17 PolarHBondContact O-N 3.48Å; S17-A21 WeakPolarHBondContact O-CB 3.46Å; S17-A21 PolarHBondContact O-N 3.47Å
18	Q	55.8	Low	54.2	Low	113 Å²	113	96.3 Å²	96.3	53%	0.528	55%	0.549	S	S	.	.	H	α-helix	trans	-72.6	-35.9	176.5	-72.4	173.5	84.8	0	0	111.9	F14 N15 G16 A21 G22	F14-Q18 WeakPolarHBondContact O-CG 2.97Å; F14-Q18 PolarHBondContact O-N 3.1Å; F14-Q18 PolarHBondContact O-NE2 3.04Å; N15-Q18 WeakPolarHBondContact O-CB 3.45Å; N15-Q18 PolarHBondContact O-N 3.42Å; G16-Q18 VanDerWaalsContact C-N 3.33Å; Q18-A21 PolarHBondContact O-N 2.75Å; Q18-G22 PolarHBondContact O-N 2.86Å
19	T	55	Low	54.4	Low	90 Å²	90	94 Å²	94	55%	0.552	55%	0.546	S	S	*	.	H	α-helix	trans	-69.4	-36.5	174.2	60.8	0	0	0	0	111.8	N15 G16 A23	N15-T19 PolarHBondContact O-N 3.23Å; N15-T19 VanDerWaalsContact O-N 3.15Å; G16-T19 PolarHBondContact O-N 2.66Å; G16-T19 PolarHBondContact O-OG1 3.28Å; T19-A23 WeakPolarHBondContact O-CB 3.43Å; T19-A23 PolarHBondContact O-N 2.73Å
20	L	55.3	Low	54.3	Low	120 Å²	120	96.3 Å²	96.3	63%	0.628	56%	0.555	S	S	*	*	H	α-helix	trans	-67.4	-37.5	172.6	-134.1	77	0	0	0	112	G16 A23 L24	G16-L20 PolarHBondContact O-N 2.7Å; G16-L20 VanDerWaalsContact O-N 3.1Å; L20-A23 PolarHBondContact O-N 3.23Å; L20-L24 PolarHBondContact O-N 3.06Å
21	A	56.5	Low	53.9	Low	57 Å²	57	95.1 Å²	95.1	47%	0.471	56%	0.562	S	S	.	*	H	α-helix	trans	-64.5	-44.3	175	0	0	0	0	0	112	S17 Q18 A23 L24 D25	S17-A21 WeakPolarHBondContact O-CB 3.46Å; S17-A21 PolarHBondContact O-N 3.47Å; Q18-A21 PolarHBondContact O-N 2.75Å; A21-A23 VanDerWaalsContact C-N 3.31Å; A21-A23 PolarHBondContact O-N 3.14Å; A21-L24 PolarHBondContact O-N 3Å; A21-D25 WeakPolarHBondContact O-CB 3.35Å; A21-D25 PolarHBondContact O-N 2.82Å
22	G	56.6	Low	53.5	Low	38 Å²	38	98 Å²	98	39%	0.392	58%	0.576	S	S	.	*	H	α-helix	trans	-64.1	-33.6	173.7	0	0	0	0	0	113.3	Q18 T26	Q18-G22 PolarHBondContact O-N 2.86Å; G22-T26 WeakPolarHBondContact O-CB 3.01Å; G22-T26 PolarHBondContact O-N 3.45Å; G22-T26 PolarHBondContact O-OG1 2.89Å
23	A	56.6	Low	53.1	Low	56 Å²	56	102 Å²	102	46%	0.463	59%	0.588	S	S	.	*	H	α-helix	trans	-70.3	-36.6	174.9	0	0	0	0	0	112.8	T19 L20 A21 Y27	T19-A23 WeakPolarHBondContact O-CB 3.43Å; T19-A23 PolarHBondContact O-N 2.73Å; L20-A23 PolarHBondContact O-N 3.23Å; A21-A23 VanDerWaalsContact C-N 3.31Å; A21-A23 PolarHBondContact O-N 3.14Å; A23-Y27 PolarHBondContact O-N 3.48Å; A23-Y27 VanDerWaalsContact O-N 3.12Å
24	L	56.4	Low	52.7	Low	124 Å²	124	100.8 Å²	100.8	65%	0.649	59%	0.586	S	S	*	*	H	α-helix	trans	-71.1	-37.1	175.4	-111.1	150.3	0	0	0	112.3	L20 A21 Y27 S28	L20-L24 PolarHBondContact O-N 3.06Å; A21-L24 PolarHBondContact O-N 3Å; L24-Y27 PolarHBondContact O-N 2.62Å; L24-S28 PolarHBondContact O-N 2.67Å
25	D	55.3	Low	51.7	Low	106 Å²	106	100.6 Å²	100.6	57%	0.567	60%	0.596	S	S	*	*	H	α-helix	trans	-67.5	-38.5	174.7	-165.6	37.4	0	0	0	111.8	A21 Y27 S28 S29	A21-D25 WeakPolarHBondContact O-CB 3.35Å; A21-D25 PolarHBondContact O-N 2.82Å; D25-Y27 VanDerWaalsContact C-N 3.3Å; D25-Y27 PolarHBondContact O-N 3.32Å; D25-S28 PolarHBondContact O-N 2.64Å; D25-S28 VanDerWaalsContact O-N 3.15Å; D25-S29 PolarHBondContact O-N 3.13Å
26	T	56.5	Low	51.2	Low	86 Å²	86	104 Å²	104	53%	0.528	61%	0.611	S	S	.	*	H	α-helix	trans	-63.2	-35.6	171.8	-55.1	0	0	0	0	111.6	G22 S28 N30	G22-T26 WeakPolarHBondContact O-CB 3.01Å; G22-T26 PolarHBondContact O-N 3.45Å; G22-T26 PolarHBondContact O-OG1 2.89Å; T26-S28 VanDerWaalsContact C-N 3.34Å; T26-N30 PolarHBondContact O-ND2 3.37Å; T26-N30 PolarHBondContact O-OD1 3.21Å
27	Y	50.2	Low	50.4	Low	196 Å²	196	108.9 Å²	108.9	77%	0.769	64%	0.635	S	S	*	*	H	α-helix	trans	-73	-27.5	176	-130.1	-96.1	0	0	0	112.5	A23 L24 D25	A23-Y27 PolarHBondContact O-N 3.48Å; A23-Y27 VanDerWaalsContact O-N 3.12Å; L24-Y27 PolarHBondContact O-N 2.62Å; D25-Y27 VanDerWaalsContact C-N 3.3Å; D25-Y27 PolarHBondContact O-N 3.32Å
28	S	51.6	Low	49.5	Very low	83 Å²	83	112.3 Å²	112.3	58%	0.58	65%	0.648	S	S	*	*	H	α-helix	trans	-80.5	-32.7	178.7	-165.7	0	0	0	0	113.5	L24 D25 T26 N30	L24-S28 PolarHBondContact O-N 2.67Å; D25-S28 PolarHBondContact O-N 2.64Å; D25-S28 VanDerWaalsContact O-N 3.15Å; T26-S28 VanDerWaalsContact C-N 3.34Å; S28-N30 VanDerWaalsContact C-N 3.29Å; S28-N30 PolarHBondContact O-N 2.8Å
29	S	52.3	Low	48.8	Very low	83 Å²	83	113.7 Å²	113.7	58%	0.58	66%	0.659	S	S	*	*	H	α-helix	trans	-74.8	-12.6	-179.9	-84.6	0	0	0	0	114.6	D25 S31	D25-S29 PolarHBondContact O-N 3.13Å; S29-S31 VanDerWaalsContact C-N 3.25Å; S29-S31 PolarHBondContact O-N 3.5Å
30	N	50.3	Low	48.4	Very low	123 Å²	123	113 Å²	113	66%	0.658	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	-0.3	-178.2	-52.8	-18.8	0	0	0	113.3	T26 S28	T26-N30 PolarHBondContact O-ND2 3.37Å; T26-N30 PolarHBondContact O-OD1 3.21Å; S28-N30 VanDerWaalsContact C-N 3.29Å; S28-N30 PolarHBondContact O-N 2.8Å
31	S	46.6	Very low	47.7	Very low	107 Å²	107	110 Å²	110	75%	0.748	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.1	12.9	-174.1	-155.7	0	0	0	0	114.3	S29	S29-S31 VanDerWaalsContact C-N 3.25Å; S29-S31 PolarHBondContact O-N 3.5Å
32	S	42.2	Very low	47	Very low	101 Å²	101	110.3 Å²	110.3	71%	0.706	68%	0.677	S	S	*	*			trans	-128.4	71.1	-178.4	-53.5	0	0	0	0	110.7	T34	S32-T34 PolarHBondContact O-N 3.35Å
33	E	42.6	Very low	46.5	Very low	177 Å²	177	113.4 Å²	113.4	83%	0.827	69%	0.692	S	S	*	*			trans	-64.5	124.5	160.3	-158.7	-164.5	146.2	0	0	108.4
34	T	46.6	Very low	45.8	Very low	111 Å²	111	117.8 Å²	117.8	68%	0.681	71%	0.707	S	S	*	*			trans	74.9	109.4	168.3	91.2	0	0	0	0	116.4	S32	S32-T34 PolarHBondContact O-N 3.35Å
35	V	35.9	Very low	45.3	Very low	139 Å²	139	117 Å²	117	84%	0.842	71%	0.707	S	S	*	*				174.6	132.3	102	166.8	0	0	0	0	107.7
36	M	42.7	Very low	44.8	Very low	171 Å²	171	117.1 Å²	117.1	84%	0.842	71%	0.707	S	S	*	*			trans	-65.4	171.7	-178.8	-80	-177.5	146.2	0	0	114.8
37	T	36.3	Very low	44.1	Very low	135 Å²	135	118 Å²	118	83%	0.828	71%	0.708	S	S	*	*			trans	97.6	133.6	149	-28.2	0	0	0	0	112.7
38	D	39.1	Very low	43.6	Very low	142 Å²	142	116.2 Å²	116.2	76%	0.759	71%	0.707	S	S	*	*			cis	-179.8	159.3	-12.1	173.6	38.9	0	0	0	104
39	D	39.4	Very low	43.2	Very low	142 Å²	142	115.9 Å²	115.9	76%	0.759	70%	0.699	S	S	*	*			trans	68.4	107.1	158.4	-150.4	11.9	0	0	0	121.2
40	G	47.4	Very low	42.9	Very low	75 Å²	75	115.6 Å²	115.6	77%	0.773	69%	0.688	S	S	*	*				63.5	76.3	122.1	0	0	0	0	0	118.7
41	G	41.5	Very low	42.5	Very low	58 Å²	58	119.2 Å²	119.2	60%	0.598	69%	0.692	S	S	*	*			trans	-175.8	12	168.5	0	0	0	0	0	118.5	S43	G41-S43 PolarHBondContact O-N 2.86Å
42	G	40.8	Very low	42.4	Very low	64 Å²	64	121.6 Å²	121.6	66%	0.66	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.2	9.5	-169.3	0	0	0	0	0	117.5
43	S	45.3	Very low	42.6	Very low	103 Å²	103	120.2 Å²	120.2	72%	0.72	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.1	-24.9	-173.5	-165.3	0	0	0	0	114	G41	G41-S43 PolarHBondContact O-N 2.86Å
44	L	43.6	Very low	42.9	Very low	147 Å²	147	117.2 Å²	117.2	77%	0.77	66%	0.658	S	S	*	*	H	α-helix	trans	-103.5	-21.2	-178.5	-71.9	166.5	0	0	0	113.9
45	V	44.4	Very low	43.1	Very low	109 Å²	109	116.9 Å²	116.9	66%	0.661	66%	0.656	S	S	*	*	H	α-helix	trans	-78	-30.7	171.6	173.9	0	0	0	0	111.4	D49	V45-D49 WeakPolarHBondContact O-CB 3.12Å; V45-D49 PolarHBondContact O-N 3.48Å
46	L	45.2	Very low	43.8	Very low	108 Å²	108	115.7 Å²	115.7	57%	0.565	64%	0.642	S	S	*	*	H	α-helix	trans	-61.8	-49.2	178.8	-129.8	-178.3	0	0	0	110.6	Q48 D49 E50	L46-Q48 PolarHBondContact O-N 2.68Å; L46-D49 PolarHBondContact O-N 2.75Å; L46-E50 HydrophobicContact CD2-CG 4.32Å; L46-E50 WeakPolarHBondContact O-CG 3.18Å; L46-E50 PolarHBondContact O-N 2.74Å
47	L	43.3	Very low	44.4	Very low	104 Å²	104	112.3 Å²	112.3	55%	0.545	62%	0.62	S	S	.	*	H	α-helix	trans	-64.1	-36.2	-174	-142.3	-156.4	0	0	0	114.1	E50	L47-E50 PolarHBondContact O-N 2.7Å
48	Q	38.3	Very low	45.3	Very low	159 Å²	159	109.9 Å²	109.9	74%	0.743	61%	0.605	S	S	*	*	H	α-helix	trans	-81.2	-28.9	-178.7	-157.1	175.8	-2.8	0	0	111.9	L46 E50	L46-Q48 PolarHBondContact O-N 2.68Å; Q48-E50 VanDerWaalsContact C-N 3.31Å
49	D	44.3	Very low	46.7	Very low	76 Å²	76	107.1 Å²	107.1	41%	0.406	59%	0.593	S	S	.	*	H	α-helix	trans	-75	-19.1	170.7	-157.9	52.3	0	0	0	112.1	V45 L46 R51 L53	V45-D49 WeakPolarHBondContact O-CB 3.12Å; V45-D49 PolarHBondContact O-N 3.48Å; L46-D49 PolarHBondContact O-N 2.75Å; D49-R51 PolarHBondContact O-N 3.45Å; D49-L53 WeakPolarHBondContact O-CB 3.09Å; D49-L53 WeakPolarHBondContact O-CG 3.19Å; D49-L53 PolarHBondContact O-N 3.5Å; D49-L53 WeakPolarHBondContact OD2-CD1 3.48Å; D49-L53 WeakPolarHBondContact OD2-CG 3.12Å
50	E	45.8	Very low	47.2	Very low	76 Å²	76	106.1 Å²	106.1	36%	0.355	58%	0.584	S	S	.	*	H	α-helix	trans	-65.6	-41.4	177.1	-39	-171	174.8	0	0	111.5	L46 L47 Q48 F54 R57	L46-E50 HydrophobicContact CD2-CG 4.32Å; L46-E50 WeakPolarHBondContact O-CG 3.18Å; L46-E50 PolarHBondContact O-N 2.74Å; L47-E50 PolarHBondContact O-N 2.7Å; Q48-E50 VanDerWaalsContact C-N 3.31Å; E50-F54 VanDerWaalsContact O-CB 3.23Å; E50-F54 WeakPolarHBondContact O-CB 3.24Å; E50-F54 WeakPolarHBondContact O-CD2 3.37Å; E50-F54 PolarHBondContact O-N 2.82Å; E50-R57 PolarHBondContact O-NH2 2.8Å
51	R	42.3	Very low	48.2	Very low	199 Å²	199	107.6 Å²	107.6	75%	0.751	57%	0.573	S	S	*	*	H	α-helix	trans	-73.7	-37.5	-177.8	-63.7	-104.5	-148.2	-133.4	-1	112.4	D49 F54 V55	D49-R51 PolarHBondContact O-N 3.45Å; R51-F54 WeakPolarHBondContact O-CB 3.13Å; R51-F54 PolarHBondContact O-N 3.29Å; R51-V55 PolarHBondContact O-N 3.43Å
52	K	42.9	Very low	49.7	Very low	157 Å²	157	107 Å²	107	68%	0.683	56%	0.562	S	S	*	*	H	α-helix	trans	-77.8	-38.7	-179.6	-154.8	173.7	176.9	179.8	0	111.1	F54 V55 M56	K52-F54 VanDerWaalsContact C-N 3.26Å; K52-F54 PolarHBondContact O-N 3.3Å; K52-V55 PolarHBondContact O-N 3.5Å; K52-M56 PolarHBondContact O-N 2.74Å
53	L	47.7	Very low	51.6	Low	72 Å²	72	108.1 Å²	108.1	38%	0.377	56%	0.556	S	S	.	*	H	α-helix	trans	-66.8	-25.8	164.9	-66.6	-179.2	0	0	0	112.2	D49 V55 M56 R57	D49-L53 WeakPolarHBondContact O-CB 3.09Å; D49-L53 WeakPolarHBondContact O-CG 3.19Å; D49-L53 PolarHBondContact O-N 3.5Å; D49-L53 WeakPolarHBondContact OD2-CD1 3.48Å; D49-L53 WeakPolarHBondContact OD2-CG 3.12Å; L53-V55 VanDerWaalsContact C-N 3.35Å; L53-M56 PolarHBondContact O-N 2.75Å; L53-R57 WeakPolarHBondContact O-CB 3.43Å; L53-R57 WeakPolarHBondContact O-CG 3.38Å; L53-R57 PolarHBondContact O-N 3.5Å; L53-R57 PolarHBondContact O-NE 2.81Å; L53-R57 VanDerWaalsContact O-NE 3.16Å
54	F	47.9	Very low	52.6	Low	115 Å²	115	108.8 Å²	108.8	50%	0.504	55%	0.551	S	S	.	*	H	α-helix	trans	-65.3	-37.7	172.5	-108.5	-71.6	0	0	0	111.6	E50 R51 K52 R57 V58	E50-F54 VanDerWaalsContact O-CB 3.23Å; E50-F54 WeakPolarHBondContact O-CB 3.24Å; E50-F54 WeakPolarHBondContact O-CD2 3.37Å; E50-F54 PolarHBondContact O-N 2.82Å; R51-F54 WeakPolarHBondContact O-CB 3.13Å; R51-F54 PolarHBondContact O-N 3.29Å; K52-F54 VanDerWaalsContact C-N 3.26Å; K52-F54 PolarHBondContact O-N 3.3Å; F54-R57 PolarHBondContact O-N 3.39Å; F54-V58 HydrophobicContact CD1-CG2 4.38Å; F54-V58 VanDerWaalsContact O-CB 3.23Å; F54-V58 WeakPolarHBondContact O-CB 3.38Å; F54-V58 WeakPolarHBondContact O-CG2 3.02Å; F54-V58 PolarHBondContact O-N 3.49Å
55	V	51.2	Low	54	Low	103 Å²	103	104.7 Å²	104.7	62%	0.624	53%	0.534	S	S	*	.	H	α-helix	trans	-65.5	-42.2	175.9	177.7	0	0	0	0	110.9	R51 K52 L53 V58 V59	R51-V55 PolarHBondContact O-N 3.43Å; K52-V55 PolarHBondContact O-N 3.5Å; L53-V55 VanDerWaalsContact C-N 3.35Å; V55-V58 PolarHBondContact O-N 2.83Å; V55-V59 PolarHBondContact O-N 3.37Å
56	M	51	Low	55.6	Low	115 Å²	115	103.8 Å²	103.8	57%	0.567	53%	0.528	S	S	*	.	H	α-helix	trans	-68.1	-37.7	175.8	-62.6	-177.5	72.3	0	0	112.2	K52 L53 V59 Q60	K52-M56 PolarHBondContact O-N 2.74Å; L53-M56 PolarHBondContact O-N 2.75Å; M56-V59 WeakPolarHBondContact O-CG1 3.05Å; M56-Q60 WeakPolarHBondContact O-CB 3.29Å; M56-Q60 VanDerWaalsContact O-CG 3.31Å; M56-Q60 WeakPolarHBondContact O-CG 3.23Å; M56-Q60 PolarHBondContact O-N 2.88Å; M56-Q60 VanDerWaalsContact O-N 3.09Å
57	R	54.7	Low	57.4	Low	100 Å²	100	103.6 Å²	103.6	38%	0.377	53%	0.527	S	S	.	.	H	α-helix	trans	-67.5	-38.3	172.7	-73.4	179.2	-70.7	-178.3	-2.4	111.7	E50 L53 F54 Q60 I61	E50-R57 PolarHBondContact O-NH2 2.8Å; L53-R57 WeakPolarHBondContact O-CB 3.43Å; L53-R57 WeakPolarHBondContact O-CG 3.38Å; L53-R57 PolarHBondContact O-N 3.5Å; L53-R57 PolarHBondContact O-NE 2.81Å; L53-R57 VanDerWaalsContact O-NE 3.16Å; F54-R57 PolarHBondContact O-N 3.39Å; R57-Q60 PolarHBondContact O-N 3.41Å; R57-I61 HydrophobicContact CB-CD1 4.49Å; R57-I61 VanDerWaalsContact O-CB 3.24Å; R57-I61 WeakPolarHBondContact O-CB 3.43Å; R57-I61 VanDerWaalsContact O-CD1 3.29Å; R57-I61 WeakPolarHBondContact O-CD1 3.34Å; R57-I61 WeakPolarHBondContact O-CG1 2.98Å; R57-I61 PolarHBondContact O-N 3.09Å
58	V	55.8	Low	58.8	Low	84 Å²	84	102 Å²	102	51%	0.509	53%	0.525	S	S	.	.	H	α-helix	trans	-70.5	-39.4	178.4	168.5	0	0	0	0	110.8	F54 V55 A62	F54-V58 HydrophobicContact CD1-CG2 4.38Å; F54-V58 VanDerWaalsContact O-CB 3.23Å; F54-V58 WeakPolarHBondContact O-CB 3.38Å; F54-V58 WeakPolarHBondContact O-CG2 3.02Å; F54-V58 PolarHBondContact O-N 3.49Å; V55-V58 PolarHBondContact O-N 2.83Å; V58-A62 WeakPolarHBondContact O-CA 3.44Å; V58-A62 WeakPolarHBondContact O-CB 3.24Å; V58-A62 PolarHBondContact O-N 2.8Å
59	V	68.4	Low	60.8	Low	84 Å²	84	98.6 Å²	98.6	51%	0.509	51%	0.512	S	S	.	.	H	α-helix	trans	-67.6	-38.4	174.5	70.7	0	0	0	0	111.2	V55 M56 A62 V63	V55-V59 PolarHBondContact O-N 3.37Å; M56-V59 WeakPolarHBondContact O-CG1 3.05Å; V59-A62 PolarHBondContact O-N 2.72Å; V59-V63 HydrophobicContact CG2-CG2 4.34Å; V59-V63 WeakPolarHBondContact O-CB 3.08Å; V59-V63 WeakPolarHBondContact O-CG2 2.92Å; V59-V63 PolarHBondContact O-N 3.43Å
60	Q	50.5	Low	62.6	Low	121 Å²	121	99.1 Å²	99.1	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-67.5	-44.9	175.8	-74.5	-179.6	-8.2	0	0	112	M56 R57 A62 V63 L64	M56-Q60 WeakPolarHBondContact O-CB 3.29Å; M56-Q60 VanDerWaalsContact O-CG 3.31Å; M56-Q60 WeakPolarHBondContact O-CG 3.23Å; M56-Q60 PolarHBondContact O-N 2.88Å; M56-Q60 VanDerWaalsContact O-N 3.09Å; R57-Q60 PolarHBondContact O-N 3.41Å; Q60-A62 VanDerWaalsContact C-N 3.32Å; Q60-A62 PolarHBondContact O-N 2.71Å; Q60-V63 PolarHBondContact O-N 2.93Å; Q60-L64 WeakPolarHBondContact O-CB 3.15Å; Q60-L64 VanDerWaalsContact O-CG 3.28Å; Q60-L64 WeakPolarHBondContact O-CG 3.36Å; Q60-L64 PolarHBondContact O-N 3.15Å
61	I	68.4	Low	64.4	Low	105 Å²	105	99.1 Å²	99.1	54%	0.538	52%	0.523	S	S	.	.	H	α-helix	trans	-63.4	-40.7	173.7	-69.5	161.8	0	0	0	110	R57 L64 C65	R57-I61 HydrophobicContact CB-CD1 4.49Å; R57-I61 VanDerWaalsContact O-CB 3.24Å; R57-I61 WeakPolarHBondContact O-CB 3.43Å; R57-I61 VanDerWaalsContact O-CD1 3.29Å; R57-I61 WeakPolarHBondContact O-CD1 3.34Å; R57-I61 WeakPolarHBondContact O-CG1 2.98Å; R57-I61 PolarHBondContact O-N 3.09Å; I61-L64 PolarHBondContact O-N 3.15Å; I61-C65 WeakPolarHBondContact O-CA 3.17Å; I61-C65 WeakPolarHBondContact O-CB 3.46Å; I61-C65 PolarHBondContact O-N 3.06Å
62	A	72.5	Confident	65.9	Low	45 Å²	45	95.4 Å²	95.4	37%	0.372	52%	0.515	S	S	.	.	H	α-helix	trans	-65.8	-43.4	177.9	0	0	0	0	0	111.1	V58 V59 Q60 C65 V66	V58-A62 WeakPolarHBondContact O-CA 3.44Å; V58-A62 WeakPolarHBondContact O-CB 3.24Å; V58-A62 PolarHBondContact O-N 2.8Å; V59-A62 PolarHBondContact O-N 2.72Å; Q60-A62 VanDerWaalsContact C-N 3.32Å; Q60-A62 PolarHBondContact O-N 2.71Å; A62-C65 PolarHBondContact O-N 3.25Å; A62-V66 WeakPolarHBondContact O-CB 3.11Å; A62-V66 WeakPolarHBondContact O-CG2 3.31Å; A62-V66 PolarHBondContact O-N 3.12Å
63	V	79.9	Confident	67.4	Low	89 Å²	89	93.7 Å²	93.7	54%	0.539	51%	0.508	S	S	.	.	H	α-helix	trans	-65.6	-45.8	176.8	171.8	0	0	0	0	110.6	V59 Q60 C65 V66 L67	V59-V63 HydrophobicContact CG2-CG2 4.34Å; V59-V63 WeakPolarHBondContact O-CB 3.08Å; V59-V63 WeakPolarHBondContact O-CG2 2.92Å; V59-V63 PolarHBondContact O-N 3.43Å; Q60-V63 PolarHBondContact O-N 2.93Å; V63-C65 VanDerWaalsContact C-N 3.35Å; V63-C65 PolarHBondContact O-N 3.36Å; V63-V66 PolarHBondContact O-N 2.72Å; V63-L67 WeakPolarHBondContact O-CB 3.35Å; V63-L67 PolarHBondContact O-N 2.84Å
64	L	67.5	Low	68.9	Low	116 Å²	116	92.2 Å²	92.2	61%	0.607	51%	0.511	S	S	*	.	H	α-helix	trans	-67	-35.5	176.6	-69.4	177	0	0	0	112.5	Q60 I61 S68	Q60-L64 WeakPolarHBondContact O-CB 3.15Å; Q60-L64 VanDerWaalsContact O-CG 3.28Å; Q60-L64 WeakPolarHBondContact O-CG 3.36Å; Q60-L64 PolarHBondContact O-N 3.15Å; I61-L64 PolarHBondContact O-N 3.15Å; L64-S68 WeakPolarHBondContact O-CB 3.37Å; L64-S68 PolarHBondContact O-N 2.97Å
65	C	72	Confident	70.2	Confident	62 Å²	62	91.7 Å²	91.7	42%	0.419	51%	0.512	S	S	.	.	H	α-helix	trans	-70	-47.7	176.3	-175.5	0	0	0	0	110.5	I61 A62 V63 L67 S68 L69	I61-C65 WeakPolarHBondContact O-CA 3.17Å; I61-C65 WeakPolarHBondContact O-CB 3.46Å; I61-C65 PolarHBondContact O-N 3.06Å; A62-C65 PolarHBondContact O-N 3.25Å; V63-C65 VanDerWaalsContact C-N 3.35Å; V63-C65 PolarHBondContact O-N 3.36Å; C65-L67 VanDerWaalsContact C-N 3.3Å; C65-L67 PolarHBondContact O-N 3.4Å; C65-S68 PolarHBondContact O-N 3.34Å; C65-L69 VanDerWaalsContact O-CB 3.22Å; C65-L69 WeakPolarHBondContact O-CB 3.21Å; C65-L69 WeakPolarHBondContact O-CG 3.16Å; C65-L69 PolarHBondContact O-N 3.04Å
66	V	79	Confident	71	Confident	89 Å²	89	93.1 Å²	93.1	54%	0.539	51%	0.51	S	S	.	.	H	α-helix	trans	-61.7	-40.8	174.5	171.3	0	0	0	0	110.4	A62 V63 T70	A62-V66 WeakPolarHBondContact O-CB 3.11Å; A62-V66 WeakPolarHBondContact O-CG2 3.31Å; A62-V66 PolarHBondContact O-N 3.12Å; V63-V66 PolarHBondContact O-N 2.72Å; V66-T70 VanDerWaalsContact O-CB 3.24Å; V66-T70 WeakPolarHBondContact O-CB 3.22Å; V66-T70 PolarHBondContact O-N 3.44Å; V66-T70 PolarHBondContact O-OG1 3.37Å
67	L	81.8	Confident	71.7	Confident	104 Å²	104	93.9 Å²	93.9	55%	0.545	51%	0.51	S	S	.	.	H	α-helix	trans	-63.6	-47.9	175.3	-172.4	68.2	0	0	0	111.2	V63 C65 T70 V71	V63-L67 WeakPolarHBondContact O-CB 3.35Å; V63-L67 PolarHBondContact O-N 2.84Å; C65-L67 VanDerWaalsContact C-N 3.3Å; C65-L67 PolarHBondContact O-N 3.4Å; L67-T70 PolarHBondContact O-N 3.3Å; L67-V71 WeakPolarHBondContact O-CB 3.18Å; L67-V71 VanDerWaalsContact O-CG2 3.23Å; L67-V71 WeakPolarHBondContact O-CG2 2.9Å; L67-V71 PolarHBondContact O-N 2.97Å
68	S	72.3	Confident	72.5	Confident	71 Å²	71	94.3 Å²	94.3	50%	0.497	52%	0.52	S	S	.	.	H	α-helix	trans	-65.2	-41.9	177.8	-175.2	0	0	0	0	112.3	L64 C65 V71 M72	L64-S68 WeakPolarHBondContact O-CB 3.37Å; L64-S68 PolarHBondContact O-N 2.97Å; C65-S68 PolarHBondContact O-N 3.34Å; S68-V71 PolarHBondContact O-N 3.1Å; S68-M72 WeakPolarHBondContact O-CB 3.18Å; S68-M72 VanDerWaalsContact O-CG 3.31Å; S68-M72 WeakPolarHBondContact O-CG 3.1Å; S68-M72 PolarHBondContact O-N 3.25Å
69	L	82	Confident	73	Confident	88 Å²	88	91.9 Å²	91.9	46%	0.461	51%	0.511	S	S	.	.	H	α-helix	trans	-63.4	-42.5	173.9	-73	172.8	0	0	0	110.8	C65 M72 F73	C65-L69 VanDerWaalsContact O-CB 3.22Å; C65-L69 WeakPolarHBondContact O-CB 3.21Å; C65-L69 WeakPolarHBondContact O-CG 3.16Å; C65-L69 PolarHBondContact O-N 3.04Å; L69-M72 PolarHBondContact O-N 3.48Å; L69-F73 HydrophobicContact CB-CD2 4.46Å; L69-F73 WeakPolarHBondContact O-CB 3.01Å; L69-F73 WeakPolarHBondContact O-CD2 3.42Å; L69-F73 PolarHBondContact O-N 3.45Å
70	T	81.1	Confident	72.9	Confident	87 Å²	87	89.5 Å²	89.5	53%	0.534	50%	0.498	S	S	.	.	H	α-helix	trans	-66.1	-39.3	176.9	-58.2	0	0	0	0	111.6	V66 L67 F73 G74	V66-T70 VanDerWaalsContact O-CB 3.24Å; V66-T70 WeakPolarHBondContact O-CB 3.22Å; V66-T70 PolarHBondContact O-N 3.44Å; V66-T70 PolarHBondContact O-OG1 3.37Å; L67-T70 PolarHBondContact O-N 3.3Å; T70-F73 PolarHBondContact O-N 3.38Å; T70-G74 PolarHBondContact O-N 3.38Å
71	V	83.8	Confident	73.6	Confident	76 Å²	76	88.6 Å²	88.6	46%	0.461	50%	0.497	S	S	.	.	H	α-helix	trans	-65.2	-46.4	174.1	169.3	0	0	0	0	110.3	L67 S68 F73 G74 I75	L67-V71 WeakPolarHBondContact O-CB 3.18Å; L67-V71 VanDerWaalsContact O-CG2 3.23Å; L67-V71 WeakPolarHBondContact O-CG2 2.9Å; L67-V71 PolarHBondContact O-N 2.97Å; S68-V71 PolarHBondContact O-N 3.1Å; V71-F73 PolarHBondContact O-N 2.86Å; V71-G74 PolarHBondContact O-N 3.18Å; V71-I75 HydrophobicContact CG1-CD1 3.44Å; V71-I75 VanDerWaalsContact CG1-CD1 3.44Å; V71-I75 HydrophobicContact CG1-CG1 4.26Å; V71-I75 WeakPolarHBondContact O-CB 3.39Å; V71-I75 WeakPolarHBondContact O-CD1 3.35Å; V71-I75 WeakPolarHBondContact O-CG1 3.28Å; V71-I75 PolarHBondContact O-N 3.43Å
72	M	74.4	Confident	73.3	Confident	121 Å²	121	88.4 Å²	88.4	60%	0.596	50%	0.497	S	S	*	.	H	α-helix	trans	-60.8	-45.4	174.3	-75	-67.8	-81	0	0	111	S68 L69 G74 I75 F76	S68-M72 WeakPolarHBondContact O-CB 3.18Å; S68-M72 VanDerWaalsContact O-CG 3.31Å; S68-M72 WeakPolarHBondContact O-CG 3.1Å; S68-M72 PolarHBondContact O-N 3.25Å; L69-M72 PolarHBondContact O-N 3.48Å; M72-G74 PolarHBondContact O-N 3.21Å; M72-I75 PolarHBondContact O-N 3.37Å; M72-F76 WeakPolarHBondContact O-CA 3.47Å; M72-F76 WeakPolarHBondContact O-CB 3.39Å; M72-F76 PolarHBondContact O-N 2.95Å
73	F	74.3	Confident	72.6	Confident	120 Å²	120	92 Å²	92	53%	0.526	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-40.1	174.3	-82.9	-64.8	0	0	0	111.6	L69 T70 V71 F76 F77	L69-F73 HydrophobicContact CB-CD2 4.46Å; L69-F73 WeakPolarHBondContact O-CB 3.01Å; L69-F73 WeakPolarHBondContact O-CD2 3.42Å; L69-F73 PolarHBondContact O-N 3.45Å; T70-F73 PolarHBondContact O-N 3.38Å; V71-F73 PolarHBondContact O-N 2.86Å; F73-F76 CarbonylContact O-C 3.42Å; F73-F76 PolarHBondContact O-N 2.9Å; F73-F77 HydrophobicContact CB-CD2 4.28Å; F73-F77 HydrophobicContact CB-CE2 4.33Å; F73-F77 HydrophobicContact CD1-CE2 4.1Å; F73-F77 VanDerWaalsContact O-CB 3.29Å; F73-F77 WeakPolarHBondContact O-CB 3.1Å; F73-F77 WeakPolarHBondContact O-CD2 3.23Å; F73-F77 PolarHBondContact O-N 2.86Å
74	G	78.5	Confident	71.9	Confident	42 Å²	42	93 Å²	93	43%	0.433	51%	0.508	S	S	.	.	H	α-helix	trans	-65	-45.2	176.6	0	0	0	0	0	112.8	T70 V71 M72 F76 F77 L78	T70-G74 PolarHBondContact O-N 3.38Å; V71-G74 PolarHBondContact O-N 3.18Å; M72-G74 PolarHBondContact O-N 3.21Å; G74-F76 VanDerWaalsContact C-N 3.32Å; G74-F77 PolarHBondContact O-N 2.78Å; G74-L78 VanDerWaalsContact O-CB 3.24Å; G74-L78 WeakPolarHBondContact O-CB 3.31Å; G74-L78 PolarHBondContact O-N 3.37Å
75	I	74.4	Confident	71.4	Confident	104 Å²	104	95.2 Å²	95.2	53%	0.533	51%	0.513	S	S	.	.	H	α-helix	trans	-72.4	-27.7	175.7	-56.1	160	0	0	0	110.8	V71 M72 G79	V71-I75 HydrophobicContact CG1-CD1 3.44Å; V71-I75 VanDerWaalsContact CG1-CD1 3.44Å; V71-I75 HydrophobicContact CG1-CG1 4.26Å; V71-I75 WeakPolarHBondContact O-CB 3.39Å; V71-I75 WeakPolarHBondContact O-CD1 3.35Å; V71-I75 WeakPolarHBondContact O-CG1 3.28Å; V71-I75 PolarHBondContact O-N 3.43Å; M72-I75 PolarHBondContact O-N 3.37Å; I75-G79 WeakPolarHBondContact O-CA 3.19Å; I75-G79 PolarHBondContact O-N 3.45Å
76	F	69.7	Low	70.5	Confident	132 Å²	132	94.6 Å²	94.6	58%	0.579	51%	0.509	S	S	*	.	H	α-helix	trans	-83.7	-27.5	176.6	-164.9	-95.2	0	0	0	111.4	M72 F73 G74 G79 C80	M72-F76 WeakPolarHBondContact O-CA 3.47Å; M72-F76 WeakPolarHBondContact O-CB 3.39Å; M72-F76 PolarHBondContact O-N 2.95Å; F73-F76 CarbonylContact O-C 3.42Å; F73-F76 PolarHBondContact O-N 2.9Å; G74-F76 VanDerWaalsContact C-N 3.32Å; F76-G79 CarbonylContact O-C 3.51Å; F76-C80 WeakPolarHBondContact CD1-SG 3.41Å; F76-C80 WeakPolarHBondContact CE1-SG 3.34Å; F76-C80 VanDerWaalsContact CZ-SG 3.56Å; F76-C80 WeakPolarHBondContact O-CA 3.24Å; F76-C80 WeakPolarHBondContact O-CB 3.29Å; F76-C80 PolarHBondContact O-N 3.16Å; F76-C80 PolarHBondContact O-SG 3.28Å
77	F	65.8	Low	69.1	Low	131 Å²	131	96.5 Å²	96.5	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-74.7	-40.3	168.3	-85.9	-68	0	0	0	110	F73 G74 G79 N81	F73-F77 HydrophobicContact CB-CD2 4.28Å; F73-F77 HydrophobicContact CB-CE2 4.33Å; F73-F77 HydrophobicContact CD1-CE2 4.1Å; F73-F77 VanDerWaalsContact O-CB 3.29Å; F73-F77 WeakPolarHBondContact O-CB 3.1Å; F73-F77 WeakPolarHBondContact O-CD2 3.23Å; F73-F77 PolarHBondContact O-N 2.86Å; G74-F77 PolarHBondContact O-N 2.78Å; F77-G79 VanDerWaalsContact C-N 3.33Å; F77-N81 WeakPolarHBondContact O-CB 3.07Å; F77-N81 PolarHBondContact O-N 2.94Å; F77-N81 PolarHBondContact O-ND2 3.05Å
78	L	69.7	Low	67.8	Low	110 Å²	110	96.4 Å²	96.4	58%	0.576	52%	0.521	S	S	*	.	H	α-helix	trans	-64.3	-42.9	169.3	-175.5	58.7	0	0	0	110.2	G74 L82	G74-L78 VanDerWaalsContact O-CB 3.24Å; G74-L78 WeakPolarHBondContact O-CB 3.31Å; G74-L78 PolarHBondContact O-N 3.37Å; L78-L82 HydrophobicContact CD1-CD1 4.11Å; L78-L82 HydrophobicContact CD1-CG 4.39Å; L78-L82 HydrophobicContact CG-CD1 3.87Å; L78-L82 WeakPolarHBondContact O-CB 3.17Å; L78-L82 WeakPolarHBondContact O-CD1 3.48Å; L78-L82 WeakPolarHBondContact O-CG 3.38Å; L78-L82 PolarHBondContact O-N 2.82Å
79	G	66.6	Low	66.7	Low	32 Å²	32	99 Å²	99	33%	0.33	53%	0.527	S	S	.	.	H	α-helix	trans	-72.1	-35.3	-178.1	0	0	0	0	0	113	I75 F76 F77 L82 M83	I75-G79 WeakPolarHBondContact O-CA 3.19Å; I75-G79 PolarHBondContact O-N 3.45Å; F76-G79 CarbonylContact O-C 3.51Å; F77-G79 VanDerWaalsContact C-N 3.33Å; G79-L82 CarbonylContact O-C 3.51Å; G79-M83 WeakPolarHBondContact O-CA 3.46Å; G79-M83 WeakPolarHBondContact O-CB 2.99Å; G79-M83 PolarHBondContact O-N 2.91Å
80	C	66.9	Low	65.3	Low	34 Å²	34	100.3 Å²	100.3	23%	0.23	53%	0.533	C	S	.	.	H	α-helix	trans	-79.8	-37.4	172.7	-73.3	0	0	0	0	111.5	F76 L82 M83 I84	F76-C80 WeakPolarHBondContact CD1-SG 3.41Å; F76-C80 WeakPolarHBondContact CE1-SG 3.34Å; F76-C80 VanDerWaalsContact CZ-SG 3.56Å; F76-C80 WeakPolarHBondContact O-CA 3.24Å; F76-C80 WeakPolarHBondContact O-CB 3.29Å; F76-C80 PolarHBondContact O-N 3.16Å; F76-C80 PolarHBondContact O-SG 3.28Å; C80-L82 VanDerWaalsContact C-N 3.25Å; C80-L82 PolarHBondContact O-N 3.43Å; C80-M83 PolarHBondContact O-N 3.19Å; C80-I84 WeakPolarHBondContact O-CB 3.45Å; C80-I84 WeakPolarHBondContact O-CG2 3.34Å; C80-I84 PolarHBondContact O-N 3.28Å
81	N	64.4	Low	63.7	Low	102 Å²	102	101.6 Å²	101.6	55%	0.545	54%	0.536	S	S	.	.	H	α-helix	trans	-63.3	-36	168.2	-84.7	-71.3	0	0	0	110.8	F77 K85	F77-N81 WeakPolarHBondContact O-CB 3.07Å; F77-N81 PolarHBondContact O-N 2.94Å; F77-N81 PolarHBondContact O-ND2 3.05Å; N81-K85 WeakPolarHBondContact O-CB 3.37Å; N81-K85 PolarHBondContact O-N 3.24Å; N81-K85 VanDerWaalsContact O-N 3.1Å
82	L	62.5	Low	61.7	Low	102 Å²	102	103.7 Å²	103.7	53%	0.534	54%	0.539	S	S	.	.	H	α-helix	trans	-73.9	-33.9	172	-71.8	167.8	0	0	0	111.7	L78 G79 C80 K85 S86	L78-L82 HydrophobicContact CD1-CD1 4.11Å; L78-L82 HydrophobicContact CD1-CG 4.39Å; L78-L82 HydrophobicContact CG-CD1 3.87Å; L78-L82 WeakPolarHBondContact O-CB 3.17Å; L78-L82 WeakPolarHBondContact O-CD1 3.48Å; L78-L82 WeakPolarHBondContact O-CG 3.38Å; L78-L82 PolarHBondContact O-N 2.82Å; G79-L82 CarbonylContact O-C 3.51Å; C80-L82 VanDerWaalsContact C-N 3.25Å; C80-L82 PolarHBondContact O-N 3.43Å; L82-K85 CarbonylContact O-C 3.49Å; L82-K85 PolarHBondContact O-N 3.06Å; L82-S86 WeakPolarHBondContact O-CA 3.22Å; L82-S86 WeakPolarHBondContact O-CB 3.08Å; L82-S86 PolarHBondContact O-N 2.98Å; L82-S86 PolarHBondContact O-OG 3.33Å
83	M	59	Low	60.3	Low	119 Å²	119	103.2 Å²	103.2	59%	0.586	54%	0.539	S	S	*	.	H	α-helix	trans	-74.9	-45.9	-179.4	-169.7	178.7	75.2	0	0	111.1	G79 C80 K85 S86 E87	G79-M83 WeakPolarHBondContact O-CA 3.46Å; G79-M83 WeakPolarHBondContact O-CB 2.99Å; G79-M83 PolarHBondContact O-N 2.91Å; C80-M83 PolarHBondContact O-N 3.19Å; M83-K85 VanDerWaalsContact C-N 3.26Å; M83-K85 PolarHBondContact O-N 3.46Å; M83-S86 WeakPolarHBondContact CA-OG 3.47Å; M83-S86 CarbonylContact O-C 3.58Å; M83-S86 WeakPolarHBondContact O-CA 3.5Å; M83-S86 PolarHBondContact O-N 3Å; M83-S86 PolarHBondContact O-OG 3.38Å; M83-E87 PolarHBondContact O-N 2.96Å
84	I	63.5	Low	58.7	Low	111 Å²	111	102.6 Å²	102.6	57%	0.569	54%	0.544	S	S	*	.	H	α-helix	trans	-64.4	-31.6	172.4	-142.3	79.8	0	0	0	110.7	C80	C80-I84 WeakPolarHBondContact O-CB 3.45Å; C80-I84 WeakPolarHBondContact O-CG2 3.34Å; C80-I84 PolarHBondContact O-N 3.28Å
85	K	56.9	Low	57.1	Low	162 Å²	162	107.6 Å²	107.6	70%	0.704	55%	0.554	S	S	*	*	H	α-helix	trans	-79.4	-24	171.1	-173.4	160.4	164.2	64.3	0	113.1	N81 L82 M83	N81-K85 WeakPolarHBondContact O-CB 3.37Å; N81-K85 PolarHBondContact O-N 3.24Å; N81-K85 VanDerWaalsContact O-N 3.1Å; L82-K85 CarbonylContact O-C 3.49Å; L82-K85 PolarHBondContact O-N 3.06Å; M83-K85 VanDerWaalsContact C-N 3.26Å; M83-K85 PolarHBondContact O-N 3.46Å
86	S	53	Low	55.5	Low	49 Å²	49	106.3 Å²	106.3	34%	0.343	55%	0.548	S	S	.	.	H	α-helix	trans	-83.4	-19.5	175.2	74.7	0	0	0	0	113.2	L82 M83 S88 M89 I90	L82-S86 WeakPolarHBondContact O-CA 3.22Å; L82-S86 WeakPolarHBondContact O-CB 3.08Å; L82-S86 PolarHBondContact O-N 2.98Å; L82-S86 PolarHBondContact O-OG 3.33Å; M83-S86 WeakPolarHBondContact CA-OG 3.47Å; M83-S86 CarbonylContact O-C 3.58Å; M83-S86 WeakPolarHBondContact O-CA 3.5Å; M83-S86 PolarHBondContact O-N 3Å; M83-S86 PolarHBondContact O-OG 3.38Å; S86-S88 PolarHBondContact O-N 3.4Å; S86-M89 PolarHBondContact O-N 3.4Å; S86-I90 PolarHBondContact O-N 3.22Å; S86-I90 VanDerWaalsContact O-N 3.14Å
87	E	51.4	Low	54.3	Low	129 Å²	129	110.7 Å²	110.7	60%	0.603	56%	0.561	S	S	*	*	H	α-helix	trans	-56	-33.3	170.5	-164.8	-178.9	148.5	0	0	111	M83 M89	M83-E87 PolarHBondContact O-N 2.96Å; E87-M89 PolarHBondContact O-N 2.97Å
88	S	53.9	Low	53.3	Low	103 Å²	103	112.3 Å²	112.3	72%	0.72	56%	0.563	S	S	*	*	H	α-helix	trans	-80	-5.9	176.6	-171.7	0	0	0	0	115	S86	S86-S88 PolarHBondContact O-N 3.4Å
89	M	49.6	Very low	51.9	Low	126 Å²	126	112 Å²	112	62%	0.621	57%	0.568	S	S	*	*	H	α-helix	trans	-116.8	-24.4	-177.6	-165.8	174.7	171.6	0	0	114.1	S86 E87 F92 L93	S86-M89 PolarHBondContact O-N 3.4Å; E87-M89 PolarHBondContact O-N 2.97Å; M89-F92 WeakPolarHBondContact O-CB 3.23Å; M89-F92 PolarHBondContact O-N 3Å; M89-L93 PolarHBondContact O-N 2.76Å
90	I	50.9	Low	50.6	Low	115 Å²	115	113.2 Å²	113.2	59%	0.59	57%	0.571	S	S	*	*	H	α-helix	trans	-75.6	-24.1	171.9	61.6	166.4	0	0	0	113.2	S86 F92 L93 V94	S86-I90 PolarHBondContact O-N 3.22Å; S86-I90 VanDerWaalsContact O-N 3.14Å; I90-F92 PolarHBondContact O-N 3.04Å; I90-L93 PolarHBondContact O-N 3.15Å; I90-V94 PolarHBondContact O-N 3.49Å
91	N	49.5	Very low	49.7	Very low	113 Å²	113	120.2 Å²	120.2	60%	0.604	60%	0.598	S	S	*	*	H	α-helix	trans	-73.7	-11.6	168.9	-168.6	38.7	0	0	0	112.7	K95	N91-K95 WeakPolarHBondContact O-CB 3.36Å
92	F	41.3	Very low	48.4	Very low	121 Å²	121	121.1 Å²	121.1	53%	0.531	60%	0.603	S	S	.	*	H	α-helix	trans	-90.8	-37	172.1	-162.1	-95.3	0	0	0	111.2	M89 I90 K95 D96	M89-F92 WeakPolarHBondContact O-CB 3.23Å; M89-F92 PolarHBondContact O-N 3Å; I90-F92 PolarHBondContact O-N 3.04Å; F92-K95 CarbonylContact O-C 3.49Å; F92-K95 WeakPolarHBondContact O-CA 3.16Å; F92-K95 WeakPolarHBondContact O-CB 3.23Å; F92-K95 PolarHBondContact O-N 2.97Å; F92-K95 VanDerWaalsContact O-N 3.12Å; F92-D96 WeakPolarHBondContact CD1-OD2 3.35Å; F92-D96 WeakPolarHBondContact CE1-OD2 3.12Å; F92-D96 PolarHBondContact O-N 2.97Å
93	L	44.3	Very low	47.5	Very low	111 Å²	111	121.5 Å²	121.5	58%	0.581	61%	0.609	S	S	*	*	H	α-helix	trans	-76.4	-23.2	174.2	-74.9	167.3	0	0	0	114.6	M89 I90 K95 D96	M89-L93 PolarHBondContact O-N 2.76Å; I90-L93 PolarHBondContact O-N 3.15Å; L93-K95 VanDerWaalsContact C-N 3.27Å; L93-D96 PolarHBondContact O-N 2.92Å
94	V	41.4	Very low	46.6	Very low	106 Å²	106	123 Å²	123	64%	0.642	61%	0.614	S	S	*	*	S	Bend	trans	-74.3	-22.4	165.3	104.4	0	0	0	0	111.8	I90	I90-V94 PolarHBondContact O-N 3.49Å
95	K	44.1	Very low	45.7	Very low	148 Å²	148	123.2 Å²	123.2	64%	0.643	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-6.4	173.6	-159.6	161.1	67.1	157.7	0	113.4	N91 F92 L93	N91-K95 WeakPolarHBondContact O-CB 3.36Å; F92-K95 CarbonylContact O-C 3.49Å; F92-K95 WeakPolarHBondContact O-CA 3.16Å; F92-K95 WeakPolarHBondContact O-CB 3.23Å; F92-K95 PolarHBondContact O-N 2.97Å; F92-K95 VanDerWaalsContact O-N 3.12Å; L93-K95 VanDerWaalsContact C-N 3.27Å
96	D	42	Very low	44.8	Very low	76 Å²	76	120.6 Å²	120.6	41%	0.406	62%	0.619	S	S	.	*	T	Hydrogen-bonded Turn	trans	-99.6	13.2	171.1	-82.3	-44.2	0	0	0	113.3	F92 L93 R98 P99	F92-D96 WeakPolarHBondContact CD1-OD2 3.35Å; F92-D96 WeakPolarHBondContact CE1-OD2 3.12Å; F92-D96 PolarHBondContact O-N 2.97Å; L93-D96 PolarHBondContact O-N 2.92Å; D96-R98 VanDerWaalsContact C-N 3.26Å; D96-R98 PolarHBondContact O-N 3.42Å; D96-P99 WeakPolarHBondContact O-CD 3.08Å
97	R	44.3	Very low	44.4	Very low	225 Å²	225	126.7 Å²	126.7	85%	0.849	64%	0.644	S	S	*	*	S	Bend	trans	-73.8	-10.1	171.2	-117.4	-103.5	-168.7	176.2	2.1	113.9
98	R	44.8	Very low	44.3	Very low	165 Å²	165	128.8 Å²	128.8	62%	0.623	66%	0.657	S	S	*	*			trans	-169.1	73.6	170.5	-118.8	-80	-129.1	170	4.6	112.3	D96 S100 K101	D96-R98 VanDerWaalsContact C-N 3.26Å; D96-R98 PolarHBondContact O-N 3.42Å; R98-S100 WeakPolarHBondContact CD-OG 2.83Å; R98-S100 PolarHBondContact NE-OG 3.19Å; R98-S100 PolarHBondContact NH1-O 3.42Å; R98-S100 PolarHBondContact NH1-OG 3.26Å; R98-S100 PolarHBondContact O-N 2.93Å; R98-K101 PolarHBondContact NH1-O 3.04Å
99	P	39.4	Very low	43.8	Very low	104 Å²	104	127.2 Å²	127.2	68%	0.675	66%	0.657	S	S	*	*			trans	-72.5	67.5	148.3	33.7	-32	0	0	0	108.3	D96	D96-P99 WeakPolarHBondContact O-CD 3.08Å
100	S	39.3	Very low	43.5	Very low	57 Å²	57	130.1 Å²	130.1	40%	0.399	67%	0.674	S	S	.	*			trans	-137.5	113.3	148.4	31.9	0	0	0	0	108.4	R98 D102	R98-S100 WeakPolarHBondContact CD-OG 2.83Å; R98-S100 PolarHBondContact NE-OG 3.19Å; R98-S100 PolarHBondContact NH1-O 3.42Å; R98-S100 PolarHBondContact NH1-OG 3.26Å; R98-S100 PolarHBondContact O-N 2.93Å; S100-D102 PolarHBondContact O-N 3.48Å
101	K	48	Very low	42.8	Very low	180 Å²	180	131.9 Å²	131.9	78%	0.783	72%	0.72	S	S	*	*				37.2	91.7	118.2	-152.7	176.4	94.7	83.8	0	111.4	R98	R98-K101 PolarHBondContact NH1-O 3.04Å
102	D	37.3	Very low	42.4	Very low	122 Å²	122	132.8 Å²	132.8	65%	0.652	73%	0.726	S	S	*	*				-167.1	134.3	120.3	-79.6	-44.8	0	0	0	108.8	S100	S100-D102 PolarHBondContact O-N 3.48Å
103	V	43.3	Very low	42.5	Very low	109 Å²	109	133.4 Å²	133.4	66%	0.661	74%	0.737	S	S	*	*			trans	70.2	81	142.1	151.7	0	0	0	0	114.7
104	E	40.8	Very low	42.4	Very low	150 Å²	150	134.7 Å²	134.7	70%	0.701	75%	0.745	S	S	*	*				78.1	109.6	101	90.5	-156.7	142.9	0	0	111.8	V106	E104-V106 PolarHBondContact O-N 3.35Å
105	T	43.9	Very low	42.5	Very low	117 Å²	117	136.4 Å²	136.4	72%	0.718	75%	0.751	S	S	*	*				16.9	103.3	129.9	35.4	0	0	0	0	114
106	V	39.1	Very low	42.4	Very low	107 Å²	107	135.6 Å²	135.6	65%	0.648	76%	0.758	S	S	*	*	S	Bend		48.7	89.8	87.8	-179.9	0	0	0	0	108.9	E104 I108	E104-V106 PolarHBondContact O-N 3.35Å; V106-I108 PolarHBondContact O-N 2.92Å
107	M	42.7	Very low	42.4	Very low	176 Å²	176	139.6 Å²	139.6	87%	0.867	78%	0.781	S	S	*	*				57.3	58.5	113.5	-157.6	175.8	70.6	0	0	114.7
108	I	50.4	Low	42.3	Very low	174 Å²	174	133.5 Å²	133.5	89%	0.892	78%	0.777	S	S	*	*			trans	-127.8	82.4	151	-45.7	172	0	0	0	106.3	V106	V106-I108 PolarHBondContact O-N 2.92Å
109	G	42.5	Very low	42.1	Very low	69 Å²	69	131.1 Å²	131.1	71%	0.711	79%	0.788	S	S	*	*			trans	173.4	39.8	-174.1	0	0	0	0	0	114.6
110	L	45.2	Very low	42.3	Very low	188 Å²	188	133.3 Å²	133.3	98%	0.984	80%	0.798	S	S	*	*			trans	-130.6	88.3	155.8	-133	95	0	0	0	105.9
111	G	34.8	Very low	42.5	Very low	151 Å²	151	140.3 Å²	140.3	100%	1.557	83%	0.834	S	S	*	*			trans	178.4	0	-176.3	0	0	0	0	0	109.4

Retrieved 111 of 111 residues in 40.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).