A0A3B3W0X6_9TELE Loading...

Otoraplin

AlphaFold DB , UniProt , Accession A0A3B3W0X6, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 132 aa.

						>A0A3B3W0X6_9TELE|A0A3B3W0X6
LLPTMSPLVSLLLVGLLHQTTMAVRMDKLADRKMCGDAECSYVLSMATAVDDFIAPDCRFINIKKGQMVYVYSKLIPPDGAGVFWYGSVYSQRYVDQMGRTGYFPATVVKETRTFTDNTVRKQTTDMDFYCD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	43.6	Very low	62.3	Low	221 Å²	221	114.8 Å²	114.8	100%	1.157	66%	0.655	S	S	*	*				0	111.1	0	-96.2	72.3	0	0	0	107.6
2	L	52.5	Low	62.4	Low	164 Å²	164	114 Å²	114	86%	0.859	65%	0.646	S	S	*	*			trans	-65.5	130.9	166.4	-105.1	74.1	0	0	0	107.5	T4	L2-T4 PolarHBondContact O-N 3.43Å
3	P	58.8	Low	62.4	Low	111 Å²	111	112.6 Å²	112.6	72%	0.721	64%	0.635	S	S	*	*			trans	-66.9	120	176.6	27.3	-30.6	0	0	0	108.3	M5	P3-M5 PolarHBondContact O-N 2.84Å
4	T	64.9	Low	62.5	Low	139 Å²	139	110 Å²	110	85%	0.853	62%	0.623	S	S	*	*			trans	-68.7	96.3	171.8	46.7	0	0	0	0	108	L2 S6	L2-T4 PolarHBondContact O-N 3.43Å; T4-S6 PolarHBondContact O-N 3.37Å
5	M	62.4	Low	62.5	Low	116 Å²	116	105.3 Å²	105.3	57%	0.571	61%	0.608	S	S	*	*			trans	-64	127.5	175.8	-62.7	-136.8	77.9	0	0	109.3	P3 V9	P3-M5 PolarHBondContact O-N 2.84Å; M5-V9 HydrophobicContact CE-CB 4.43Å; M5-V9 HydrophobicContact CE-CG1 3.54Å; M5-V9 HydrophobicContact SD-CG1 4.4Å
6	S	72.3	Confident	62.3	Low	58 Å²	58	107.3 Å²	107.3	41%	0.406	62%	0.615	S	S	.	*			trans	-53.7	139.6	178.5	169.4	0	0	0	0	110.7	T4 L8 V9 S10	T4-S6 PolarHBondContact O-N 3.37Å; S6-L8 PolarHBondContact O-N 3.11Å; S6-L8 VanDerWaalsContact O-N 3.08Å; S6-V9 WeakPolarHBondContact O-CA 3.44Å; S6-V9 WeakPolarHBondContact O-CB 3.41Å; S6-V9 PolarHBondContact O-N 2.68Å; S6-S10 PolarHBondContact O-N 3.34Å; S6-S10 VanDerWaalsContact O-N 3.11Å
7	P	65.4	Low	61.9	Low	95 Å²	95	108.9 Å²	108.9	62%	0.617	62%	0.62	S	S	*	*	H	α-helix	trans	-57.7	-27.8	-179.2	23.2	-33.6	0	0	0	112.7	S10 L11	P7-S10 PolarHBondContact O-N 2.86Å; P7-L11 WeakPolarHBondContact O-CB 3.32Å; P7-L11 WeakPolarHBondContact O-CD1 3.37Å; P7-L11 WeakPolarHBondContact O-CG 3.22Å; P7-L11 PolarHBondContact O-N 2.8Å
8	L	65.2	Low	61.5	Low	121 Å²	121	111.1 Å²	111.1	63%	0.634	62%	0.624	S	S	*	*	H	α-helix	trans	-65.1	-39.9	172.1	-105.6	122.7	0	0	0	112.6	S6 L11 L12	S6-L8 PolarHBondContact O-N 3.11Å; S6-L8 VanDerWaalsContact O-N 3.08Å; L8-L11 PolarHBondContact O-N 2.81Å; L8-L12 WeakPolarHBondContact O-CB 3.31Å; L8-L12 WeakPolarHBondContact O-CD1 2.99Å; L8-L12 PolarHBondContact O-N 3.37Å
9	V	70.3	Confident	61.4	Low	56 Å²	56	114.1 Å²	114.1	34%	0.339	63%	0.632	S	S	.	*	H	α-helix	trans	-69.5	-39.2	178.2	177.7	0	0	0	0	110.1	M5 S6 L12 L13	M5-V9 HydrophobicContact CE-CB 4.43Å; M5-V9 HydrophobicContact CE-CG1 3.54Å; M5-V9 HydrophobicContact SD-CG1 4.4Å; S6-V9 WeakPolarHBondContact O-CA 3.44Å; S6-V9 WeakPolarHBondContact O-CB 3.41Å; S6-V9 PolarHBondContact O-N 2.68Å; V9-L12 PolarHBondContact O-N 2.53Å; V9-L13 HydrophobicContact CG1-CD1 3.94Å; V9-L13 WeakPolarHBondContact O-CB 3.42Å; V9-L13 WeakPolarHBondContact O-CD1 3.41Å; V9-L13 PolarHBondContact O-N 3.39Å
10	S	64.8	Low	61	Low	54 Å²	54	114.1 Å²	114.1	38%	0.378	64%	0.636	S	S	.	*	H	α-helix	trans	-62.9	-43.2	173.2	-56.7	0	0	0	0	112.1	S6 P7 L13 V14	S6-S10 PolarHBondContact O-N 3.34Å; S6-S10 VanDerWaalsContact O-N 3.11Å; P7-S10 PolarHBondContact O-N 2.86Å; S10-L13 PolarHBondContact O-N 2.76Å; S10-V14 VanDerWaalsContact O-CG2 3.26Å; S10-V14 WeakPolarHBondContact O-CG2 3.42Å; S10-V14 PolarHBondContact O-N 3.12Å
11	L	64.9	Low	60.8	Low	128 Å²	128	115.2 Å²	115.2	67%	0.67	65%	0.646	S	S	*	*	H	α-helix	trans	-65	-39	175.8	-82.3	158.2	0	0	0	112.7	P7 L8 V14 G15	P7-L11 WeakPolarHBondContact O-CB 3.32Å; P7-L11 WeakPolarHBondContact O-CD1 3.37Å; P7-L11 WeakPolarHBondContact O-CG 3.22Å; P7-L11 PolarHBondContact O-N 2.8Å; L8-L11 PolarHBondContact O-N 2.81Å; L11-V14 PolarHBondContact O-N 3.12Å; L11-G15 PolarHBondContact O-N 2.83Å
12	L	63.7	Low	61.3	Low	105 Å²	105	112.2 Å²	112.2	55%	0.55	63%	0.628	S	S	.	*	H	α-helix	trans	-64.2	-43.1	173.9	-98.5	141	0	0	0	112.1	L8 V9 G15 L16	L8-L12 WeakPolarHBondContact O-CB 3.31Å; L8-L12 WeakPolarHBondContact O-CD1 2.99Å; L8-L12 PolarHBondContact O-N 3.37Å; V9-L12 PolarHBondContact O-N 2.53Å; L12-G15 PolarHBondContact O-N 2.83Å; L12-L16 VanDerWaalsContact O-CD1 3.25Å; L12-L16 WeakPolarHBondContact O-CD1 3.29Å; L12-L16 PolarHBondContact O-N 2.87Å
13	L	63	Low	61.4	Low	96 Å²	96	107.7 Å²	107.7	50%	0.503	61%	0.614	S	S	.	*	H	α-helix	trans	-63.6	-42.7	175.9	-84.7	155.8	0	0	0	112.1	V9 S10 L16 L17	V9-L13 HydrophobicContact CG1-CD1 3.94Å; V9-L13 WeakPolarHBondContact O-CB 3.42Å; V9-L13 WeakPolarHBondContact O-CD1 3.41Å; V9-L13 PolarHBondContact O-N 3.39Å; S10-L13 PolarHBondContact O-N 2.76Å; L13-L16 PolarHBondContact O-N 2.82Å; L13-L17 WeakPolarHBondContact O-CD1 3.25Å; L13-L17 PolarHBondContact O-N 3.09Å
14	V	63.9	Low	61.6	Low	76 Å²	76	108 Å²	108	46%	0.461	61%	0.614	S	S	.	*	H	α-helix	trans	-67.6	-38.1	176	175.3	0	0	0	0	111.1	S10 L11 L17 H18	S10-V14 VanDerWaalsContact O-CG2 3.26Å; S10-V14 WeakPolarHBondContact O-CG2 3.42Å; S10-V14 PolarHBondContact O-N 3.12Å; L11-V14 PolarHBondContact O-N 3.12Å; V14-L17 PolarHBondContact O-N 3.4Å; V14-H18 PolarHBondContact O-N 3.49Å; V14-H18 PolarHBondContact O-ND1 2.84Å
15	G	62.2	Low	61.7	Low	39 Å²	39	111 Å²	111	40%	0.402	61%	0.609	S	S	.	*	H	α-helix	trans	-64.5	-36.4	175.1	0	0	0	0	0	113.6	L11 L12 H18	L11-G15 PolarHBondContact O-N 2.83Å; L12-G15 PolarHBondContact O-N 2.83Å; G15-H18 PolarHBondContact O-N 3.18Å
16	L	59.3	Low	62.5	Low	137 Å²	137	108.3 Å²	108.3	72%	0.717	60%	0.596	S	S	*	*	H	α-helix	trans	-70.7	-29.3	173.3	-97.4	88.1	0	0	0	113.1	L12 L13 H18	L12-L16 VanDerWaalsContact O-CD1 3.25Å; L12-L16 WeakPolarHBondContact O-CD1 3.29Å; L12-L16 PolarHBondContact O-N 2.87Å; L13-L16 PolarHBondContact O-N 2.82Å; L16-H18 VanDerWaalsContact C-N 3.3Å
17	L	56.1	Low	63.1	Low	136 Å²	136	112.1 Å²	112.1	71%	0.712	61%	0.612	S	S	*	*	H	α-helix	trans	-76.5	-14.3	176.7	-79.5	156.8	0	0	0	113.4	L13 V14 Q19	L13-L17 WeakPolarHBondContact O-CD1 3.25Å; L13-L17 PolarHBondContact O-N 3.09Å; V14-L17 PolarHBondContact O-N 3.4Å; L17-Q19 PolarHBondContact O-N 2.73Å
18	H	54.5	Low	64.3	Low	147 Å²	147	111.7 Å²	111.7	68%	0.681	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	8	-173.4	-90.6	79.2	0	0	0	116	V14 G15 L16	V14-H18 PolarHBondContact O-N 3.49Å; V14-H18 PolarHBondContact O-ND1 2.84Å; G15-H18 PolarHBondContact O-N 3.18Å; L16-H18 VanDerWaalsContact C-N 3.3Å
19	Q	58.8	Low	65.6	Low	168 Å²	168	107.3 Å²	107.3	79%	0.785	58%	0.577	S	S	*	*			trans	-123.2	43.7	-173.9	-65.6	-172.1	10.5	0	0	115.2	L17	L17-Q19 PolarHBondContact O-N 2.73Å
20	T	53.6	Low	66.8	Low	115 Å²	115	104.8 Å²	104.8	71%	0.706	56%	0.563	S	S	*	*			trans	-127.5	52.1	168.7	59.4	0	0	0	0	112.6	M22	T20-M22 PolarHBondContact O-N 2.8Å
21	T	55.8	Low	68.3	Low	137 Å²	137	107.3 Å²	107.3	84%	0.84	57%	0.572	S	S	*	*			trans	-71.3	88.4	146.6	47.6	0	0	0	0	106.6	A23	T21-A23 PolarHBondContact O-N 3.02Å
22	M	54.5	Low	69.8	Low	158 Å²	158	105.6 Å²	105.6	78%	0.778	56%	0.556	S	S	*	*			trans	-65.8	88.7	165	-65.2	-66.7	-82.9	0	0	105.9	T20 V24	T20-M22 PolarHBondContact O-N 2.8Å; M22-V24 VanDerWaalsContact C-N 3.31Å; M22-V24 PolarHBondContact O-N 3.02Å
23	A	56.1	Low	71.3	Confident	69 Å²	69	101.6 Å²	101.6	57%	0.57	54%	0.535	S	S	*	.			trans	-55.9	105.5	163.4	0	0	0	0	0	105.4	T21 R25	T21-A23 PolarHBondContact O-N 3.02Å; A23-R25 PolarHBondContact O-N 3.46Å
24	V	61.7	Low	73	Confident	119 Å²	119	99.6 Å²	99.6	72%	0.721	52%	0.524	S	S	*	.			trans	-65.5	104.1	179	177	0	0	0	0	105.5	M22 M26	M22-V24 VanDerWaalsContact C-N 3.31Å; M22-V24 PolarHBondContact O-N 3.02Å; V24-M26 HydrophobicContact CG1-CG 4.45Å; V24-M26 PolarHBondContact O-N 3.26Å
25	R	68.3	Low	74.5	Confident	201 Å²	201	96 Å²	96	76%	0.758	50%	0.502	S	S	*	.			trans	-66.1	100.5	175.4	-172.3	178.8	-169.6	179.3	6	107.4	A23 D126	A23-R25 PolarHBondContact O-N 3.46Å; R25-D126 IonicContact NE-OD2 2.63Å; R25-D126 IonicContact NH2-OD2 3.06Å; R25-D126 PolarHBondContact NH2-OD2 3.14Å
26	M	77.7	Confident	76.1	Confident	60 Å²	60	94.9 Å²	94.9	30%	0.296	49%	0.49	S	S	.	.	P	Polyproline II helix	trans	-78.1	142.5	175.8	-57.9	-152.3	82.4	0	0	109.9	V24 D57 R59	V24-M26 HydrophobicContact CG1-CG 4.45Å; V24-M26 PolarHBondContact O-N 3.26Å; M26-D57 HydrophobicContact CE-CB 4.13Å; M26-R59 VanDerWaalsContact SD-CD 3.6Å; M26-R59 HydrophobicContact SD-CG 3.78Å
27	D	85.3	Confident	77.7	Confident	138 Å²	138	89.5 Å²	89.5	74%	0.738	46%	0.462	S	S	*	.	P	Polyproline II helix	trans	-63.9	147.2	175.6	-67.5	-38.6	0	0	0	111.2	L29 R59	D27-L29 PolarHBondContact O-N 2.94Å; D27-R59 PolarHBondContact O-NH1 2.94Å
28	K	90.8	Very high	79.4	Confident	85 Å²	85	86.3 Å²	86.3	37%	0.37	46%	0.455	S	S	.	.	P	Polyproline II helix	trans	-63.9	136.2	175.1	-64.4	-168.9	174.2	-172.3	0	110.1	A30 T124 D126 F129	K28-A30 VanDerWaalsContact C-N 3.31Å; K28-T124 PolarHBondContact NZ-O 2.87Å; K28-D126 WeakPolarHBondContact CE-OD1 3.22Å; K28-D126 IonicContact NZ-OD1 3.28Å; K28-F129 HydrophobicContact CB-CD2 3.97Å; K28-F129 HydrophobicContact CB-CE2 3.6Å; K28-F129 HydrophobicContact CB-CZ 4.28Å; K28-F129 HydrophobicContact CD-CE2 4.1Å; K28-F129 HydrophobicContact CG-CD2 3.77Å; K28-F129 HydrophobicContact CG-CE2 3.65Å
29	L	92.8	Very high	81.2	Confident	29 Å²	29	87 Å²	87	15%	0.152	46%	0.459	C	S	.	.	S	Bend	trans	-74.3	-27.2	172.1	-61.7	174.8	0	0	0	111.9	D27 F60 L75 Y103 F129	D27-L29 PolarHBondContact O-N 2.94Å; L29-F60 HydrophobicContact CD1-CE1 4.28Å; L29-F60 HydrophobicContact CD1-CZ 3.92Å; L29-F60 HydrophobicContact CD2-CZ 3.95Å; L29-L75 HydrophobicContact CB-CD1 3.55Å; L29-L75 HydrophobicContact CD1-CD1 4.27Å; L29-Y103 HydrophobicContact CD1-CD1 4.15Å; L29-Y103 HydrophobicContact CD1-CD2 3.66Å; L29-Y103 HydrophobicContact CD1-CE2 4.13Å; L29-Y103 HydrophobicContact CD1-CG 3.67Å; L29-F129 HydrophobicContact CB-CD1 4.16Å; L29-F129 HydrophobicContact CB-CE1 3.62Å; L29-F129 HydrophobicContact CB-CZ 4.24Å; L29-F129 HydrophobicContact CD1-CD1 4.06Å; L29-F129 HydrophobicContact CD1-CE1 4.08Å; L29-F129 HydrophobicContact CG-CD1 3.93Å; L29-F129 HydrophobicContact CG-CE1 3.91Å
30	A	95.3	Very high	82.8	Confident	4 Å²	4	80 Å²	80	3%	0.033	43%	0.428	C	S	.	.			trans	-162.2	155.2	175.4	0	0	0	0	0	110.4	K28 L75 I76 T124 F129	K28-A30 VanDerWaalsContact C-N 3.31Å; A30-L75 HydrophobicContact CB-CB 3.85Å; A30-L75 HydrophobicContact CB-CD1 3.97Å; A30-L75 HydrophobicContact CB-CD2 4.42Å; A30-L75 HydrophobicContact CB-CG 4.31Å; A30-I76 WeakPolarHBondContact CB-O 3.21Å; A30-T124 WeakPolarHBondContact O-CB 3.49Å; A30-T124 WeakPolarHBondContact O-CG2 3.46Å; A30-T124 PolarHBondContact O-OG1 2.94Å; A30-F129 WeakPolarHBondContact O-CZ 3.2Å
31	D	95.5	Very high	84.6	Confident	106 Å²	106	77.3 Å²	77.3	57%	0.567	41%	0.414	S	S	*	.	S	Bend	trans	-78	-23.1	173.4	-70.9	-38.8	0	0	0	113.2	Q123 T124	D31-Q123 CarbonylContact O-C 3.58Å; D31-Q123 WeakPolarHBondContact O-CA 3.48Å; D31-Q123 PolarHBondContact O-OE1 2.97Å; D31-T124 VanDerWaalsContact C-OG1 3.3Å; D31-T124 WeakPolarHBondContact CA-OG1 3.48Å; D31-T124 PolarHBondContact O-N 3.48Å; D31-T124 PolarHBondContact O-OG1 3.38Å
32	R	96.4	Very high	86.3	Confident	92 Å²	92	78.7 Å²	78.7	35%	0.347	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	149.6	-172	-55.1	-171.5	74.8	111.3	-3	112.3	I76 R121 K122	R32-I76 HydrophobicContact CB-CB 4.16Å; R32-I76 HydrophobicContact CB-CD1 3.63Å; R32-I76 HydrophobicContact CB-CG1 4.49Å; R32-I76 PolarHBondContact O-N 3.27Å; R32-R121 VanDerWaalsContact NE-CD 3.33Å; R32-K122 VanDerWaalsContact CA-O 3.31Å; R32-K122 WeakPolarHBondContact CA-O 3.26Å
33	K	96.8	Very high	88.2	Confident	21 Å²	21	72.9 Å²	72.9	9%	0.091	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	155.1	174.6	63.7	-178.3	179.7	-178.4	0	111.8	K74 L75 R121 K122 T124 D128	K33-K74 WeakPolarHBondContact CA-O 3.35Å; K33-L75 HydrophobicContact CB-CD2 3.83Å; K33-R121 WeakPolarHBondContact O-CA 3.46Å; K33-K122 PolarHBondContact N-O 3.34Å; K33-K122 PolarHBondContact O-N 3.43Å; K33-T124 HydrophobicContact CB-CG2 4.1Å; K33-T124 HydrophobicContact CD-CG2 4.23Å; K33-T124 HydrophobicContact CG-CG2 4.13Å; K33-D128 IonicContact NZ-OD1 3.06Å; K33-D128 PolarHBondContact NZ-OD1 2.76Å; K33-D128 IonicContact NZ-OD2 3.99Å; K33-D128 PolarHBondContact NZ-OD2 3.37Å
34	M	96.9	Very high	90	Very high	55 Å²	55	69.9 Å²	69.9	27%	0.271	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	130.6	169.8	-66.6	-176.6	-69.5	0	0	109.4	S73 K74 I76 V120	M34-S73 CarbonylContact O-C 3.56Å; M34-S73 WeakPolarHBondContact O-CA 3.39Å; M34-S73 VanDerWaalsContact O-CB 3.27Å; M34-S73 WeakPolarHBondContact O-CB 3.17Å; M34-K74 HydrophobicContact CE-CB 4.44Å; M34-K74 PolarHBondContact N-O 3.33Å; M34-K74 PolarHBondContact O-N 3.34Å; M34-I76 HydrophobicContact CE-CG1 4.05Å; M34-I76 HydrophobicContact CG-CD1 3.74Å; M34-I76 HydrophobicContact CG-CG1 3.99Å; M34-I76 HydrophobicContact SD-CD1 4.45Å; M34-I76 HydrophobicContact SD-CG1 4.35Å; M34-V120 WeakPolarHBondContact CA-O 3.48Å
35	C	96.8	Very high	91.7	Very high	0 Å²	0	64.2 Å²	64.2	0%	0	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	160.6	-178.4	-58	0	0	0	0	111.1	D37 C40 T119 V120	C35-D37 VanDerWaalsContact C-N 3.27Å; C35-D37 WeakPolarHBondContact CB-O 3.44Å; C35-C40 HydrophobicContact CB-CB 3.65Å; C35-C40 WeakPolarHBondContact CB-SG 3.31Å; C35-C40 WeakPolarHBondContact SG-CB 3.3Å; C35-C40 CovalentContact SG-SG 2.03Å; C35-C40 PolarHBondContact SG-SG 2.86Å; C35-T119 CarbonylContact O-C 3.44Å; C35-T119 VanDerWaalsContact O-CA 3.26Å; C35-T119 WeakPolarHBondContact O-CA 2.92Å; C35-V120 HydrophobicContact CB-CG2 4.22Å; C35-V120 PolarHBondContact N-O 2.97Å; C35-V120 PolarHBondContact O-N 2.8Å
36	G	94.4	Very high	93	Very high	15 Å²	15	56.5 Å²	56.5	16%	0.155	29%	0.291	C	S	.	.	S	Bend	trans	-75.6	-14.1	176	0	0	0	0	0	114.3
37	D	93.6	Very high	94	Very high	25 Å²	25	53.6 Å²	53.6	13%	0.134	28%	0.277	C	S	.	.	S	Bend	trans	-156.8	171	-176.9	68.5	-79.5	0	0	0	111.2	C35 E39 C40 S41 Y42 V120	C35-D37 VanDerWaalsContact C-N 3.27Å; C35-D37 WeakPolarHBondContact CB-O 3.44Å; D37-E39 VanDerWaalsContact C-N 3.28Å; D37-E39 PolarHBondContact O-N 2.83Å; D37-E39 WeakPolarHBondContact OD2-CA 3.25Å; D37-E39 WeakPolarHBondContact OD2-CB 3.48Å; D37-E39 PolarHBondContact OD2-N 3.2Å; D37-C40 PolarHBondContact O-N 2.99Å; D37-C40 PolarHBondContact OD2-N 3.5Å; D37-S41 PolarHBondContact OD1-N 2.88Å; D37-S41 PolarHBondContact OD2-N 2.83Å; D37-S41 PolarHBondContact OD2-OG 2.9Å; D37-Y42 HydrophobicContact CB-CD2 3.87Å; D37-Y42 PolarHBondContact OD1-N 2.94Å; D37-V120 VanDerWaalsContact C-CG2 3.44Å; D37-V120 WeakPolarHBondContact O-CG2 3.25Å
38	A	92.1	Very high	94.6	Very high	68 Å²	68	49.1 Å²	49.1	56%	0.562	26%	0.255	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.3	-26.6	-175.2	0	0	0	0	0	114.4	K122	A38-K122 WeakPolarHBondContact O-CD 3.43Å; A38-K122 WeakPolarHBondContact O-CE 3.39Å; A38-K122 PolarHBondContact O-NZ 2.81Å
39	E	91.8	Very high	95	Very high	162 Å²	162	45.2 Å²	45.2	76%	0.757	24%	0.238	S	C	*	.	T	Hydrogen-bonded Turn	trans	-95.1	-9.7	179.9	-59.9	-171.6	153.4	0	0	112.2	D37 S41	D37-E39 VanDerWaalsContact C-N 3.28Å; D37-E39 PolarHBondContact O-N 2.83Å; D37-E39 WeakPolarHBondContact OD2-CA 3.25Å; D37-E39 WeakPolarHBondContact OD2-CB 3.48Å; D37-E39 PolarHBondContact OD2-N 3.2Å; E39-S41 PolarHBondContact O-N 3.44Å
40	C	92.8	Very high	95.2	Very high	21 Å²	21	46.8 Å²	46.8	14%	0.142	25%	0.249	C	C	.	.	S	Bend	trans	57.7	33	-173	-52	0	0	0	0	112.5	C35 D37	C35-C40 HydrophobicContact CB-CB 3.65Å; C35-C40 WeakPolarHBondContact CB-SG 3.31Å; C35-C40 WeakPolarHBondContact SG-CB 3.3Å; C35-C40 CovalentContact SG-SG 2.03Å; C35-C40 PolarHBondContact SG-SG 2.86Å; D37-C40 PolarHBondContact O-N 2.99Å; D37-C40 PolarHBondContact OD2-N 3.5Å
41	S	90.9	Very high	95.4	Very high	59 Å²	59	51.1 Å²	51.1	41%	0.413	27%	0.272	S	S	.	.			trans	-93.8	-24.3	-175.6	61	0	0	0	0	112.7	D37 E39	D37-S41 PolarHBondContact OD1-N 2.88Å; D37-S41 PolarHBondContact OD2-N 2.83Å; D37-S41 PolarHBondContact OD2-OG 2.9Å; E39-S41 PolarHBondContact O-N 3.44Å
42	Y	91.8	Very high	95.5	Very high	165 Å²	165	49.5 Å²	49.5	65%	0.647	26%	0.263	S	S	*	.	S	Bend	trans	-92.8	147.7	-179.7	-66.3	-60.5	0	0	0	113	D37 L44	D37-Y42 HydrophobicContact CB-CD2 3.87Å; D37-Y42 PolarHBondContact OD1-N 2.94Å; Y42-L44 PolarHBondContact O-N 2.95Å
43	V	93.9	Very high	95.6	Very high	37 Å²	37	46.8 Å²	46.8	22%	0.224	25%	0.254	C	S	.	.			trans	-67.2	123.4	174.5	-176.4	0	0	0	0	109.2	S45 Y70 Y72 F115	V43-S45 WeakPolarHBondContact CG1-O 3.48Å; V43-Y70 HydrophobicContact CG1-CD1 3.9Å; V43-Y70 HydrophobicContact CG1-CG 4.27Å; V43-Y70 HydrophobicContact CG2-CG 4.37Å; V43-Y72 HydrophobicContact CB-CE1 4.46Å; V43-Y72 HydrophobicContact CG2-CD1 4.04Å; V43-Y72 HydrophobicContact CG2-CE1 3.45Å; V43-Y72 VanDerWaalsContact CG2-CE1 3.45Å; V43-F115 HydrophobicContact CB-CD2 4.27Å; V43-F115 HydrophobicContact CB-CE2 4.45Å; V43-F115 HydrophobicContact CG1-CD2 3.72Å; V43-F115 HydrophobicContact CG1-CE2 3.65Å
44	L	95.6	Very high	95.6	Very high	6 Å²	6	51.9 Å²	51.9	3%	0.031	28%	0.281	C	S	.	.			trans	-79.2	-43.3	177	-176.8	145	0	0	0	110.9	Y42 V71 K74 F115 T119	Y42-L44 PolarHBondContact O-N 2.95Å; L44-V71 WeakPolarHBondContact CB-O 3.24Å; L44-V71 PolarHBondContact N-O 2.99Å; L44-K74 HydrophobicContact CD2-CD 4.17Å; L44-F115 PolarHBondContact O-N 2.91Å; L44-T119 HydrophobicContact CD1-CG2 3.85Å
45	S	96.4	Very high	95.6	Very high	0 Å²	0	50.5 Å²	50.5	0%	0	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.2	170	-179.6	63.9	0	0	0	0	113.1	V43 V71 E111 R113	V43-S45 WeakPolarHBondContact CG1-O 3.48Å; S45-V71 PolarHBondContact N-O 3.02Å; S45-V71 PolarHBondContact O-N 2.9Å; S45-V71 WeakPolarHBondContact OG-CB 3.26Å; S45-E111 WeakPolarHBondContact CB-OE1 3.36Å; S45-E111 PolarHBondContact OG-OE1 3.25Å; S45-R113 CarbonylContact C-O 3.56Å; S45-R113 WeakPolarHBondContact CA-O 3.2Å; S45-R113 WeakPolarHBondContact CB-O 3Å
46	M	96.6	Very high	95.5	Very high	38 Å²	38	55 Å²	55	19%	0.187	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	141.8	169.3	-173	175	65.3	0	0	108.9	M68 V69 Y70 T112 R113 F115	M46-M68 HydrophobicContact SD-SD 4.22Å; M46-V69 WeakPolarHBondContact CA-O 3.5Å; M46-Y70 HydrophobicContact CB-CD1 4.36Å; M46-Y70 HydrophobicContact CG-CD1 4.27Å; M46-Y70 HydrophobicContact CG-CE1 4.26Å; M46-Y70 HydrophobicContact SD-CE1 4.06Å; M46-T112 PolarHBondContact O-N 2.81Å; M46-T112 PolarHBondContact O-OG1 3.01Å; M46-T112 VanDerWaalsContact O-OG1 3.12Å; M46-R113 HydrophobicContact CB-CB 4.34Å; M46-R113 HydrophobicContact CE-CB 4.25Å; M46-R113 PolarHBondContact N-O 3.32Å; M46-R113 PolarHBondContact O-N 3.48Å; M46-R113 VanDerWaalsContact O-N 3.12Å; M46-F115 HydrophobicContact CB-CE2 3.93Å; M46-F115 HydrophobicContact CB-CZ 4.12Å
47	A	97.9	Very high	95.5	Very high	0 Å²	0	56.3 Å²	56.3	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	157.2	178.1	0	0	0	0	0	111.1	M68 V69 V71 V109 K110	A47-M68 CarbonylContact O-C 3.46Å; A47-M68 WeakPolarHBondContact O-CA 3.42Å; A47-V69 PolarHBondContact N-O 2.93Å; A47-V69 PolarHBondContact O-N 2.85Å; A47-V71 HydrophobicContact CB-CG2 4.34Å; A47-V109 HydrophobicContact CB-CB 3.84Å; A47-V109 HydrophobicContact CB-CG2 3.88Å; A47-K110 CarbonylContact C-O 3.53Å; A47-K110 VanDerWaalsContact CA-O 3.25Å; A47-K110 WeakPolarHBondContact CA-O 3.19Å; A47-K110 WeakPolarHBondContact CB-O 3.46Å
48	T	98	Very high	95.4	Very high	44 Å²	44	57.7 Å²	57.7	27%	0.27	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	129.7	171.7	-59.2	0	0	0	0	109.1	V50 Q67 V109 K110 T112	T48-V50 PolarHBondContact O-N 3.03Å; T48-Q67 WeakPolarHBondContact CA-O 3.46Å; T48-V109 CarbonylContact O-C 3.59Å; T48-V109 WeakPolarHBondContact O-CA 3.46Å; T48-K110 PolarHBondContact N-O 2.01Å; T48-K110 PolarHBondContact O-N 3.46Å; T48-T112 WeakPolarHBondContact OG1-CG2 3.48Å
49	A	98	Very high	95.6	Very high	3 Å²	3	56.1 Å²	56.1	3%	0.025	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.5	125.8	176	0	0	0	0	0	111	I63 K64 G66 Q67 V108	A49-I63 HydrophobicContact CB-CG2 3.31Å; A49-K64 VanDerWaalsContact CB-O 3.25Å; A49-K64 WeakPolarHBondContact CB-O 3.49Å; A49-G66 PolarHBondContact O-N 2.67Å; A49-Q67 HydrophobicContact CB-CB 4.48Å; A49-Q67 WeakPolarHBondContact CB-O 3.43Å; A49-Q67 PolarHBondContact N-O 3.39Å; A49-V108 CarbonylContact C-O 3.57Å; A49-V108 WeakPolarHBondContact CA-O 3.44Å
50	V	98.6	Very high	95.8	Very high	62 Å²	62	48.9 Å²	48.9	38%	0.376	27%	0.267	S	S	.	.	S	Bend	trans	-100.2	-15.4	177.4	-65.6	0	0	0	0	112.4	T48 K65 V108 K110	T48-V50 PolarHBondContact O-N 3.03Å; V50-K65 WeakPolarHBondContact O-CD 3.15Å; V50-K65 VanDerWaalsContact O-CE 3.22Å; V50-K65 WeakPolarHBondContact O-CE 3.41Å; V50-V108 WeakPolarHBondContact CG2-O 3.46Å; V50-V108 PolarHBondContact N-O 3.3Å; V50-K110 HydrophobicContact CG1-CB 3.7Å
51	D	98.6	Very high	95.9	Very high	95 Å²	95	48.1 Å²	48.1	51%	0.508	26%	0.262	S	S	.	.	S	Bend	trans	-143.1	165.5	176.4	-152.9	-3.7	0	0	0	111.1	V108	D51-V108 HydrophobicContact CB-CB 4.43Å; D51-V108 HydrophobicContact CB-CG1 4.49Å; D51-V108 PolarHBondContact N-O 3.28Å
52	D	97.8	Very high	96.1	Very high	72 Å²	72	50.2 Å²	50.2	39%	0.385	27%	0.268	S	S	.	.			trans	-76.4	146.2	169.9	-80.1	9.4	0	0	0	110.3	I63 K64 K65	D52-I63 WeakPolarHBondContact CA-O 3.18Å; D52-K64 HydrophobicContact CB-CD 4.47Å; D52-K64 WeakPolarHBondContact OD1-CA 3.41Å; D52-K64 WeakPolarHBondContact OD1-CD 3.37Å; D52-K64 VanDerWaalsContact OD2-CD 3.31Å; D52-K64 WeakPolarHBondContact OD2-CD 3.37Å; D52-K64 IonicContact OD2-NZ 3.11Å; D52-K64 PolarHBondContact OD2-NZ 2.94Å; D52-K65 PolarHBondContact OD1-N 2.89Å
53	F	97.9	Very high	96.3	Very high	34 Å²	34	42.3 Å²	42.3	15%	0.149	24%	0.238	C	C	.	.	B	Isolated β-bridge	trans	-139	128.2	171.4	175.7	-113.8	0	0	0	109.9	F60 I61 N62 I63 F104 P105 V108	F53-F60 HydrophobicContact CE1-CB 3.97Å; F53-F60 AromaticContact CE1-CD1 3.95Å; F53-F60 HydrophobicContact CE1-CD1 3.95Å; F53-F60 HydrophobicContact CE1-CG 4.31Å; F53-F60 HydrophobicContact CZ-CB 4.25Å; F53-F60 AromaticContact CZ-CD1 3.76Å; F53-F60 HydrophobicContact CZ-CD1 3.76Å; F53-F60 HydrophobicContact CZ-CE1 4.49Å; F53-F60 HydrophobicContact CZ-CG 4.19Å; F53-I61 VanDerWaalsContact CD1-O 3.24Å; F53-I61 WeakPolarHBondContact CD1-O 3.43Å; F53-I61 WeakPolarHBondContact CE1-O 3.33Å; F53-N62 WeakPolarHBondContact O-CA 3.46Å; F53-I63 HydrophobicContact CB-CB 4.26Å; F53-I63 PolarHBondContact N-O 2.82Å; F53-I63 PolarHBondContact O-N 2.92Å; F53-F104 HydrophobicContact CD1-CB 4.01Å; F53-F104 HydrophobicContact CE1-CB 4.12Å; F53-P105 HydrophobicContact CD2-CG 3.95Å; F53-P105 HydrophobicContact CE2-CG 3.73Å; F53-P105 HydrophobicContact CZ-CG 4.14Å; F53-V108 HydrophobicContact CB-CB 4.43Å; F53-V108 HydrophobicContact CB-CG1 4.25Å; F53-V108 HydrophobicContact CB-CG2 4.02Å; F53-V108 HydrophobicContact CG-CG2 4.48Å
54	I	97.4	Very high	96.5	Very high	129 Å²	129	45.7 Å²	45.7	66%	0.662	25%	0.249	S	C	*	.			trans	-103.9	123.4	176.6	-60.4	173.6	0	0	0	107.5	P56 N62	I54-P56 WeakPolarHBondContact O-CD 3.36Å; I54-N62 WeakPolarHBondContact CA-OD1 3.26Å
55	A	96.5	Very high	96.6	Very high	26 Å²	26	52.2 Å²	52.2	22%	0.215	28%	0.277	C	S	.	.			trans	-61.7	119.6	-179.6	0	0	0	0	0	110.4	D57 F60 N62	A55-D57 VanDerWaalsContact C-N 3.33Å; A55-F60 HydrophobicContact CB-CB 3.68Å; A55-F60 WeakPolarHBondContact CB-O 3.46Å; A55-N62 PolarHBondContact N-OD1 2.98Å
56	P	94.6	Very high	96.6	Very high	95 Å²	95	54.8 Å²	54.8	62%	0.617	30%	0.303	S	S	*	.	S	Bend	trans	-74.3	-27.3	178.3	29.5	-35.7	0	0	0	112.5	I54 F60	I54-P56 WeakPolarHBondContact O-CD 3.36Å; P56-F60 HydrophobicContact CG-CD2 3.59Å; P56-F60 HydrophobicContact CG-CE2 3.82Å; P56-F60 HydrophobicContact CG-CG 4.06Å; P56-F60 HydrophobicContact CG-CZ 4.46Å
57	D	94	Very high	96.5	Very high	41 Å²	41	56.3 Å²	56.3	22%	0.219	31%	0.31	C	S	.	.	S	Bend	trans	-150	179	176.6	68.1	54.8	0	0	0	110.8	M26 A55 R59 F60	M26-D57 HydrophobicContact CE-CB 4.13Å; A55-D57 VanDerWaalsContact C-N 3.33Å; D57-R59 PolarHBondContact O-N 2.97Å; D57-R59 WeakPolarHBondContact OD1-CB 3.4Å; D57-R59 WeakPolarHBondContact OD1-CG 3.24Å; D57-R59 IonicContact OD1-CZ 2.68Å; D57-R59 PolarHBondContact OD1-N 3.16Å; D57-R59 IonicContact OD1-NE 3.96Å; D57-R59 PolarHBondContact OD1-NE 2.98Å; D57-R59 IonicContact OD1-NH2 3.96Å; D57-R59 IonicContact OD2-CZ 2.73Å; D57-R59 IonicContact OD2-NE 2.74Å; D57-R59 PolarHBondContact OD2-NE 3.31Å; D57-R59 IonicContact OD2-NH2 3.43Å; D57-R59 PolarHBondContact OD2-NH2 3.13Å; D57-F60 PolarHBondContact O-N 3.37Å; D57-F60 VanDerWaalsContact O-N 3.15Å; D57-F60 VanDerWaalsContact OD1-CD2 3.25Å; D57-F60 WeakPolarHBondContact OD1-CD2 3.39Å; D57-F60 WeakPolarHBondContact OD2-CE2 3.43Å
58	C	93	Very high	96.4	Very high	55 Å²	55	59.8 Å²	59.8	37%	0.372	33%	0.327	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.5	-21.9	-172.9	52.1	0	0	0	0	115	F60 R100 C131	C58-F60 PolarHBondContact O-N 3.15Å; C58-R100 PolarHBondContact O-NH2 3.23Å; C58-R100 VanDerWaalsContact O-NH2 3.13Å; C58-C131 VanDerWaalsContact C-SG 3.51Å; C58-C131 HydrophobicContact CB-CB 3.62Å; C58-C131 WeakPolarHBondContact CB-SG 3.25Å; C58-C131 WeakPolarHBondContact SG-CB 3.46Å; C58-C131 CovalentContact SG-SG 2.01Å; C58-C131 PolarHBondContact SG-SG 3.2Å
59	R	94.6	Very high	96.3	Very high	34 Å²	34	57.7 Å²	57.7	13%	0.128	31%	0.314	C	S	.	.	T	Hydrogen-bonded Turn	trans	-69.6	-22.6	178.1	-57.7	175.5	-67.2	177.5	-2.1	111.5	M26 D27 D57 G102 Y103 F129 C131	M26-R59 VanDerWaalsContact SD-CD 3.6Å; M26-R59 HydrophobicContact SD-CG 3.78Å; D27-R59 PolarHBondContact O-NH1 2.94Å; D57-R59 PolarHBondContact O-N 2.97Å; D57-R59 WeakPolarHBondContact OD1-CB 3.4Å; D57-R59 WeakPolarHBondContact OD1-CG 3.24Å; D57-R59 IonicContact OD1-CZ 2.68Å; D57-R59 PolarHBondContact OD1-N 3.16Å; D57-R59 IonicContact OD1-NE 3.96Å; D57-R59 PolarHBondContact OD1-NE 2.98Å; D57-R59 IonicContact OD1-NH2 3.96Å; D57-R59 IonicContact OD2-CZ 2.73Å; D57-R59 IonicContact OD2-NE 2.74Å; D57-R59 PolarHBondContact OD2-NE 3.31Å; D57-R59 IonicContact OD2-NH2 3.43Å; D57-R59 PolarHBondContact OD2-NH2 3.13Å; R59-G102 CarbonylContact O-C 3.56Å; R59-G102 VanDerWaalsContact O-CA 3.29Å; R59-G102 WeakPolarHBondContact O-CA 3.49Å; R59-Y103 HydrophobicContact CB-CD2 4.17Å; R59-Y103 WeakPolarHBondContact O-CD2 3.24Å; R59-Y103 PolarHBondContact O-N 3.03Å; R59-F129 WeakPolarHBondContact CG-O 3.37Å; R59-C131 PolarHBondContact N-SG 3.39Å
60	F	96.1	Very high	96.2	Very high	10 Å²	10	60.5 Å²	60.5	4%	0.044	33%	0.325	C	S	.	.	B	Isolated β-bridge	trans	-99.9	157.6	-175.3	-62.7	-89.5	0	0	0	111.8	L29 F53 A55 P56 D57 C58 F84 Y103	L29-F60 HydrophobicContact CD1-CE1 4.28Å; L29-F60 HydrophobicContact CD1-CZ 3.92Å; L29-F60 HydrophobicContact CD2-CZ 3.95Å; F53-F60 HydrophobicContact CE1-CB 3.97Å; F53-F60 AromaticContact CE1-CD1 3.95Å; F53-F60 HydrophobicContact CE1-CD1 3.95Å; F53-F60 HydrophobicContact CE1-CG 4.31Å; F53-F60 HydrophobicContact CZ-CB 4.25Å; F53-F60 AromaticContact CZ-CD1 3.76Å; F53-F60 HydrophobicContact CZ-CD1 3.76Å; F53-F60 HydrophobicContact CZ-CE1 4.49Å; F53-F60 HydrophobicContact CZ-CG 4.19Å; A55-F60 HydrophobicContact CB-CB 3.68Å; A55-F60 WeakPolarHBondContact CB-O 3.46Å; P56-F60 HydrophobicContact CG-CD2 3.59Å; P56-F60 HydrophobicContact CG-CE2 3.82Å; P56-F60 HydrophobicContact CG-CG 4.06Å; P56-F60 HydrophobicContact CG-CZ 4.46Å; D57-F60 PolarHBondContact O-N 3.37Å; D57-F60 VanDerWaalsContact O-N 3.15Å; D57-F60 VanDerWaalsContact OD1-CD2 3.25Å; D57-F60 WeakPolarHBondContact OD1-CD2 3.39Å; D57-F60 WeakPolarHBondContact OD2-CE2 3.43Å; C58-F60 PolarHBondContact O-N 3.15Å; F60-F84 AromaticContact CE1-CD1 3.7Å; F60-F84 HydrophobicContact CE1-CD1 3.7Å; F60-F84 AromaticContact CE1-CE1 3.57Å; F60-F84 HydrophobicContact CE1-CE1 3.57Å; F60-F84 HydrophobicContact CE1-CZ 4.32Å; F60-F84 HydrophobicContact CZ-CE1 4.2Å; F60-Y103 VanDerWaalsContact CA-O 3.24Å; F60-Y103 WeakPolarHBondContact CA-O 3.4Å; F60-Y103 WeakPolarHBondContact CB-O 3.48Å; F60-Y103 VanDerWaalsContact CD1-O 3.32Å; F60-Y103 WeakPolarHBondContact CD1-O 3.04Å
61	I	96	Very high	96.1	Very high	5 Å²	5	57.6 Å²	57.6	3%	0.026	31%	0.307	C	S	.	.			trans	-111.7	145.1	172.2	50.9	174.7	0	0	0	111.2	F53 I63 V89 R100 T101 Y103 F104	F53-I61 VanDerWaalsContact CD1-O 3.24Å; F53-I61 WeakPolarHBondContact CD1-O 3.43Å; F53-I61 WeakPolarHBondContact CE1-O 3.33Å; I61-I63 HydrophobicContact CD1-CD1 4.49Å; I61-I63 HydrophobicContact CD1-CG1 4.47Å; I61-I63 HydrophobicContact CG1-CD1 4.47Å; I61-I63 HydrophobicContact CG1-CG1 4.33Å; I61-V89 HydrophobicContact CD1-CG2 4.26Å; I61-R100 HydrophobicContact CG2-CB 4.44Å; I61-R100 HydrophobicContact CG2-CG 4.02Å; I61-R100 WeakPolarHBondContact CG2-O 3.27Å; I61-T101 VanDerWaalsContact CG2-O 3.26Å; I61-T101 WeakPolarHBondContact CG2-O 3.26Å; I61-Y103 PolarHBondContact N-O 3.22Å; I61-Y103 VanDerWaalsContact N-O 3.13Å; I61-F104 HydrophobicContact CD1-CD1 3.96Å; I61-F104 HydrophobicContact CD1-CE1 4.38Å; I61-F104 HydrophobicContact CG1-CD1 4.11Å
62	N	95.5	Very high	96	Very high	103 Å²	103	54.2 Å²	54.2	55%	0.551	29%	0.287	S	S	*	.			trans	-70.6	134.5	169.2	-67	-50	0	0	0	109.4	F53 I54 A55	F53-N62 WeakPolarHBondContact O-CA 3.46Å; I54-N62 WeakPolarHBondContact CA-OD1 3.26Å; A55-N62 PolarHBondContact N-OD1 2.98Å
63	I	96.3	Very high	96	Very high	0 Å²	0	51 Å²	51	0%	0	27%	0.27	C	S	.	.	B	Isolated β-bridge	trans	-126.4	138.4	175.2	-64.7	177	0	0	0	108.3	A49 D52 F53 I61 V69 V89 F104 V108 V109	A49-I63 HydrophobicContact CB-CG2 3.31Å; D52-I63 WeakPolarHBondContact CA-O 3.18Å; F53-I63 HydrophobicContact CB-CB 4.26Å; F53-I63 PolarHBondContact N-O 2.82Å; F53-I63 PolarHBondContact O-N 2.92Å; I61-I63 HydrophobicContact CD1-CD1 4.49Å; I61-I63 HydrophobicContact CD1-CG1 4.47Å; I61-I63 HydrophobicContact CG1-CD1 4.47Å; I61-I63 HydrophobicContact CG1-CG1 4.33Å; I63-V69 HydrophobicContact CD1-CG2 4.19Å; I63-V89 HydrophobicContact CG1-CG2 4.16Å; I63-F104 HydrophobicContact CD1-CB 3.49Å; I63-F104 VanDerWaalsContact CD1-CB 3.49Å; I63-F104 HydrophobicContact CD1-CD1 3.77Å; I63-F104 HydrophobicContact CD1-CD2 3.81Å; I63-F104 HydrophobicContact CD1-CE1 4.46Å; I63-F104 HydrophobicContact CD1-CG 3.39Å; I63-V108 HydrophobicContact CD1-CG2 4.5Å; I63-V109 HydrophobicContact CD1-CG1 4.46Å
64	K	96.8	Very high	96	Very high	107 Å²	107	50.9 Å²	50.9	47%	0.465	27%	0.27	S	S	.	.			trans	-109.7	140.7	169.9	-68.3	-56.4	-165.4	-179	0	110.4	A49 D52 G66 Q67	A49-K64 VanDerWaalsContact CB-O 3.25Å; A49-K64 WeakPolarHBondContact CB-O 3.49Å; D52-K64 HydrophobicContact CB-CD 4.47Å; D52-K64 WeakPolarHBondContact OD1-CA 3.41Å; D52-K64 WeakPolarHBondContact OD1-CD 3.37Å; D52-K64 VanDerWaalsContact OD2-CD 3.31Å; D52-K64 WeakPolarHBondContact OD2-CD 3.37Å; D52-K64 IonicContact OD2-NZ 3.11Å; D52-K64 PolarHBondContact OD2-NZ 2.94Å; K64-G66 PolarHBondContact O-N 2.99Å; K64-Q67 HydrophobicContact CB-CG 4.12Å; K64-Q67 VanDerWaalsContact O-CB 3.24Å; K64-Q67 WeakPolarHBondContact O-CB 3.08Å; K64-Q67 VanDerWaalsContact O-CG 3.3Å; K64-Q67 WeakPolarHBondContact O-CG 2.99Å; K64-Q67 PolarHBondContact O-N 2.83Å
65	K	97.9	Very high	96	Very high	144 Å²	144	45 Å²	45	63%	0.626	24%	0.24	S	C	*	.	T	Hydrogen-bonded Turn	trans	-49.6	134.3	175.2	-177.6	171.5	-176.1	166.2	0	110.8	V50 D52 Q67	V50-K65 WeakPolarHBondContact O-CD 3.15Å; V50-K65 VanDerWaalsContact O-CE 3.22Å; V50-K65 WeakPolarHBondContact O-CE 3.41Å; D52-K65 PolarHBondContact OD1-N 2.89Å; K65-Q67 VanDerWaalsContact C-N 3.33Å
66	G	96.3	Very high	96	Very high	53 Å²	53	45.4 Å²	45.4	55%	0.546	24%	0.238	S	C	.	.	T	Hydrogen-bonded Turn	trans	86.9	-12.4	-177.4	0	0	0	0	0	115	A49 K64	A49-G66 PolarHBondContact O-N 2.67Å; K64-G66 PolarHBondContact O-N 2.99Å
67	Q	95.3	Very high	95.8	Very high	71 Å²	71	43 Å²	43	33%	0.332	22%	0.222	S	C	.	.			trans	-67	144.7	174.1	-70.4	-175.8	-46.9	0	0	111.5	T48 A49 K64 K65 V89	T48-Q67 WeakPolarHBondContact CA-O 3.46Å; A49-Q67 HydrophobicContact CB-CB 4.48Å; A49-Q67 WeakPolarHBondContact CB-O 3.43Å; A49-Q67 PolarHBondContact N-O 3.39Å; K64-Q67 HydrophobicContact CB-CG 4.12Å; K64-Q67 VanDerWaalsContact O-CB 3.24Å; K64-Q67 WeakPolarHBondContact O-CB 3.08Å; K64-Q67 VanDerWaalsContact O-CG 3.3Å; K64-Q67 WeakPolarHBondContact O-CG 2.99Å; K64-Q67 PolarHBondContact O-N 2.83Å; K65-Q67 VanDerWaalsContact C-N 3.33Å; Q67-V89 HydrophobicContact CB-CG1 4.09Å; Q67-V89 HydrophobicContact CG-CG1 4.26Å
68	M	95.4	Very high	95.4	Very high	72 Å²	72	44.3 Å²	44.3	36%	0.355	23%	0.233	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	144	169	-65.4	-173	-65.4	0	0	109.8	M46 A47 Y90	M46-M68 HydrophobicContact SD-SD 4.22Å; A47-M68 CarbonylContact O-C 3.46Å; A47-M68 WeakPolarHBondContact O-CA 3.42Å; M68-Y90 HydrophobicContact CB-CG 4.45Å; M68-Y90 HydrophobicContact CE-CD1 3.6Å; M68-Y90 HydrophobicContact CE-CE1 3.86Å; M68-Y90 HydrophobicContact CE-CG 4.04Å; M68-Y90 WeakPolarHBondContact O-CB 2.91Å; M68-Y90 PolarHBondContact O-N 2.78Å
69	V	96.1	Very high	94.9	Very high	0 Å²	0	50.1 Å²	50.1	0%	0	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	129.4	-178.3	-173.6	0	0	0	0	108.7	M46 A47 I63 S88 F104 V109	M46-V69 WeakPolarHBondContact CA-O 3.5Å; A47-V69 PolarHBondContact N-O 2.93Å; A47-V69 PolarHBondContact O-N 2.85Å; I63-V69 HydrophobicContact CD1-CG2 4.19Å; V69-S88 WeakPolarHBondContact CA-O 3.32Å; V69-F104 HydrophobicContact CG1-CE1 3.63Å; V69-F104 HydrophobicContact CG1-CE2 4.45Å; V69-F104 HydrophobicContact CG1-CZ 3.59Å; V69-V109 HydrophobicContact CG2-CG1 4.39Å
70	Y	95.9	Very high	94	Very high	63 Å²	63	52.9 Å²	52.9	25%	0.247	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	131.1	167	-68.3	-54.4	0	0	0	109.4	V43 M46 G87 S88 Y90	V43-Y70 HydrophobicContact CG1-CD1 3.9Å; V43-Y70 HydrophobicContact CG1-CG 4.27Å; V43-Y70 HydrophobicContact CG2-CG 4.37Å; M46-Y70 HydrophobicContact CB-CD1 4.36Å; M46-Y70 HydrophobicContact CG-CD1 4.27Å; M46-Y70 HydrophobicContact CG-CE1 4.26Å; M46-Y70 HydrophobicContact SD-CE1 4.06Å; Y70-G87 CarbonylContact O-C 3.55Å; Y70-G87 WeakPolarHBondContact O-CA 3.29Å; Y70-S88 PolarHBondContact N-O 2.03Å; Y70-S88 PolarHBondContact O-N 3.23Å; Y70-Y90 AromaticContact CE2-CD2 3.63Å; Y70-Y90 HydrophobicContact CE2-CD2 3.63Å; Y70-Y90 HydrophobicContact CE2-CE2 4.31Å; Y70-Y90 AromaticContact CZ-CD2 3.89Å
71	V	97.1	Very high	93.4	Very high	0 Å²	0	54.5 Å²	54.5	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	120.4	-178.5	-174.6	0	0	0	0	108.6	L44 S45 A47 K74 W85 F104	L44-V71 WeakPolarHBondContact CB-O 3.24Å; L44-V71 PolarHBondContact N-O 2.99Å; S45-V71 PolarHBondContact N-O 3.02Å; S45-V71 PolarHBondContact O-N 2.9Å; S45-V71 WeakPolarHBondContact OG-CB 3.26Å; A47-V71 HydrophobicContact CB-CG2 4.34Å; V71-K74 HydrophobicContact CG1-CG 4.17Å; V71-W85 HydrophobicContact CG1-CB 4.12Å; V71-W85 HydrophobicContact CG1-CD2 4.37Å; V71-W85 HydrophobicContact CG1-CE3 4.1Å; V71-W85 HydrophobicContact CG1-CG 4.41Å; V71-W85 HydrophobicContact CG2-CE3 3.92Å; V71-W85 HydrophobicContact CG2-CZ3 4.37Å; V71-F104 HydrophobicContact CG2-CZ 4.26Å
72	Y	96.1	Very high	92.9	Very high	24 Å²	24	56.2 Å²	56.2	9%	0.094	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	-35.7	178.5	-64.1	-87.6	0	0	0	112.1	V43 Y86 M98	V43-Y72 HydrophobicContact CB-CE1 4.46Å; V43-Y72 HydrophobicContact CG2-CD1 4.04Å; V43-Y72 HydrophobicContact CG2-CE1 3.45Å; V43-Y72 VanDerWaalsContact CG2-CE1 3.45Å; Y72-Y86 PolarHBondContact N-O 2.74Å; Y72-M98 VanDerWaalsContact OH-CE 3.32Å; Y72-M98 WeakPolarHBondContact OH-CE 3.31Å; Y72-M98 PolarHBondContact OH-SD 3.32Å
73	S	97.3	Very high	92.9	Very high	4 Å²	4	54.6 Å²	54.6	3%	0.028	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.1	155.6	176.4	72.2	0	0	0	0	112.7	M34 W85 Y86	M34-S73 CarbonylContact O-C 3.56Å; M34-S73 WeakPolarHBondContact O-CA 3.39Å; M34-S73 VanDerWaalsContact O-CB 3.27Å; M34-S73 WeakPolarHBondContact O-CB 3.17Å; S73-W85 WeakPolarHBondContact O-CA 3.37Å; S73-Y86 PolarHBondContact N-O 2.78Å; S73-Y86 PolarHBondContact O-N 3.26Å; S73-Y86 WeakPolarHBondContact OG-CB 3.16Å
74	K	97.4	Very high	92.9	Very high	33 Å²	33	56.8 Å²	56.8	14%	0.143	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	119.8	176.6	-59.5	-178.2	173.3	172.2	0	108	K33 M34 L44 V71 W85 E111	K33-K74 WeakPolarHBondContact CA-O 3.35Å; M34-K74 HydrophobicContact CE-CB 4.44Å; M34-K74 PolarHBondContact N-O 3.33Å; M34-K74 PolarHBondContact O-N 3.34Å; L44-K74 HydrophobicContact CD2-CD 4.17Å; V71-K74 HydrophobicContact CG1-CG 4.17Å; K74-W85 HydrophobicContact CB-CG 4.3Å; K74-W85 HydrophobicContact CD-CD2 4.28Å; K74-W85 HydrophobicContact CD-CZ2 4.01Å; K74-W85 HydrophobicContact CG-CD2 4.01Å; K74-W85 HydrophobicContact CG-CG 3.86Å; K74-E111 VanDerWaalsContact CE-OE1 3.31Å; K74-E111 WeakPolarHBondContact CE-OE1 3.35Å; K74-E111 VanDerWaalsContact NZ-CD 3.3Å; K74-E111 IonicContact NZ-OE1 3.25Å; K74-E111 PolarHBondContact NZ-OE1 2.9Å; K74-E111 IonicContact NZ-OE2 3.84Å; K74-E111 PolarHBondContact NZ-OE2 2.87Å; K74-E111 VanDerWaalsContact NZ-OE2 3.11Å
75	L	97.5	Very high	93	Very high	5 Å²	5	53.2 Å²	53.2	3%	0.026	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.5	144.8	174.9	-61.4	-170.9	0	0	0	109.8	L29 A30 K33 P77 F84 Y103 T124 F129	L29-L75 HydrophobicContact CB-CD1 3.55Å; L29-L75 HydrophobicContact CD1-CD1 4.27Å; A30-L75 HydrophobicContact CB-CB 3.85Å; A30-L75 HydrophobicContact CB-CD1 3.97Å; A30-L75 HydrophobicContact CB-CD2 4.42Å; A30-L75 HydrophobicContact CB-CG 4.31Å; K33-L75 HydrophobicContact CB-CD2 3.83Å; L75-P77 WeakPolarHBondContact O-CD 3.32Å; L75-F84 VanDerWaalsContact CB-O 3.25Å; L75-F84 WeakPolarHBondContact CB-O 3.25Å; L75-F84 HydrophobicContact CD1-CB 4.09Å; L75-F84 PolarHBondContact N-O 3.49Å; L75-Y103 HydrophobicContact CD1-CD1 3.98Å; L75-Y103 HydrophobicContact CD1-CE1 3.67Å; L75-Y103 HydrophobicContact CD2-CE1 3.9Å; L75-Y103 HydrophobicContact CG-CD1 4.26Å; L75-Y103 HydrophobicContact CG-CE1 3.81Å; L75-T124 HydrophobicContact CD2-CG2 4.14Å; L75-F129 HydrophobicContact CD1-CE1 3.97Å; L75-F129 HydrophobicContact CD1-CZ 4.4Å
76	I	95.9	Very high	93	Very high	34 Å²	34	49.6 Å²	49.6	17%	0.174	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	106.3	171.1	-63.2	148.4	0	0	0	105.9	A30 R32 M34 R121	A30-I76 WeakPolarHBondContact CB-O 3.21Å; R32-I76 HydrophobicContact CB-CB 4.16Å; R32-I76 HydrophobicContact CB-CD1 3.63Å; R32-I76 HydrophobicContact CB-CG1 4.49Å; R32-I76 PolarHBondContact O-N 3.27Å; M34-I76 HydrophobicContact CE-CG1 4.05Å; M34-I76 HydrophobicContact CG-CD1 3.74Å; M34-I76 HydrophobicContact CG-CG1 3.99Å; M34-I76 HydrophobicContact SD-CD1 4.45Å; M34-I76 HydrophobicContact SD-CG1 4.35Å; I76-R121 HydrophobicContact CD1-CG 3.74Å; I76-R121 VanDerWaalsContact CD1-NH1 3.34Å
77	P	91.2	Very high	93	Very high	45 Å²	45	47 Å²	47	29%	0.292	28%	0.278	S	S	.	.	P	Polyproline II helix	trans	-65.6	147.1	-175.1	30.6	-37.6	0	0	0	110.5	L75 A81 V83	L75-P77 WeakPolarHBondContact O-CD 3.32Å; P77-A81 HydrophobicContact CB-CB 4.15Å; P77-V83 HydrophobicContact CG-CG2 4.12Å
78	P	85	Confident	92.9	Very high	68 Å²	68	43.7 Å²	43.7	44%	0.442	26%	0.262	S	S	.	.	P	Polyproline II helix	trans	-62	158.7	158.4	24.9	-28.3	0	0	0	110.1	G80 A81	P78-G80 PolarHBondContact O-N 2.89Å; P78-A81 HydrophobicContact CG-CB 3.66Å; P78-A81 WeakPolarHBondContact O-CB 3.49Å; P78-A81 PolarHBondContact O-N 3.04Å
79	D	83.2	Confident	92.9	Very high	177 Å²	177	41.4 Å²	41.4	95%	0.947	25%	0.252	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	125.3	-175.7	-66.9	-31.4	0	0	0	111.5	A81	D79-A81 VanDerWaalsContact C-N 3.32Å; D79-A81 PolarHBondContact O-N 2.83Å
80	G	76.2	Confident	92.5	Very high	92 Å²	92	45 Å²	45	95%	0.948	27%	0.266	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.7	-1.8	-179.6	0	0	0	0	0	116.1	P78	P78-G80 PolarHBondContact O-N 2.89Å
81	A	83.8	Confident	91.7	Very high	44 Å²	44	43.9 Å²	43.9	36%	0.364	27%	0.267	S	S	.	.			trans	-85.7	160.1	176	0	0	0	0	0	113.3	P77 P78 D79	P77-A81 HydrophobicContact CB-CB 4.15Å; P78-A81 HydrophobicContact CG-CB 3.66Å; P78-A81 WeakPolarHBondContact O-CB 3.49Å; P78-A81 PolarHBondContact O-N 3.04Å; D79-A81 VanDerWaalsContact C-N 3.32Å; D79-A81 PolarHBondContact O-N 2.83Å
82	G	85.3	Confident	90.2	Very high	42 Å²	42	52.2 Å²	52.2	43%	0.433	31%	0.307	S	S	.	.			trans	-63.9	144.3	176.6	0	0	0	0	0	112.8	F84	G82-F84 VanDerWaalsContact O-CD2 3.26Å; G82-F84 WeakPolarHBondContact O-CD2 3.24Å; G82-F84 PolarHBondContact O-N 3.24Å
83	V	94.7	Very high	88.5	Confident	69 Å²	69	60.9 Å²	60.9	42%	0.418	34%	0.339	S	S	.	.			trans	-84.5	113.4	175.2	-175	0	0	0	0	109	P77 A106	P77-V83 HydrophobicContact CG-CG2 4.12Å; V83-A106 HydrophobicContact CB-CB 4.1Å; V83-A106 HydrophobicContact CG1-CB 3.73Å; V83-A106 PolarHBondContact O-N 3.43Å
84	F	97.6	Very high	86.5	Confident	46 Å²	46	68.2 Å²	68.2	20%	0.202	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	140	178.8	-64.1	-78.7	0	0	0	111.9	F60 L75 G82 Y103 F104 P105	F60-F84 AromaticContact CE1-CD1 3.7Å; F60-F84 HydrophobicContact CE1-CD1 3.7Å; F60-F84 AromaticContact CE1-CE1 3.57Å; F60-F84 HydrophobicContact CE1-CE1 3.57Å; F60-F84 HydrophobicContact CE1-CZ 4.32Å; F60-F84 HydrophobicContact CZ-CE1 4.2Å; L75-F84 VanDerWaalsContact CB-O 3.25Å; L75-F84 WeakPolarHBondContact CB-O 3.25Å; L75-F84 HydrophobicContact CD1-CB 4.09Å; L75-F84 PolarHBondContact N-O 3.49Å; G82-F84 VanDerWaalsContact O-CD2 3.26Å; G82-F84 WeakPolarHBondContact O-CD2 3.24Å; G82-F84 PolarHBondContact O-N 3.24Å; F84-Y103 HydrophobicContact CB-CD1 4.48Å; F84-F104 WeakPolarHBondContact CA-O 3.32Å; F84-P105 HydrophobicContact CD1-CG 4.4Å; F84-P105 HydrophobicContact CE1-CB 4.49Å; F84-P105 HydrophobicContact CE1-CG 4.05Å
85	W	97.9	Very high	84.4	Confident	32 Å²	32	72.2 Å²	72.2	12%	0.121	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	154.9	173.3	-62.2	-7.7	0	0	0	109.9	V71 S73 K74 Y103 F104 A106 V109 E111	V71-W85 HydrophobicContact CG1-CB 4.12Å; V71-W85 HydrophobicContact CG1-CD2 4.37Å; V71-W85 HydrophobicContact CG1-CE3 4.1Å; V71-W85 HydrophobicContact CG1-CG 4.41Å; V71-W85 HydrophobicContact CG2-CE3 3.92Å; V71-W85 HydrophobicContact CG2-CZ3 4.37Å; S73-W85 WeakPolarHBondContact O-CA 3.37Å; K74-W85 HydrophobicContact CB-CG 4.3Å; K74-W85 HydrophobicContact CD-CD2 4.28Å; K74-W85 HydrophobicContact CD-CZ2 4.01Å; K74-W85 HydrophobicContact CG-CD2 4.01Å; K74-W85 HydrophobicContact CG-CG 3.86Å; W85-Y103 CarbonylContact O-C 3.55Å; W85-Y103 WeakPolarHBondContact O-CA 3.47Å; W85-F104 HydrophobicContact CB-CE2 3.94Å; W85-F104 HydrophobicContact CB-CZ 3.89Å; W85-F104 HydrophobicContact CE3-CE2 4.16Å; W85-F104 PolarHBondContact N-O 3.13Å; W85-F104 PolarHBondContact O-N 2.63Å; W85-A106 HydrophobicContact CD2-CB 3.85Å; W85-A106 VanDerWaalsContact CE2-CB 3.44Å; W85-A106 HydrophobicContact CG-CB 4.18Å; W85-A106 HydrophobicContact CH2-CB 4.44Å; W85-A106 HydrophobicContact CZ2-CB 3.77Å; W85-V109 HydrophobicContact CE3-CG2 3.9Å; W85-V109 HydrophobicContact CZ3-CG2 3.7Å; W85-E111 HydrophobicContact CH2-CB 4.35Å; W85-E111 HydrophobicContact CZ3-CB 4.5Å
86	Y	97.4	Very high	82.3	Confident	67 Å²	67	79 Å²	79	26%	0.263	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	129.2	177	-177.8	-101.1	0	0	0	109.9	Y72 S73 T101 Y103	Y72-Y86 PolarHBondContact N-O 2.74Å; S73-Y86 PolarHBondContact N-O 2.78Å; S73-Y86 PolarHBondContact O-N 3.26Å; S73-Y86 WeakPolarHBondContact OG-CB 3.16Å; Y86-T101 VanDerWaalsContact OH-CB 3.24Å; Y86-T101 WeakPolarHBondContact OH-CB 3.45Å; Y86-T101 PolarHBondContact OH-OG1 3.06Å; Y86-Y103 HydrophobicContact CD2-CD1 4.2Å; Y86-Y103 HydrophobicContact CD2-CD2 4.27Å; Y86-Y103 AromaticContact CD2-CE1 3.98Å; Y86-Y103 HydrophobicContact CD2-CE1 3.98Å; Y86-Y103 HydrophobicContact CD2-CE2 4.04Å; Y86-Y103 HydrophobicContact CD2-CG 4.34Å; Y86-Y103 AromaticContact CD2-CZ 3.89Å; Y86-Y103 HydrophobicContact CG-CE1 4.26Å
87	G	96	Very high	80.2	Confident	0 Å²	0	83.2 Å²	83.2	0%	0	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.8	-175.1	-172.6	0	0	0	0	0	114.5	Y70 T101 G102	Y70-G87 CarbonylContact O-C 3.55Å; Y70-G87 WeakPolarHBondContact O-CA 3.29Å; G87-T101 CarbonylContact O-C 3.58Å; G87-T101 WeakPolarHBondContact O-CA 3.47Å; G87-G102 PolarHBondContact N-O 3.28Å; G87-G102 PolarHBondContact O-N 3.49Å
88	S	94.8	Very high	78.9	Confident	1 Å²	1	86.7 Å²	86.7	1%	0.007	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	138.1	173.3	58.4	0	0	0	0	110.2	V69 Y70	V69-S88 WeakPolarHBondContact CA-O 3.32Å; Y70-S88 PolarHBondContact N-O 2.03Å; Y70-S88 PolarHBondContact O-N 3.23Å
89	V	93.9	Very high	78.4	Confident	23 Å²	23	84.5 Å²	84.5	14%	0.139	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.5	133.5	169.6	177.8	0	0	0	0	109.5	I61 I63 Q67 S91	I61-V89 HydrophobicContact CD1-CG2 4.26Å; I63-V89 HydrophobicContact CG1-CG2 4.16Å; Q67-V89 HydrophobicContact CB-CG1 4.09Å; Q67-V89 HydrophobicContact CG-CG1 4.26Å; V89-S91 PolarHBondContact O-N 2.93Å
90	Y	87.8	Confident	78.5	Confident	75 Å²	75	84.3 Å²	84.3	29%	0.294	44%	0.439	S	S	.	.	P	Polyproline II helix	trans	-63.8	125.2	174.6	-179.8	-99.8	0	0	0	110.7	M68 Y70 Q92	M68-Y90 HydrophobicContact CB-CG 4.45Å; M68-Y90 HydrophobicContact CE-CD1 3.6Å; M68-Y90 HydrophobicContact CE-CE1 3.86Å; M68-Y90 HydrophobicContact CE-CG 4.04Å; M68-Y90 WeakPolarHBondContact O-CB 2.91Å; M68-Y90 PolarHBondContact O-N 2.78Å; Y70-Y90 AromaticContact CE2-CD2 3.63Å; Y70-Y90 HydrophobicContact CE2-CD2 3.63Å; Y70-Y90 HydrophobicContact CE2-CE2 4.31Å; Y70-Y90 AromaticContact CZ-CD2 3.89Å; Y90-Q92 HydrophobicContact CD1-CG 4.41Å; Y90-Q92 HydrophobicContact CE1-CG 3.86Å
91	S	79.1	Confident	79.3	Confident	40 Å²	40	82.7 Å²	82.7	28%	0.28	41%	0.411	S	S	.	.	P	Polyproline II helix	trans	-101.7	132.6	172.6	179.2	0	0	0	0	110.3	V89 R93	V89-S91 PolarHBondContact O-N 2.93Å; S91-R93 PolarHBondContact OG-N 2.86Å; S91-R93 VanDerWaalsContact OG-N 3.16Å; S91-R93 PolarHBondContact OG-O 3.14Å
92	Q	67.1	Low	79.9	Confident	176 Å²	176	80.7 Å²	80.7	82%	0.822	40%	0.395	S	S	*	.	S	Bend	trans	-80.5	-21.8	169.2	-70.8	-178.5	-3.4	0	0	112.5	Y90 Y94	Y90-Q92 HydrophobicContact CD1-CG 4.41Å; Y90-Q92 HydrophobicContact CE1-CG 3.86Å; Q92-Y94 PolarHBondContact O-N 2.63Å
93	R	59.3	Low	80.5	Confident	205 Å²	205	78.9 Å²	78.9	77%	0.774	38%	0.375	S	S	*	.	S	Bend	trans	-84.2	105.5	174.8	-71.1	-169.8	-153.5	-156.1	5.6	107.5	S91	S91-R93 PolarHBondContact OG-N 2.86Å; S91-R93 VanDerWaalsContact OG-N 3.16Å; S91-R93 PolarHBondContact OG-O 3.14Å
94	Y	56	Low	80.6	Confident	159 Å²	159	75.6 Å²	75.6	62%	0.624	36%	0.355	S	S	*	.			trans	65.7	107.1	-178.1	-58.2	-85.2	0	0	0	113.2	Q92 D96 Q97	Q92-Y94 PolarHBondContact O-N 2.63Å; Y94-D96 PolarHBondContact O-N 2.84Å; Y94-Q97 PolarHBondContact O-N 2.97Å
95	V	52.9	Low	80.6	Confident	117 Å²	117	74.4 Å²	74.4	71%	0.709	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	-22.2	176.6	-143.2	0	0	0	0	112
96	D	52.8	Low	80.6	Confident	147 Å²	147	73.6 Å²	73.6	79%	0.786	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.6	-9.8	-176.7	-36.4	-36.7	0	0	0	112.6	Y94 M98	Y94-D96 PolarHBondContact O-N 2.84Å; D96-M98 PolarHBondContact O-N 3.25Å
97	Q	53.2	Low	80.6	Confident	123 Å²	123	76.1 Å²	76.1	58%	0.575	37%	0.374	S	S	*	.			trans	-95.4	90.6	175.3	-67.5	-172.1	6.4	0	0	108.9	Y94 G99	Y94-Q97 PolarHBondContact O-N 2.97Å; Q97-G99 PolarHBondContact O-N 3.25Å
98	M	62.1	Low	80.7	Confident	117 Å²	117	76.7 Å²	76.7	58%	0.576	38%	0.378	S	S	*	.	P	Polyproline II helix	trans	-55.6	125.7	166.5	-132.2	81.9	78.4	0	0	108.2	Y72 D96	Y72-M98 VanDerWaalsContact OH-CE 3.32Å; Y72-M98 WeakPolarHBondContact OH-CE 3.31Å; Y72-M98 PolarHBondContact OH-SD 3.32Å; D96-M98 PolarHBondContact O-N 3.25Å
99	G	75.4	Confident	80.9	Confident	23 Å²	23	77.2 Å²	77.2	24%	0.237	38%	0.381	C	S	.	.	P	Polyproline II helix	trans	-59.8	167	174.2	0	0	0	0	0	111.3	Q97 T101	Q97-G99 PolarHBondContact O-N 3.25Å; G99-T101 PolarHBondContact O-N 2.91Å
100	R	85.1	Confident	81.1	Confident	172 Å²	172	83 Å²	83	65%	0.649	40%	0.404	S	S	*	.	P	Polyproline II helix	trans	-47.1	131.5	172.9	-176.9	178.9	170.9	144.7	0.6	109.8	C58 I61	C58-R100 PolarHBondContact O-NH2 3.23Å; C58-R100 VanDerWaalsContact O-NH2 3.13Å; I61-R100 HydrophobicContact CG2-CB 4.44Å; I61-R100 HydrophobicContact CG2-CG 4.02Å; I61-R100 WeakPolarHBondContact CG2-O 3.27Å
101	T	93.1	Very high	81.6	Confident	58 Å²	58	82.6 Å²	82.6	36%	0.356	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	155.4	177.5	52.2	0	0	0	0	111.1	I61 Y86 G87 G99	I61-T101 VanDerWaalsContact CG2-O 3.26Å; I61-T101 WeakPolarHBondContact CG2-O 3.26Å; Y86-T101 VanDerWaalsContact OH-CB 3.24Å; Y86-T101 WeakPolarHBondContact OH-CB 3.45Å; Y86-T101 PolarHBondContact OH-OG1 3.06Å; G87-T101 CarbonylContact O-C 3.58Å; G87-T101 WeakPolarHBondContact O-CA 3.47Å; G99-T101 PolarHBondContact O-N 2.91Å
102	G	95.9	Very high	82.4	Confident	2 Å²	2	84.1 Å²	84.1	2%	0.021	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	167.9	-176.4	172.8	0	0	0	0	0	112.4	R59 G87	R59-G102 CarbonylContact O-C 3.56Å; R59-G102 VanDerWaalsContact O-CA 3.29Å; R59-G102 WeakPolarHBondContact O-CA 3.49Å; G87-G102 PolarHBondContact N-O 3.28Å; G87-G102 PolarHBondContact O-N 3.49Å
103	Y	97.4	Very high	83.8	Confident	4 Å²	4	82.9 Å²	82.9	2%	0.016	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	154.1	-179.9	-63.4	-79.9	0	0	0	112.7	L29 R59 F60 I61 L75 F84 W85 Y86 D128 F129	L29-Y103 HydrophobicContact CD1-CD1 4.15Å; L29-Y103 HydrophobicContact CD1-CD2 3.66Å; L29-Y103 HydrophobicContact CD1-CE2 4.13Å; L29-Y103 HydrophobicContact CD1-CG 3.67Å; R59-Y103 HydrophobicContact CB-CD2 4.17Å; R59-Y103 WeakPolarHBondContact O-CD2 3.24Å; R59-Y103 PolarHBondContact O-N 3.03Å; F60-Y103 VanDerWaalsContact CA-O 3.24Å; F60-Y103 WeakPolarHBondContact CA-O 3.4Å; F60-Y103 WeakPolarHBondContact CB-O 3.48Å; F60-Y103 VanDerWaalsContact CD1-O 3.32Å; F60-Y103 WeakPolarHBondContact CD1-O 3.04Å; I61-Y103 PolarHBondContact N-O 3.22Å; I61-Y103 VanDerWaalsContact N-O 3.13Å; L75-Y103 HydrophobicContact CD1-CD1 3.98Å; L75-Y103 HydrophobicContact CD1-CE1 3.67Å; L75-Y103 HydrophobicContact CD2-CE1 3.9Å; L75-Y103 HydrophobicContact CG-CD1 4.26Å; L75-Y103 HydrophobicContact CG-CE1 3.81Å; F84-Y103 HydrophobicContact CB-CD1 4.48Å; W85-Y103 CarbonylContact O-C 3.55Å; W85-Y103 WeakPolarHBondContact O-CA 3.47Å; Y86-Y103 HydrophobicContact CD2-CD1 4.2Å; Y86-Y103 HydrophobicContact CD2-CD2 4.27Å; Y86-Y103 AromaticContact CD2-CE1 3.98Å; Y86-Y103 HydrophobicContact CD2-CE1 3.98Å; Y86-Y103 HydrophobicContact CD2-CE2 4.04Å; Y86-Y103 HydrophobicContact CD2-CG 4.34Å; Y86-Y103 AromaticContact CD2-CZ 3.89Å; Y86-Y103 HydrophobicContact CG-CE1 4.26Å; Y103-D128 WeakPolarHBondContact CE2-O 3.21Å; Y103-D128 PolarHBondContact OH-O 3.06Å; Y103-F129 HydrophobicContact CE1-CE1 4.26Å; Y103-F129 AromaticContact CE2-CD1 3.63Å; Y103-F129 HydrophobicContact CE2-CD1 3.63Å; Y103-F129 AromaticContact CE2-CE1 3.95Å; Y103-F129 HydrophobicContact CE2-CE1 3.95Å; Y103-F129 AromaticContact CZ-CD1 3.77Å; Y103-F129 AromaticContact CZ-CE1 3.61Å; Y103-F129 WeakPolarHBondContact OH-CE1 3.46Å
104	F	97.9	Very high	85.6	Confident	0 Å²	0	76 Å²	76	0%	0	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.3	154.8	169.4	54.1	-87	0	0	0	110.2	F53 I61 I63 V69 V71 F84 W85 A106 V108 V109	F53-F104 HydrophobicContact CD1-CB 4.01Å; F53-F104 HydrophobicContact CE1-CB 4.12Å; I61-F104 HydrophobicContact CD1-CD1 3.96Å; I61-F104 HydrophobicContact CD1-CE1 4.38Å; I61-F104 HydrophobicContact CG1-CD1 4.11Å; I63-F104 HydrophobicContact CD1-CB 3.49Å; I63-F104 VanDerWaalsContact CD1-CB 3.49Å; I63-F104 HydrophobicContact CD1-CD1 3.77Å; I63-F104 HydrophobicContact CD1-CD2 3.81Å; I63-F104 HydrophobicContact CD1-CE1 4.46Å; I63-F104 HydrophobicContact CD1-CG 3.39Å; V69-F104 HydrophobicContact CG1-CE1 3.63Å; V69-F104 HydrophobicContact CG1-CE2 4.45Å; V69-F104 HydrophobicContact CG1-CZ 3.59Å; V71-F104 HydrophobicContact CG2-CZ 4.26Å; F84-F104 WeakPolarHBondContact CA-O 3.32Å; W85-F104 HydrophobicContact CB-CE2 3.94Å; W85-F104 HydrophobicContact CB-CZ 3.89Å; W85-F104 HydrophobicContact CE3-CE2 4.16Å; W85-F104 PolarHBondContact N-O 3.13Å; W85-F104 PolarHBondContact O-N 2.63Å; F104-A106 PolarHBondContact O-N 3.41Å; F104-V108 HydrophobicContact CB-CG2 4.46Å; F104-V108 HydrophobicContact CD2-CG2 4.39Å; F104-V109 HydrophobicContact CD2-CG1 3.96Å; F104-V109 HydrophobicContact CD2-CG2 4.39Å; F104-V109 HydrophobicContact CE2-CB 4.45Å; F104-V109 HydrophobicContact CE2-CG1 3.77Å; F104-V109 HydrophobicContact CE2-CG2 3.78Å
105	P	97.9	Very high	87.4	Confident	21 Å²	21	72.7 Å²	72.7	14%	0.136	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.8	134.6	175.1	-19	29.8	0	0	0	111.1	F53 F84 T107 V108	F53-P105 HydrophobicContact CD2-CG 3.95Å; F53-P105 HydrophobicContact CE2-CG 3.73Å; F53-P105 HydrophobicContact CZ-CG 4.14Å; F84-P105 HydrophobicContact CD1-CG 4.4Å; F84-P105 HydrophobicContact CE1-CB 4.49Å; F84-P105 HydrophobicContact CE1-CG 4.05Å; P105-T107 PolarHBondContact O-N 2.92Å; P105-T107 VanDerWaalsContact O-N 3.09Å; P105-V108 HydrophobicContact CB-CG1 4.31Å; P105-V108 HydrophobicContact CB-CG2 4.49Å; P105-V108 HydrophobicContact CG-CG1 4.39Å; P105-V108 WeakPolarHBondContact O-CG2 3.4Å; P105-V108 PolarHBondContact O-N 3.36Å
106	A	97.8	Very high	89.1	Confident	16 Å²	16	68.9 Å²	68.9	13%	0.132	35%	0.348	C	S	.	.	G	3₁₀ helix	trans	-59.4	-25.1	175.4	0	0	0	0	0	112.5	V83 W85 F104 V108 V109	V83-A106 HydrophobicContact CB-CB 4.1Å; V83-A106 HydrophobicContact CG1-CB 3.73Å; V83-A106 PolarHBondContact O-N 3.43Å; W85-A106 HydrophobicContact CD2-CB 3.85Å; W85-A106 VanDerWaalsContact CE2-CB 3.44Å; W85-A106 HydrophobicContact CG-CB 4.18Å; W85-A106 HydrophobicContact CH2-CB 4.44Å; W85-A106 HydrophobicContact CZ2-CB 3.77Å; F104-A106 PolarHBondContact O-N 3.41Å; A106-V108 VanDerWaalsContact C-N 3.3Å; A106-V108 PolarHBondContact O-N 2.94Å; A106-V109 PolarHBondContact O-N 3.08Å; A106-V109 VanDerWaalsContact O-O 3.07Å
107	T	97.7	Very high	90.7	Very high	119 Å²	119	68.5 Å²	68.5	73%	0.73	35%	0.346	S	S	*	.	G	3₁₀ helix	trans	-69.7	-21	-179.3	53.5	0	0	0	0	114.2	P105 V109	P105-T107 PolarHBondContact O-N 2.92Å; P105-T107 VanDerWaalsContact O-N 3.09Å; T107-V109 VanDerWaalsContact C-N 3.31Å
108	V	98.3	Very high	92.4	Very high	13 Å²	13	69.1 Å²	69.1	8%	0.079	35%	0.353	C	S	.	.	G	3₁₀ helix	trans	-87.9	-1.8	-179.4	-57.1	0	0	0	0	112.9	A49 V50 D51 F53 I63 F104 P105 A106	A49-V108 CarbonylContact C-O 3.57Å; A49-V108 WeakPolarHBondContact CA-O 3.44Å; V50-V108 WeakPolarHBondContact CG2-O 3.46Å; V50-V108 PolarHBondContact N-O 3.3Å; D51-V108 HydrophobicContact CB-CB 4.43Å; D51-V108 HydrophobicContact CB-CG1 4.49Å; D51-V108 PolarHBondContact N-O 3.28Å; F53-V108 HydrophobicContact CB-CB 4.43Å; F53-V108 HydrophobicContact CB-CG1 4.25Å; F53-V108 HydrophobicContact CB-CG2 4.02Å; F53-V108 HydrophobicContact CG-CG2 4.48Å; I63-V108 HydrophobicContact CD1-CG2 4.5Å; F104-V108 HydrophobicContact CB-CG2 4.46Å; F104-V108 HydrophobicContact CD2-CG2 4.39Å; P105-V108 HydrophobicContact CB-CG1 4.31Å; P105-V108 HydrophobicContact CB-CG2 4.49Å; P105-V108 HydrophobicContact CG-CG1 4.39Å; P105-V108 WeakPolarHBondContact O-CG2 3.4Å; P105-V108 PolarHBondContact O-N 3.36Å; A106-V108 VanDerWaalsContact C-N 3.3Å; A106-V108 PolarHBondContact O-N 2.94Å
109	V	98.3	Very high	94	Very high	12 Å²	12	67 Å²	67	7%	0.073	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	157.6	176.8	-56.9	0	0	0	0	111.5	A47 T48 I63 V69 W85 F104 A106 T107	A47-V109 HydrophobicContact CB-CB 3.84Å; A47-V109 HydrophobicContact CB-CG2 3.88Å; T48-V109 CarbonylContact O-C 3.59Å; T48-V109 WeakPolarHBondContact O-CA 3.46Å; I63-V109 HydrophobicContact CD1-CG1 4.46Å; V69-V109 HydrophobicContact CG2-CG1 4.39Å; W85-V109 HydrophobicContact CE3-CG2 3.9Å; W85-V109 HydrophobicContact CZ3-CG2 3.7Å; F104-V109 HydrophobicContact CD2-CG1 3.96Å; F104-V109 HydrophobicContact CD2-CG2 4.39Å; F104-V109 HydrophobicContact CE2-CB 4.45Å; F104-V109 HydrophobicContact CE2-CG1 3.77Å; F104-V109 HydrophobicContact CE2-CG2 3.78Å; A106-V109 PolarHBondContact O-N 3.08Å; A106-V109 VanDerWaalsContact O-O 3.07Å; T107-V109 VanDerWaalsContact C-N 3.31Å
110	K	98.4	Very high	95	Very high	144 Å²	144	68.5 Å²	68.5	63%	0.626	35%	0.351	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.7	120.8	166.5	-178.8	178.2	-179.9	-179.5	0	108.7	A47 T48 V50 T112	A47-K110 CarbonylContact C-O 3.53Å; A47-K110 VanDerWaalsContact CA-O 3.25Å; A47-K110 WeakPolarHBondContact CA-O 3.19Å; A47-K110 WeakPolarHBondContact CB-O 3.46Å; T48-K110 PolarHBondContact N-O 2.01Å; T48-K110 PolarHBondContact O-N 3.46Å; V50-K110 HydrophobicContact CG1-CB 3.7Å; K110-T112 PolarHBondContact O-N 3.44Å
111	E	97.3	Very high	95.5	Very high	66 Å²	66	66.7 Å²	66.7	31%	0.308	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.2	125.4	175.3	-170.7	159.1	-110.2	0	0	109.9	S45 K74 W85	S45-E111 WeakPolarHBondContact CB-OE1 3.36Å; S45-E111 PolarHBondContact OG-OE1 3.25Å; K74-E111 VanDerWaalsContact CE-OE1 3.31Å; K74-E111 WeakPolarHBondContact CE-OE1 3.35Å; K74-E111 VanDerWaalsContact NZ-CD 3.3Å; K74-E111 IonicContact NZ-OE1 3.25Å; K74-E111 PolarHBondContact NZ-OE1 2.9Å; K74-E111 IonicContact NZ-OE2 3.84Å; K74-E111 PolarHBondContact NZ-OE2 2.87Å; K74-E111 VanDerWaalsContact NZ-OE2 3.11Å; W85-E111 HydrophobicContact CH2-CB 4.35Å; W85-E111 HydrophobicContact CZ3-CB 4.5Å
112	T	96.9	Very high	95.6	Very high	72 Å²	72	68.1 Å²	68.1	44%	0.442	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	-28.6	-174.6	51.6	0	0	0	0	112.8	M46 T48 K110	M46-T112 PolarHBondContact O-N 2.81Å; M46-T112 PolarHBondContact O-OG1 3.01Å; M46-T112 VanDerWaalsContact O-OG1 3.12Å; T48-T112 WeakPolarHBondContact OG1-CG2 3.48Å; K110-T112 PolarHBondContact O-N 3.44Å
113	R	96.5	Very high	95.7	Very high	150 Å²	150	73.6 Å²	73.6	57%	0.566	37%	0.371	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-150.2	126.7	176.6	-178	176.6	-179.5	-178	-0.4	111.2	S45 M46 F115	S45-R113 CarbonylContact C-O 3.56Å; S45-R113 WeakPolarHBondContact CA-O 3.2Å; S45-R113 WeakPolarHBondContact CB-O 3Å; M46-R113 HydrophobicContact CB-CB 4.34Å; M46-R113 HydrophobicContact CE-CB 4.25Å; M46-R113 PolarHBondContact N-O 3.32Å; M46-R113 PolarHBondContact O-N 3.48Å; M46-R113 VanDerWaalsContact O-N 3.12Å; R113-F115 HydrophobicContact CG-CD1 4.42Å; R113-F115 HydrophobicContact CG-CE1 4.15Å; R113-F115 HydrophobicContact CG-CZ 4.44Å
114	T	96.4	Very high	95.6	Very high	61 Å²	61	73.7 Å²	73.7	37%	0.374	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	132.9	168	-52.9	0	0	0	0	109.4	T116 D117	T114-T116 VanDerWaalsContact CG2-O 3.29Å; T114-T116 WeakPolarHBondContact CG2-O 3.15Å; T114-D117 WeakPolarHBondContact CG2-OD1 3.35Å
115	F	94.1	Very high	95.4	Very high	89 Å²	89	77.2 Å²	77.2	39%	0.39	39%	0.393	S	S	.	.	S	Bend	trans	-95.1	-29.1	177.8	-62.1	-71.9	0	0	0	112.3	V43 L44 M46 R113	V43-F115 HydrophobicContact CB-CD2 4.27Å; V43-F115 HydrophobicContact CB-CE2 4.45Å; V43-F115 HydrophobicContact CG1-CD2 3.72Å; V43-F115 HydrophobicContact CG1-CE2 3.65Å; L44-F115 PolarHBondContact O-N 2.91Å; M46-F115 HydrophobicContact CB-CE2 3.93Å; M46-F115 HydrophobicContact CB-CZ 4.12Å; R113-F115 HydrophobicContact CG-CD1 4.42Å; R113-F115 HydrophobicContact CG-CE1 4.15Å; R113-F115 HydrophobicContact CG-CZ 4.44Å
116	T	89.3	Confident	95.1	Very high	38 Å²	38	80.2 Å²	80.2	23%	0.233	41%	0.408	C	S	.	.			trans	-148.2	136.8	175.9	-178.9	0	0	0	0	110.8	T114 N118	T114-T116 VanDerWaalsContact CG2-O 3.29Å; T114-T116 WeakPolarHBondContact CG2-O 3.15Å; T116-N118 PolarHBondContact OG1-N 3.44Å; T116-N118 VanDerWaalsContact OG1-N 3.14Å; T116-N118 PolarHBondContact OG1-O 3.17Å
117	D	85.3	Confident	94.7	Very high	139 Å²	139	86 Å²	86	74%	0.743	43%	0.434	S	S	*	.			trans	-95.1	-11.1	169.3	-63	-47.7	0	0	0	111.9	T114 T119	T114-D117 WeakPolarHBondContact CG2-OD1 3.35Å; D117-T119 PolarHBondContact O-N 3.25Å
118	N	90.4	Very high	94.5	Very high	136 Å²	136	82 Å²	82	73%	0.727	41%	0.408	S	S	*	.			trans	-75.4	96.6	174.3	-68.1	-31.3	0	0	0	108.3	T116	T116-N118 PolarHBondContact OG1-N 3.44Å; T116-N118 VanDerWaalsContact OG1-N 3.14Å; T116-N118 PolarHBondContact OG1-O 3.17Å
119	T	94.3	Very high	94.3	Very high	71 Å²	71	81.8 Å²	81.8	44%	0.436	41%	0.406	S	S	.	.			trans	-106.9	145.6	-179.7	62.4	0	0	0	0	111.6	C35 L44 D117	C35-T119 CarbonylContact O-C 3.44Å; C35-T119 VanDerWaalsContact O-CA 3.26Å; C35-T119 WeakPolarHBondContact O-CA 2.92Å; L44-T119 HydrophobicContact CD1-CG2 3.85Å; D117-T119 PolarHBondContact O-N 3.25Å
120	V	96.2	Very high	93.9	Very high	56 Å²	56	87 Å²	87	34%	0.339	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	135.7	172.1	-61.7	0	0	0	0	110	M34 C35 D37	M34-V120 WeakPolarHBondContact CA-O 3.48Å; C35-V120 HydrophobicContact CB-CG2 4.22Å; C35-V120 PolarHBondContact N-O 2.97Å; C35-V120 PolarHBondContact O-N 2.8Å; D37-V120 VanDerWaalsContact C-CG2 3.44Å; D37-V120 WeakPolarHBondContact O-CG2 3.25Å
121	R	96.8	Very high	93.3	Very high	134 Å²	134	81.7 Å²	81.7	51%	0.506	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	125.7	178.7	-176.4	-179.2	-73.6	-120.4	-4.9	110	R32 K33 I76	R32-R121 VanDerWaalsContact NE-CD 3.33Å; K33-R121 WeakPolarHBondContact O-CA 3.46Å; I76-R121 HydrophobicContact CD1-CG 3.74Å; I76-R121 VanDerWaalsContact CD1-NH1 3.34Å
122	K	95.3	Very high	92	Very high	88 Å²	88	89 Å²	89	38%	0.383	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	160.1	-178.9	-62.1	-172.4	72	-160.6	0	112.2	R32 K33 A38	R32-K122 VanDerWaalsContact CA-O 3.31Å; R32-K122 WeakPolarHBondContact CA-O 3.26Å; K33-K122 PolarHBondContact N-O 3.34Å; K33-K122 PolarHBondContact O-N 3.43Å; A38-K122 WeakPolarHBondContact O-CD 3.43Å; A38-K122 WeakPolarHBondContact O-CE 3.39Å; A38-K122 PolarHBondContact O-NZ 2.81Å
123	Q	96.8	Very high	91.7	Very high	116 Å²	116	89.8 Å²	89.8	54%	0.542	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	145.4	168.8	-62.9	-69.7	19.5	0	0	109.8	D31	D31-Q123 CarbonylContact O-C 3.58Å; D31-Q123 WeakPolarHBondContact O-CA 3.48Å; D31-Q123 PolarHBondContact O-OE1 2.97Å
124	T	95.7	Very high	91.5	Very high	6 Å²	6	86.6 Å²	86.6	4%	0.037	44%	0.441	C	S	.	.			trans	-81.6	144.5	169.8	58.3	0	0	0	0	110.3	K28 A30 D31 K33 L75 D128 F129	K28-T124 PolarHBondContact NZ-O 2.87Å; A30-T124 WeakPolarHBondContact O-CB 3.49Å; A30-T124 WeakPolarHBondContact O-CG2 3.46Å; A30-T124 PolarHBondContact O-OG1 2.94Å; D31-T124 VanDerWaalsContact C-OG1 3.3Å; D31-T124 WeakPolarHBondContact CA-OG1 3.48Å; D31-T124 PolarHBondContact O-N 3.48Å; D31-T124 PolarHBondContact O-OG1 3.38Å; K33-T124 HydrophobicContact CB-CG2 4.1Å; K33-T124 HydrophobicContact CD-CG2 4.23Å; K33-T124 HydrophobicContact CG-CG2 4.13Å; L75-T124 HydrophobicContact CD2-CG2 4.14Å; T124-D128 WeakPolarHBondContact CA-OD2 3.45Å; T124-F129 HydrophobicContact CG2-CE2 4.24Å; T124-F129 HydrophobicContact CG2-CZ 3.91Å
125	T	94.1	Very high	91.2	Very high	74 Å²	74	88.1 Å²	88.1	45%	0.454	45%	0.445	S	S	.	.			trans	-105.1	167.9	175.4	69	0	0	0	0	110.3	M127 D128	T125-M127 PolarHBondContact O-N 3.11Å; T125-M127 PolarHBondContact OG1-N 2.95Å; T125-D128 PolarHBondContact N-OD2 3.47Å; T125-D128 WeakPolarHBondContact O-CB 3.41Å; T125-D128 PolarHBondContact O-N 3.39Å; T125-D128 VanDerWaalsContact O-N 3.08Å
126	D	90.8	Very high	91.1	Very high	84 Å²	84	88 Å²	88	45%	0.449	45%	0.448	S	S	.	.	G	3₁₀ helix	trans	-63.8	-27.3	175.9	-68	1.5	0	0	0	111.1	R25 K28 D128 F129 Y130	R25-D126 IonicContact NE-OD2 2.63Å; R25-D126 IonicContact NH2-OD2 3.06Å; R25-D126 PolarHBondContact NH2-OD2 3.14Å; K28-D126 WeakPolarHBondContact CE-OD1 3.22Å; K28-D126 IonicContact NZ-OD1 3.28Å; D126-D128 VanDerWaalsContact C-N 3.26Å; D126-D128 PolarHBondContact O-N 3.41Å; D126-F129 PolarHBondContact O-N 2.95Å; D126-Y130 PolarHBondContact O-N 2.95Å
127	M	90.6	Very high	91.2	Very high	138 Å²	138	91.1 Å²	91.1	68%	0.68	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-66.4	-25.2	174.3	-62.7	-54.6	-60.4	0	0	113.3	T125 F129 Y130	T125-M127 PolarHBondContact O-N 3.11Å; T125-M127 PolarHBondContact OG1-N 2.95Å; M127-F129 PolarHBondContact O-N 2.84Å; M127-Y130 HydrophobicContact CE-CD1 4.47Å; M127-Y130 PolarHBondContact O-N 3.08Å
128	D	93.4	Very high	91.6	Very high	35 Å²	35	87.9 Å²	87.9	19%	0.187	44%	0.443	C	S	.	.	G	3₁₀ helix	trans	-67	-19.8	177.6	-73.1	-43.5	0	0	0	112.5	K33 Y103 T124 T125 D126	K33-D128 IonicContact NZ-OD1 3.06Å; K33-D128 PolarHBondContact NZ-OD1 2.76Å; K33-D128 IonicContact NZ-OD2 3.99Å; K33-D128 PolarHBondContact NZ-OD2 3.37Å; Y103-D128 WeakPolarHBondContact CE2-O 3.21Å; Y103-D128 PolarHBondContact OH-O 3.06Å; T124-D128 WeakPolarHBondContact CA-OD2 3.45Å; T125-D128 PolarHBondContact N-OD2 3.47Å; T125-D128 WeakPolarHBondContact O-CB 3.41Å; T125-D128 PolarHBondContact O-N 3.39Å; T125-D128 VanDerWaalsContact O-N 3.08Å; D126-D128 VanDerWaalsContact C-N 3.26Å; D126-D128 PolarHBondContact O-N 3.41Å
129	F	93.3	Very high	91.6	Very high	8 Å²	8	84.5 Å²	84.5	4%	0.035	42%	0.422	C	S	.	.	G	3₁₀ helix	trans	-122.5	12.1	-177.2	-50.1	-67.3	0	0	0	112.6	K28 L29 A30 R59 L75 Y103 T124 D126 M127	K28-F129 HydrophobicContact CB-CD2 3.97Å; K28-F129 HydrophobicContact CB-CE2 3.6Å; K28-F129 HydrophobicContact CB-CZ 4.28Å; K28-F129 HydrophobicContact CD-CE2 4.1Å; K28-F129 HydrophobicContact CG-CD2 3.77Å; K28-F129 HydrophobicContact CG-CE2 3.65Å; L29-F129 HydrophobicContact CB-CD1 4.16Å; L29-F129 HydrophobicContact CB-CE1 3.62Å; L29-F129 HydrophobicContact CB-CZ 4.24Å; L29-F129 HydrophobicContact CD1-CD1 4.06Å; L29-F129 HydrophobicContact CD1-CE1 4.08Å; L29-F129 HydrophobicContact CG-CD1 3.93Å; L29-F129 HydrophobicContact CG-CE1 3.91Å; A30-F129 WeakPolarHBondContact O-CZ 3.2Å; R59-F129 WeakPolarHBondContact CG-O 3.37Å; L75-F129 HydrophobicContact CD1-CE1 3.97Å; L75-F129 HydrophobicContact CD1-CZ 4.4Å; Y103-F129 HydrophobicContact CE1-CE1 4.26Å; Y103-F129 AromaticContact CE2-CD1 3.63Å; Y103-F129 HydrophobicContact CE2-CD1 3.63Å; Y103-F129 AromaticContact CE2-CE1 3.95Å; Y103-F129 HydrophobicContact CE2-CE1 3.95Å; Y103-F129 AromaticContact CZ-CD1 3.77Å; Y103-F129 AromaticContact CZ-CE1 3.61Å; Y103-F129 WeakPolarHBondContact OH-CE1 3.46Å; T124-F129 HydrophobicContact CG2-CE2 4.24Å; T124-F129 HydrophobicContact CG2-CZ 3.91Å; D126-F129 PolarHBondContact O-N 2.95Å; M127-F129 PolarHBondContact O-N 2.84Å
130	Y	89.6	Confident	91.4	Very high	123 Å²	123	85.5 Å²	85.5	48%	0.482	42%	0.421	S	S	.	.			trans	-77.2	146.8	179.2	-173.5	-96.2	0	0	0	110.7	D126 M127 D132	D126-Y130 PolarHBondContact O-N 2.95Å; M127-Y130 HydrophobicContact CE-CD1 4.47Å; M127-Y130 PolarHBondContact O-N 3.08Å; Y130-D132 WeakPolarHBondContact CE1-OD1 3.49Å
131	C	87.1	Confident	91	Very high	32 Å²	32	88 Å²	88	22%	0.216	43%	0.428	C	S	.	.			trans	-115.4	130	172.8	-61.3	0	0	0	0	109.2	C58 R59	C58-C131 VanDerWaalsContact C-SG 3.51Å; C58-C131 HydrophobicContact CB-CB 3.62Å; C58-C131 WeakPolarHBondContact CB-SG 3.25Å; C58-C131 WeakPolarHBondContact SG-CB 3.46Å; C58-C131 CovalentContact SG-SG 2.01Å; C58-C131 PolarHBondContact SG-SG 3.2Å; R59-C131 PolarHBondContact N-SG 3.39Å
132	D	68.9	Low	90.5	Very high	218 Å²	218	83.8 Å²	83.8	100%	1.166	42%	0.421	S	S	*	.			trans	-72.8	0	172.3	-66.9	-27.9	0	0	0	112.7	Y130	Y130-D132 WeakPolarHBondContact CE1-OD1 3.49Å

Retrieved 132 of 132 residues in 35.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).