A0A3B3W294_9TELE Loading...

Transcription initiation factor IIA subunit 2

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

AlphaFold DB , UniProt , Accession A0A3B3W294, Species 9TELE (Poecilia latipinna, sailfin molly), Gene n/a, Length 109 aa.

						>A0A3B3W294_9TELE|A0A3B3W294
MAYQLYRNTTLGNSLQESLDELIQTQQITPQLALQVLLQFDKAINAALASRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELVKVDKVKIVACDGKNSGSNTAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.6	Low	92.6	Very high	229 Å²	229	93.1 Å²	93.1	100%	1.128	48%	0.48	S	S	*	.				0	137.1	0	-166.1	144.6	-178	0	0	108
2	A	83.8	Confident	93.1	Very high	32 Å²	32	85.3 Å²	85.3	26%	0.264	44%	0.44	S	S	.	.			trans	-96.5	134.2	-178.3	0	0	0	0	0	110.4	D41 K42 N45	A2-D41 HydrophobicContact CB-CB 3.84Å; A2-K42 HydrophobicContact CB-CG 4.3Å; A2-N45 HydrophobicContact CB-CB 4.47Å
3	Y	90.8	Very high	93.5	Very high	70 Å²	70	82.9 Å²	82.9	28%	0.275	43%	0.428	S	S	.	.			trans	-74.4	134.4	178.3	-67.7	-72.3	0	0	0	111	L5 N45 C98 D99	Y3-L5 VanDerWaalsContact C-N 3.25Å; Y3-L5 PolarHBondContact O-N 3.37Å; Y3-N45 PolarHBondContact N-ND2 3.39Å; Y3-N45 PolarHBondContact O-ND2 3.02Å; Y3-N45 VanDerWaalsContact O-ND2 3.08Å; Y3-C98 HydrophobicContact CD1-CB 3.63Å; Y3-C98 HydrophobicContact CD2-CB 4.32Å; Y3-C98 HydrophobicContact CE1-CB 3.54Å; Y3-C98 HydrophobicContact CE2-CB 4.25Å; Y3-C98 HydrophobicContact CG-CB 4.05Å; Y3-D99 PolarHBondContact OH-O 3.46Å
4	Q	95.4	Very high	93.9	Very high	113 Å²	113	80.7 Å²	80.7	53%	0.528	42%	0.423	S	S	.	.	G	3₁₀ helix	trans	-81.4	-4.6	174.6	-60	-178.9	14.9	0	0	112.8	Y6 R7 D41	Q4-Y6 PolarHBondContact O-N 2.95Å; Q4-Y6 VanDerWaalsContact O-N 3.11Å; Q4-R7 WeakPolarHBondContact O-CB 3.22Å; Q4-R7 WeakPolarHBondContact O-CG 3.44Å; Q4-R7 PolarHBondContact O-N 2.84Å; Q4-D41 WeakPolarHBondContact CG-OD2 3.25Å
5	L	95.9	Very high	94.2	Very high	64 Å²	64	78.3 Å²	78.3	34%	0.335	41%	0.41	S	S	.	.	G	3₁₀ helix	trans	-51.9	-37.3	-178.4	178	63.5	0	0	0	112.3	Y3 R7 N8 V96	Y3-L5 VanDerWaalsContact C-N 3.25Å; Y3-L5 PolarHBondContact O-N 3.37Å; L5-R7 PolarHBondContact O-N 3.3Å; L5-N8 PolarHBondContact O-N 3.48Å; L5-V96 HydrophobicContact CD1-CB 4.15Å; L5-V96 HydrophobicContact CD1-CG1 3.65Å; L5-V96 HydrophobicContact CD2-CG1 4.22Å
6	Y	97.9	Very high	94.5	Very high	73 Å²	73	77 Å²	77	29%	0.286	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-71.3	-8.5	-177.6	-60.1	-63.9	0	0	0	114.3	Q4 N8 T9 I44 L48	Q4-Y6 PolarHBondContact O-N 2.95Å; Q4-Y6 VanDerWaalsContact O-N 3.11Å; Y6-N8 VanDerWaalsContact C-N 3.26Å; Y6-N8 PolarHBondContact O-N 3.26Å; Y6-T9 HydrophobicContact CD1-CG2 4.28Å; Y6-T9 WeakPolarHBondContact O-CB 3.47Å; Y6-T9 WeakPolarHBondContact O-CG2 3.42Å; Y6-T9 PolarHBondContact O-N 3.33Å; Y6-T9 PolarHBondContact O-OG1 2.87Å; Y6-I44 HydrophobicContact CD2-CG1 4.47Å; Y6-I44 HydrophobicContact CD2-CG2 3.83Å; Y6-I44 HydrophobicContact CG-CG1 4.22Å; Y6-I44 HydrophobicContact CG-CG2 4.07Å; Y6-L48 HydrophobicContact CD1-CD1 4.1Å; Y6-L48 HydrophobicContact CD2-CD1 4.47Å; Y6-L48 HydrophobicContact CE1-CD1 3.58Å; Y6-L48 HydrophobicContact CE2-CD1 3.99Å
7	R	98.3	Very high	94.7	Very high	27 Å²	27	79.8 Å²	79.8	10%	0.102	41%	0.412	C	S	.	.	G	3₁₀ helix	trans	-64.6	-31.3	172.6	-64.2	-177	-173.4	-166.1	1.8	112	Q4 L5 T9 G12 N13 Q16 L37 F40 D41	Q4-R7 WeakPolarHBondContact O-CB 3.22Å; Q4-R7 WeakPolarHBondContact O-CG 3.44Å; Q4-R7 PolarHBondContact O-N 2.84Å; L5-R7 PolarHBondContact O-N 3.3Å; R7-T9 PolarHBondContact O-N 3.46Å; R7-G12 CarbonylContact O-C 3.53Å; R7-G12 WeakPolarHBondContact O-CA 3.29Å; R7-N13 PolarHBondContact O-N 3.05Å; R7-N13 VanDerWaalsContact O-N 3.16Å; R7-N13 PolarHBondContact O-OD1 3.14Å; R7-Q16 PolarHBondContact O-NE2 3.01Å; R7-L37 VanDerWaalsContact CZ-CB 3.46Å; R7-F40 HydrophobicContact CG-CD1 4.16Å; R7-F40 HydrophobicContact CG-CE1 4.1Å; R7-D41 WeakPolarHBondContact CG-OD1 3.46Å; R7-D41 IonicContact CZ-OD1 3.73Å; R7-D41 IonicContact CZ-OD2 3.38Å; R7-D41 IonicContact NE-OD1 2.86Å; R7-D41 PolarHBondContact NE-OD1 2.98Å; R7-D41 IonicContact NE-OD2 3.3Å; R7-D41 PolarHBondContact NE-OD2 3.36Å; R7-D41 IonicContact NH2-OD1 3.74Å; R7-D41 IonicContact NH2-OD2 2.67Å; R7-D41 PolarHBondContact NH2-OD2 3.23Å
8	N	98	Very high	94.9	Very high	131 Å²	131	78.8 Å²	78.8	70%	0.701	41%	0.414	S	S	*	.	G	3₁₀ helix	trans	-89.2	29.1	177.1	-165.3	28.8	0	0	0	113.3	L5 Y6	L5-N8 PolarHBondContact O-N 3.48Å; Y6-N8 VanDerWaalsContact C-N 3.26Å; Y6-N8 PolarHBondContact O-N 3.26Å
9	T	98.4	Very high	95.1	Very high	54 Å²	54	75.4 Å²	75.4	33%	0.331	40%	0.396	S	S	.	.	S	Bend	trans	-98.3	166.1	168.8	62.9	0	0	0	0	108.9	Y6 R7 L11 G12 N13	Y6-T9 HydrophobicContact CD1-CG2 4.28Å; Y6-T9 WeakPolarHBondContact O-CB 3.47Å; Y6-T9 WeakPolarHBondContact O-CG2 3.42Å; Y6-T9 PolarHBondContact O-N 3.33Å; Y6-T9 PolarHBondContact O-OG1 2.87Å; R7-T9 PolarHBondContact O-N 3.46Å; T9-L11 PolarHBondContact O-N 3.19Å; T9-G12 PolarHBondContact O-N 2.97Å; T9-G12 VanDerWaalsContact O-N 3.07Å; T9-G12 PolarHBondContact OG1-N 3.29Å; T9-N13 WeakPolarHBondContact O-CB 3.39Å; T9-N13 PolarHBondContact O-N 3.36Å
10	T	98.6	Very high	95.3	Very high	128 Å²	128	75.8 Å²	75.8	79%	0.785	40%	0.398	S	S	*	.	H	α-helix	trans	-52	-42.2	174.9	-49.4	0	0	0	0	112.4	S14	T10-S14 WeakPolarHBondContact O-CB 3.4Å; T10-S14 PolarHBondContact O-N 3.25Å; T10-S14 PolarHBondContact O-OG 2.85Å
11	L	98.6	Very high	95.5	Very high	103 Å²	103	78.2 Å²	78.2	54%	0.539	41%	0.407	S	S	.	.	H	α-helix	trans	-69	-39.3	178.2	-179	63.5	0	0	0	112.9	T9 S14 L15 F40 I44	T9-L11 PolarHBondContact O-N 3.19Å; L11-S14 PolarHBondContact O-OG 3.2Å; L11-S14 VanDerWaalsContact O-OG 3.06Å; L11-L15 PolarHBondContact O-N 3.22Å; L11-F40 HydrophobicContact CD2-CE2 4.2Å; L11-F40 HydrophobicContact CG-CE2 4.15Å; L11-I44 HydrophobicContact CD2-CD1 4.34Å
12	G	98.6	Very high	97.2	Very high	0 Å²	0	70.1 Å²	70.1	0%	0	37%	0.369	C	S	.	.	H	α-helix	trans	-72	-36	177.6	0	0	0	0	0	112.8	R7 T9 Q16	R7-G12 CarbonylContact O-C 3.53Å; R7-G12 WeakPolarHBondContact O-CA 3.29Å; T9-G12 PolarHBondContact O-N 2.97Å; T9-G12 VanDerWaalsContact O-N 3.07Å; T9-G12 PolarHBondContact OG1-N 3.29Å; G12-Q16 WeakPolarHBondContact O-CG 3.39Å; G12-Q16 PolarHBondContact O-N 3.24Å; G12-Q16 PolarHBondContact O-NE2 2.88Å; G12-Q16 VanDerWaalsContact O-NE2 3.14Å
13	N	98.6	Very high	97.9	Very high	54 Å²	54	70.7 Å²	70.7	29%	0.289	37%	0.367	S	S	.	.	H	α-helix	trans	-69	-45.9	176.7	-73.1	-19.9	0	0	0	110.9	R7 T9 L15 Q16 E17	R7-N13 PolarHBondContact O-N 3.05Å; R7-N13 VanDerWaalsContact O-N 3.16Å; R7-N13 PolarHBondContact O-OD1 3.14Å; T9-N13 WeakPolarHBondContact O-CB 3.39Å; T9-N13 PolarHBondContact O-N 3.36Å; N13-L15 VanDerWaalsContact C-N 3.27Å; N13-L15 PolarHBondContact O-N 3.48Å; N13-Q16 PolarHBondContact O-N 3.46Å; N13-Q16 PolarHBondContact OD1-NE2 3.03Å; N13-E17 WeakPolarHBondContact O-CG 3.26Å; N13-E17 PolarHBondContact O-N 3.4Å
14	S	98.8	Very high	98.3	Very high	52 Å²	52	74.6 Å²	74.6	36%	0.364	39%	0.387	S	S	.	.	H	α-helix	trans	-61.8	-35.8	176.9	62.2	0	0	0	0	112.4	T10 L11 S18	T10-S14 WeakPolarHBondContact O-CB 3.4Å; T10-S14 PolarHBondContact O-N 3.25Å; T10-S14 PolarHBondContact O-OG 2.85Å; L11-S14 PolarHBondContact O-OG 3.2Å; L11-S14 VanDerWaalsContact O-OG 3.06Å; S14-S18 WeakPolarHBondContact O-CB 3.35Å; S14-S18 PolarHBondContact O-N 3.14Å; S14-S18 PolarHBondContact O-OG 3.13Å
15	L	98.8	Very high	98.4	Very high	44 Å²	44	73.3 Å²	73.3	23%	0.23	39%	0.387	C	S	.	.	H	α-helix	trans	-64.3	-44.9	172.1	176.7	62.1	0	0	0	112	L11 N13 S18 L19 V36 L37 F40	L11-L15 PolarHBondContact O-N 3.22Å; N13-L15 VanDerWaalsContact C-N 3.27Å; N13-L15 PolarHBondContact O-N 3.48Å; L15-S18 PolarHBondContact O-N 3.43Å; L15-L19 HydrophobicContact CD1-CD1 4.14Å; L15-L19 HydrophobicContact CD1-CG 4.2Å; L15-L19 HydrophobicContact CG-CD1 4.04Å; L15-L19 VanDerWaalsContact O-CG 3.26Å; L15-L19 WeakPolarHBondContact O-CG 3.45Å; L15-L19 PolarHBondContact O-N 3.07Å; L15-V36 HydrophobicContact CD1-CG1 4.29Å; L15-L37 HydrophobicContact CD2-CD2 4.01Å; L15-L37 HydrophobicContact CG-CD2 4.24Å; L15-F40 HydrophobicContact CD2-CB 3.62Å; L15-F40 HydrophobicContact CD2-CD1 4.38Å; L15-F40 HydrophobicContact CD2-CD2 3.63Å; L15-F40 HydrophobicContact CD2-CE2 4.41Å; L15-F40 HydrophobicContact CD2-CG 3.61Å
16	Q	98.7	Very high	98.5	Very high	58 Å²	58	78.8 Å²	78.8	27%	0.271	41%	0.411	S	S	.	.	H	α-helix	trans	-63.6	-46.3	178.8	-74.7	171.4	109.2	0	0	111.4	R7 G12 N13 S18 L19 D20 L37	R7-Q16 PolarHBondContact O-NE2 3.01Å; G12-Q16 WeakPolarHBondContact O-CG 3.39Å; G12-Q16 PolarHBondContact O-N 3.24Å; G12-Q16 PolarHBondContact O-NE2 2.88Å; G12-Q16 VanDerWaalsContact O-NE2 3.14Å; N13-Q16 PolarHBondContact O-N 3.46Å; N13-Q16 PolarHBondContact OD1-NE2 3.03Å; Q16-S18 VanDerWaalsContact C-N 3.32Å; Q16-S18 PolarHBondContact O-N 2.87Å; Q16-L19 PolarHBondContact O-N 3.39Å; Q16-L19 VanDerWaalsContact O-N 3.13Å; Q16-D20 PolarHBondContact O-N 3.31Å; Q16-L37 HydrophobicContact CG-CD1 4.13Å; Q16-L37 HydrophobicContact CG-CD2 3.65Å
17	E	98.7	Very high	98.5	Very high	124 Å²	124	82 Å²	82	58%	0.579	43%	0.429	S	S	*	.	H	α-helix	trans	-57.5	-45.3	175.2	-70.7	167.4	-170.5	0	0	111.3	N13 L19 D20 E21	N13-E17 WeakPolarHBondContact O-CG 3.26Å; N13-E17 PolarHBondContact O-N 3.4Å; E17-L19 VanDerWaalsContact C-N 3.35Å; E17-L19 PolarHBondContact O-N 3.43Å; E17-D20 PolarHBondContact O-N 3.24Å; E17-E21 PolarHBondContact O-N 2.95Å
18	S	98.8	Very high	98.5	Very high	63 Å²	63	82.4 Å²	82.4	44%	0.441	43%	0.433	S	S	.	.	H	α-helix	trans	-61.3	-42.2	175.9	-55.6	0	0	0	0	112.1	S14 L15 Q16 E21 L22	S14-S18 WeakPolarHBondContact O-CB 3.35Å; S14-S18 PolarHBondContact O-N 3.14Å; S14-S18 PolarHBondContact O-OG 3.13Å; L15-S18 PolarHBondContact O-N 3.43Å; Q16-S18 VanDerWaalsContact C-N 3.32Å; Q16-S18 PolarHBondContact O-N 2.87Å; S18-E21 PolarHBondContact O-N 3.14Å; S18-L22 WeakPolarHBondContact O-CG 3.33Å; S18-L22 PolarHBondContact O-N 3.3Å
19	L	98.8	Very high	98.6	Very high	13 Å²	13	80.1 Å²	80.1	7%	0.068	42%	0.424	C	S	.	.	H	α-helix	trans	-67	-38	177.8	-71.5	170.7	0	0	0	111.6	L15 Q16 E17 L22 I23 I28 A33 V36 L37	L15-L19 HydrophobicContact CD1-CD1 4.14Å; L15-L19 HydrophobicContact CD1-CG 4.2Å; L15-L19 HydrophobicContact CG-CD1 4.04Å; L15-L19 VanDerWaalsContact O-CG 3.26Å; L15-L19 WeakPolarHBondContact O-CG 3.45Å; L15-L19 PolarHBondContact O-N 3.07Å; Q16-L19 PolarHBondContact O-N 3.39Å; Q16-L19 VanDerWaalsContact O-N 3.13Å; E17-L19 VanDerWaalsContact C-N 3.35Å; E17-L19 PolarHBondContact O-N 3.43Å; L19-L22 PolarHBondContact O-N 2.86Å; L19-I23 VanDerWaalsContact O-CG1 3.29Å; L19-I23 WeakPolarHBondContact O-CG1 3.5Å; L19-I23 PolarHBondContact O-N 3.05Å; L19-I28 HydrophobicContact CD2-CD1 3.74Å; L19-A33 HydrophobicContact CB-CB 4.08Å; L19-A33 HydrophobicContact CD1-CB 4.23Å; L19-A33 HydrophobicContact CD2-CB 4.22Å; L19-A33 HydrophobicContact CG-CB 4.41Å; L19-V36 HydrophobicContact CD1-CB 4.13Å; L19-V36 HydrophobicContact CD1-CG1 4.04Å; L19-V36 HydrophobicContact CD2-CB 4.18Å; L19-V36 HydrophobicContact CD2-CG1 4.13Å; L19-V36 HydrophobicContact CD2-CG2 4.29Å; L19-L37 HydrophobicContact CD1-CD2 3.86Å; L19-L37 HydrophobicContact CD1-CG 3.85Å
20	D	98.6	Very high	98.6	Very high	83 Å²	83	81.9 Å²	81.9	44%	0.444	44%	0.436	S	S	.	.	H	α-helix	trans	-64.4	-39.8	177	-73.9	-22.9	0	0	0	111.4	Q16 E17 L22 I23 Q24	Q16-D20 PolarHBondContact O-N 3.31Å; E17-D20 PolarHBondContact O-N 3.24Å; D20-L22 PolarHBondContact O-N 3.32Å; D20-I23 PolarHBondContact O-N 2.95Å; D20-Q24 WeakPolarHBondContact O-CB 3.34Å; D20-Q24 WeakPolarHBondContact O-CG 3.44Å; D20-Q24 PolarHBondContact O-N 3.01Å
21	E	98.8	Very high	98.5	Very high	127 Å²	127	81.5 Å²	81.5	59%	0.593	43%	0.425	S	S	*	.	H	α-helix	trans	-60.6	-42.6	172.7	-72.5	-178.8	-167.7	0	0	112.3	E17 S18 I23 Q24 T25	E17-E21 PolarHBondContact O-N 2.95Å; S18-E21 PolarHBondContact O-N 3.14Å; E21-I23 VanDerWaalsContact C-N 3.32Å; E21-I23 PolarHBondContact O-N 3.39Å; E21-Q24 PolarHBondContact O-N 2.67Å; E21-T25 WeakPolarHBondContact O-CG2 3.35Å; E21-T25 PolarHBondContact O-N 3.34Å; E21-T25 PolarHBondContact O-OG1 3.2Å
22	L	98.6	Very high	98.5	Very high	60 Å²	60	80.7 Å²	80.7	31%	0.314	42%	0.421	S	S	.	.	H	α-helix	trans	-66.5	-33.6	176.9	-63.6	175.1	0	0	0	112.2	S18 L19 D20 T25 Q26 Q27 I28	S18-L22 WeakPolarHBondContact O-CG 3.33Å; S18-L22 PolarHBondContact O-N 3.3Å; L19-L22 PolarHBondContact O-N 2.86Å; D20-L22 PolarHBondContact O-N 3.32Å; L22-T25 WeakPolarHBondContact CA-OG1 3.4Å; L22-T25 PolarHBondContact O-OG1 2.91Å; L22-Q26 PolarHBondContact O-N 3.18Å; L22-Q27 HydrophobicContact CD2-CB 4.4Å; L22-Q27 PolarHBondContact O-N 3Å; L22-I28 HydrophobicContact CB-CD1 3.67Å; L22-I28 HydrophobicContact CB-CG1 3.67Å; L22-I28 HydrophobicContact CB-CG2 4.39Å; L22-I28 HydrophobicContact CD1-CD1 4.07Å; L22-I28 PolarHBondContact O-N 3.02Å
23	I	98.5	Very high	98.5	Very high	44 Å²	44	81 Å²	81	23%	0.226	42%	0.423	C	S	.	.	H	α-helix	trans	-68.7	-47.2	173.3	-68.3	164.5	0	0	0	110.2	L19 D20 E21 T25 Q26 I28 P30 A33	L19-I23 VanDerWaalsContact O-CG1 3.29Å; L19-I23 WeakPolarHBondContact O-CG1 3.5Å; L19-I23 PolarHBondContact O-N 3.05Å; D20-I23 PolarHBondContact O-N 2.95Å; E21-I23 VanDerWaalsContact C-N 3.32Å; E21-I23 PolarHBondContact O-N 3.39Å; I23-T25 VanDerWaalsContact C-N 3.27Å; I23-T25 PolarHBondContact O-N 3.18Å; I23-Q26 WeakPolarHBondContact O-CA 3.31Å; I23-Q26 PolarHBondContact O-N 2.71Å; I23-I28 HydrophobicContact CG1-CD1 4.22Å; I23-I28 HydrophobicContact CG1-CG1 3.81Å; I23-P30 HydrophobicContact CD1-CB 4.39Å; I23-P30 HydrophobicContact CG2-CG 4.05Å; I23-A33 HydrophobicContact CD1-CB 3.74Å; I23-A33 HydrophobicContact CG1-CB 4.38Å
24	Q	98.4	Very high	98.5	Very high	151 Å²	151	81.9 Å²	81.9	71%	0.706	43%	0.428	S	S	*	.	H	α-helix	trans	-60.9	-37.6	-179.1	-73.8	172	31.4	0	0	112	D20 E21 Q26	D20-Q24 WeakPolarHBondContact O-CB 3.34Å; D20-Q24 WeakPolarHBondContact O-CG 3.44Å; D20-Q24 PolarHBondContact O-N 3.01Å; E21-Q24 PolarHBondContact O-N 2.67Å; Q24-Q26 PolarHBondContact O-N 2.95Å
25	T	98.4	Very high	98.5	Very high	86 Å²	86	84 Å²	84	53%	0.528	43%	0.432	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.4	6.4	175.3	56.1	0	0	0	0	113.7	E21 L22 I23 Q27	E21-T25 WeakPolarHBondContact O-CG2 3.35Å; E21-T25 PolarHBondContact O-N 3.34Å; E21-T25 PolarHBondContact O-OG1 3.2Å; L22-T25 WeakPolarHBondContact CA-OG1 3.4Å; L22-T25 PolarHBondContact O-OG1 2.91Å; I23-T25 VanDerWaalsContact C-N 3.27Å; I23-T25 PolarHBondContact O-N 3.18Å; T25-Q27 PolarHBondContact O-N 2.84Å
26	Q	97.9	Very high	98.5	Very high	180 Å²	180	84.5 Å²	84.5	84%	0.841	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.1	23.9	179.6	-56.5	-178.3	-8	0	0	114.5	L22 I23 Q24	L22-Q26 PolarHBondContact O-N 3.18Å; I23-Q26 WeakPolarHBondContact O-CA 3.31Å; I23-Q26 PolarHBondContact O-N 2.71Å; Q24-Q26 PolarHBondContact O-N 2.95Å
27	Q	98.4	Very high	98.5	Very high	139 Å²	139	82.7 Å²	82.7	65%	0.65	43%	0.429	S	S	*	.	S	Bend	trans	-80.2	-29.5	177.8	-66	-175	-18.5	0	0	112.3	L22 T25	L22-Q27 HydrophobicContact CD2-CB 4.4Å; L22-Q27 PolarHBondContact O-N 3Å; T25-Q27 PolarHBondContact O-N 2.84Å
28	I	98.6	Very high	98.4	Very high	36 Å²	36	79.6 Å²	79.6	19%	0.185	42%	0.416	C	S	.	.	S	Bend	trans	-134.5	159.7	175.3	70.2	177.6	0	0	0	111.5	L19 L22 I23 L32 A33	L19-I28 HydrophobicContact CD2-CD1 3.74Å; L22-I28 HydrophobicContact CB-CD1 3.67Å; L22-I28 HydrophobicContact CB-CG1 3.67Å; L22-I28 HydrophobicContact CB-CG2 4.39Å; L22-I28 HydrophobicContact CD1-CD1 4.07Å; L22-I28 PolarHBondContact O-N 3.02Å; I23-I28 HydrophobicContact CG1-CD1 4.22Å; I23-I28 HydrophobicContact CG1-CG1 3.81Å; I28-L32 HydrophobicContact CB-CD2 4.12Å; I28-L32 HydrophobicContact CG2-CD2 4.06Å; I28-A33 HydrophobicContact CD1-CB 4.02Å
29	T	98.4	Very high	98.4	Very high	84 Å²	84	81.9 Å²	81.9	52%	0.515	42%	0.42	S	S	.	.			trans	-85.8	153.1	172.1	65.6	0	0	0	0	111.1	Q31 L32 A33	T29-Q31 PolarHBondContact O-N 2.97Å; T29-L32 PolarHBondContact O-N 3.09Å; T29-L32 PolarHBondContact OG1-N 3.34Å; T29-A33 PolarHBondContact O-N 2.93Å; T29-A33 VanDerWaalsContact O-N 3.14Å
30	P	98.3	Very high	98.4	Very high	90 Å²	90	82.4 Å²	82.4	58%	0.584	42%	0.422	S	S	*	.	H	α-helix	trans	-55.9	-34.3	172.4	-26.3	34.5	0	0	0	113.1	I23 L32 A33 L34	I23-P30 HydrophobicContact CD1-CB 4.39Å; I23-P30 HydrophobicContact CG2-CG 4.05Å; P30-L32 VanDerWaalsContact C-N 3.34Å; P30-L32 PolarHBondContact O-N 2.88Å; P30-A33 PolarHBondContact O-N 2.8Å; P30-L34 PolarHBondContact O-N 3.16Å
31	Q	98.2	Very high	98.4	Very high	120 Å²	120	78.7 Å²	78.7	56%	0.561	40%	0.401	S	S	*	.	H	α-helix	trans	-65.1	-37.9	177.2	-174	60.3	23.6	0	0	112.1	T29 L34 Q35	T29-Q31 PolarHBondContact O-N 2.97Å; Q31-L34 PolarHBondContact O-N 3.07Å; Q31-Q35 PolarHBondContact O-N 3.2Å
32	L	98.4	Very high	98.3	Very high	87 Å²	87	78.6 Å²	78.6	46%	0.455	40%	0.399	S	S	.	.	H	α-helix	trans	-68.4	-42.6	175.8	-178.5	57.9	0	0	0	111.3	I28 T29 P30 L34 Q35 V36	I28-L32 HydrophobicContact CB-CD2 4.12Å; I28-L32 HydrophobicContact CG2-CD2 4.06Å; T29-L32 PolarHBondContact O-N 3.09Å; T29-L32 PolarHBondContact OG1-N 3.34Å; P30-L32 VanDerWaalsContact C-N 3.34Å; P30-L32 PolarHBondContact O-N 2.88Å; L32-L34 VanDerWaalsContact C-N 3.27Å; L32-L34 PolarHBondContact O-N 3.24Å; L32-Q35 WeakPolarHBondContact O-CA 3.47Å; L32-Q35 WeakPolarHBondContact O-CB 3.2Å; L32-Q35 PolarHBondContact O-N 3.14Å; L32-V36 PolarHBondContact O-N 2.82Å
33	A	98.5	Very high	98.3	Very high	6 Å²	6	78.3 Å²	78.3	5%	0.05	41%	0.405	C	S	.	.	H	α-helix	trans	-57.2	-41.1	174.7	0	0	0	0	0	112.1	L19 I23 I28 T29 P30 Q35 V36 L37	L19-A33 HydrophobicContact CB-CB 4.08Å; L19-A33 HydrophobicContact CD1-CB 4.23Å; L19-A33 HydrophobicContact CD2-CB 4.22Å; L19-A33 HydrophobicContact CG-CB 4.41Å; I23-A33 HydrophobicContact CD1-CB 3.74Å; I23-A33 HydrophobicContact CG1-CB 4.38Å; I28-A33 HydrophobicContact CD1-CB 4.02Å; T29-A33 PolarHBondContact O-N 2.93Å; T29-A33 VanDerWaalsContact O-N 3.14Å; P30-A33 PolarHBondContact O-N 2.8Å; A33-Q35 VanDerWaalsContact C-N 3.32Å; A33-Q35 PolarHBondContact O-N 3.15Å; A33-V36 WeakPolarHBondContact O-CB 3.49Å; A33-V36 PolarHBondContact O-N 3.03Å; A33-V36 VanDerWaalsContact O-N 3.14Å; A33-L37 WeakPolarHBondContact O-CG 3.3Å; A33-L37 PolarHBondContact O-N 3.2Å
34	L	98.1	Very high	98.3	Very high	73 Å²	73	77.6 Å²	77.6	38%	0.382	40%	0.402	S	S	.	.	H	α-helix	trans	-60.4	-39.9	174	-178.1	62.7	0	0	0	112.4	P30 Q31 L32 V36 L37 L38	P30-L34 PolarHBondContact O-N 3.16Å; Q31-L34 PolarHBondContact O-N 3.07Å; L32-L34 VanDerWaalsContact C-N 3.27Å; L32-L34 PolarHBondContact O-N 3.24Å; L34-V36 VanDerWaalsContact C-N 3.34Å; L34-L37 PolarHBondContact O-N 3.28Å; L34-L38 WeakPolarHBondContact O-CG 3.48Å; L34-L38 PolarHBondContact O-N 3.06Å
35	Q	98.5	Very high	98.1	Very high	96 Å²	96	72.1 Å²	72.1	45%	0.449	38%	0.377	S	S	.	.	H	α-helix	trans	-64.2	-38.9	174.7	-64.9	-55.2	-54.9	0	0	112.1	Q31 L32 A33 L38 Q39	Q31-Q35 PolarHBondContact O-N 3.2Å; L32-Q35 WeakPolarHBondContact O-CA 3.47Å; L32-Q35 WeakPolarHBondContact O-CB 3.2Å; L32-Q35 PolarHBondContact O-N 3.14Å; A33-Q35 VanDerWaalsContact C-N 3.32Å; A33-Q35 PolarHBondContact O-N 3.15Å; Q35-L38 PolarHBondContact O-N 3.19Å; Q35-Q39 PolarHBondContact O-N 3.26Å
36	V	98.6	Very high	98	Very high	55 Å²	55	70.7 Å²	70.7	33%	0.333	37%	0.374	S	S	.	.	H	α-helix	trans	-62	-44.7	174.5	177.3	0	0	0	0	110.6	L15 L19 L32 A33 L34 L38 Q39 F40	L15-V36 HydrophobicContact CD1-CG1 4.29Å; L19-V36 HydrophobicContact CD1-CB 4.13Å; L19-V36 HydrophobicContact CD1-CG1 4.04Å; L19-V36 HydrophobicContact CD2-CB 4.18Å; L19-V36 HydrophobicContact CD2-CG1 4.13Å; L19-V36 HydrophobicContact CD2-CG2 4.29Å; L32-V36 PolarHBondContact O-N 2.82Å; A33-V36 WeakPolarHBondContact O-CB 3.49Å; A33-V36 PolarHBondContact O-N 3.03Å; A33-V36 VanDerWaalsContact O-N 3.14Å; L34-V36 VanDerWaalsContact C-N 3.34Å; V36-L38 PolarHBondContact O-N 2.85Å; V36-Q39 CarbonylContact O-C 3.59Å; V36-Q39 WeakPolarHBondContact O-CB 3.34Å; V36-Q39 PolarHBondContact O-N 3.3Å; V36-Q39 VanDerWaalsContact O-N 3.13Å; V36-F40 PolarHBondContact O-N 3.34Å
37	L	98.5	Very high	97.9	Very high	19 Å²	19	63.6 Å²	63.6	10%	0.099	35%	0.346	C	S	.	.	H	α-helix	trans	-64.6	-38.5	177.3	-67.1	175.3	0	0	0	112.6	R7 L15 Q16 L19 A33 L34 Q39 F40 D41	R7-L37 VanDerWaalsContact CZ-CB 3.46Å; L15-L37 HydrophobicContact CD2-CD2 4.01Å; L15-L37 HydrophobicContact CG-CD2 4.24Å; Q16-L37 HydrophobicContact CG-CD1 4.13Å; Q16-L37 HydrophobicContact CG-CD2 3.65Å; L19-L37 HydrophobicContact CD1-CD2 3.86Å; L19-L37 HydrophobicContact CD1-CG 3.85Å; A33-L37 WeakPolarHBondContact O-CG 3.3Å; A33-L37 PolarHBondContact O-N 3.2Å; L34-L37 PolarHBondContact O-N 3.28Å; L37-Q39 VanDerWaalsContact C-N 3.26Å; L37-Q39 PolarHBondContact O-N 2.87Å; L37-F40 WeakPolarHBondContact O-CB 3.28Å; L37-F40 PolarHBondContact O-N 2.95Å; L37-D41 PolarHBondContact O-N 3.21Å
38	L	98.2	Very high	97.8	Very high	59 Å²	59	60.2 Å²	60.2	31%	0.309	33%	0.332	S	S	.	.	H	α-helix	trans	-62.6	-35.2	173	-72.1	172.6	0	0	0	112.1	L34 Q35 V36 K42	L34-L38 WeakPolarHBondContact O-CG 3.48Å; L34-L38 PolarHBondContact O-N 3.06Å; Q35-L38 PolarHBondContact O-N 3.19Å; V36-L38 PolarHBondContact O-N 2.85Å; L38-K42 PolarHBondContact O-N 2.67Å
39	Q	98.4	Very high	97.6	Very high	112 Å²	112	62 Å²	62	52%	0.523	35%	0.353	S	S	.	.	H	α-helix	trans	-73.3	-37.7	175.1	-171.8	58	25	0	0	111.9	Q35 V36 L37 D41 K42 A43	Q35-Q39 PolarHBondContact O-N 3.26Å; V36-Q39 CarbonylContact O-C 3.59Å; V36-Q39 WeakPolarHBondContact O-CB 3.34Å; V36-Q39 PolarHBondContact O-N 3.3Å; V36-Q39 VanDerWaalsContact O-N 3.13Å; L37-Q39 VanDerWaalsContact C-N 3.26Å; L37-Q39 PolarHBondContact O-N 2.87Å; Q39-D41 VanDerWaalsContact C-N 3.35Å; Q39-D41 PolarHBondContact O-N 2.87Å; Q39-K42 PolarHBondContact O-N 3.43Å; Q39-A43 WeakPolarHBondContact O-CB 3.31Å; Q39-A43 PolarHBondContact O-N 2.85Å
40	F	98.6	Very high	97.4	Very high	24 Å²	24	61.2 Å²	61.2	11%	0.105	35%	0.35	C	S	.	.	H	α-helix	trans	-57.4	-46.7	171.7	167.4	-98.2	0	0	0	111.3	R7 L11 L15 V36 L37 K42 A43 I44	R7-F40 HydrophobicContact CG-CD1 4.16Å; R7-F40 HydrophobicContact CG-CE1 4.1Å; L11-F40 HydrophobicContact CD2-CE2 4.2Å; L11-F40 HydrophobicContact CG-CE2 4.15Å; L15-F40 HydrophobicContact CD2-CB 3.62Å; L15-F40 HydrophobicContact CD2-CD1 4.38Å; L15-F40 HydrophobicContact CD2-CD2 3.63Å; L15-F40 HydrophobicContact CD2-CE2 4.41Å; L15-F40 HydrophobicContact CD2-CG 3.61Å; V36-F40 PolarHBondContact O-N 3.34Å; L37-F40 WeakPolarHBondContact O-CB 3.28Å; L37-F40 PolarHBondContact O-N 2.95Å; F40-K42 VanDerWaalsContact C-N 3.29Å; F40-K42 PolarHBondContact O-N 2.98Å; F40-A43 PolarHBondContact O-N 3.11Å; F40-A43 VanDerWaalsContact O-N 3.08Å; F40-I44 HydrophobicContact CE1-CG2 4.15Å; F40-I44 HydrophobicContact CE2-CB 4.32Å; F40-I44 HydrophobicContact CZ-CB 4.29Å; F40-I44 HydrophobicContact CZ-CG1 4.5Å; F40-I44 HydrophobicContact CZ-CG2 4.21Å; F40-I44 WeakPolarHBondContact O-CG2 3.41Å; F40-I44 PolarHBondContact O-N 3.08Å
41	D	98.1	Very high	97.3	Very high	4 Å²	4	66.8 Å²	66.8	2%	0.021	36%	0.36	C	S	.	.	H	α-helix	trans	-55.2	-46.4	178.6	-59.2	-34.3	0	0	0	111	A2 Q4 R7 L37 Q39 N45	A2-D41 HydrophobicContact CB-CB 3.84Å; Q4-D41 WeakPolarHBondContact CG-OD2 3.25Å; R7-D41 WeakPolarHBondContact CG-OD1 3.46Å; R7-D41 IonicContact CZ-OD1 3.73Å; R7-D41 IonicContact CZ-OD2 3.38Å; R7-D41 IonicContact NE-OD1 2.86Å; R7-D41 PolarHBondContact NE-OD1 2.98Å; R7-D41 IonicContact NE-OD2 3.3Å; R7-D41 PolarHBondContact NE-OD2 3.36Å; R7-D41 IonicContact NH2-OD1 3.74Å; R7-D41 IonicContact NH2-OD2 2.67Å; R7-D41 PolarHBondContact NH2-OD2 3.23Å; L37-D41 PolarHBondContact O-N 3.21Å; Q39-D41 VanDerWaalsContact C-N 3.35Å; Q39-D41 PolarHBondContact O-N 2.87Å; D41-N45 WeakPolarHBondContact O-CB 3.46Å; D41-N45 PolarHBondContact O-N 3.25Å; D41-N45 PolarHBondContact O-ND2 2.82Å
42	K	96.8	Very high	97.3	Very high	126 Å²	126	64.3 Å²	64.3	55%	0.548	35%	0.353	S	S	.	.	H	α-helix	trans	-62.3	-46.8	177.2	-65.4	173.7	-171.6	171.4	0	111.4	A2 L38 Q39 F40 A46	A2-K42 HydrophobicContact CB-CG 4.3Å; L38-K42 PolarHBondContact O-N 2.67Å; Q39-K42 PolarHBondContact O-N 3.43Å; F40-K42 VanDerWaalsContact C-N 3.29Å; F40-K42 PolarHBondContact O-N 2.98Å; K42-A46 VanDerWaalsContact O-CB 3.31Å; K42-A46 WeakPolarHBondContact O-CB 3.32Å; K42-A46 PolarHBondContact O-N 2.86Å
43	A	98.1	Very high	97.1	Very high	53 Å²	53	69.6 Å²	69.6	44%	0.438	37%	0.366	S	S	.	.	H	α-helix	trans	-63.7	-47.3	-175.7	0	0	0	0	0	112.2	Q39 F40 A46 A47	Q39-A43 WeakPolarHBondContact O-CB 3.31Å; Q39-A43 PolarHBondContact O-N 2.85Å; F40-A43 PolarHBondContact O-N 3.11Å; F40-A43 VanDerWaalsContact O-N 3.08Å; A43-A46 PolarHBondContact O-N 3.5Å; A43-A47 VanDerWaalsContact O-CB 3.28Å; A43-A47 WeakPolarHBondContact O-CB 3.44Å; A43-A47 PolarHBondContact O-N 2.82Å
44	I	97.8	Very high	96.9	Very high	30 Å²	30	73.9 Å²	73.9	15%	0.154	39%	0.389	C	S	.	.	H	α-helix	trans	-69.6	-41.9	-177.3	-168	61.6	0	0	0	112	Y6 L11 F40 A46 A47 L48	Y6-I44 HydrophobicContact CD2-CG1 4.47Å; Y6-I44 HydrophobicContact CD2-CG2 3.83Å; Y6-I44 HydrophobicContact CG-CG1 4.22Å; Y6-I44 HydrophobicContact CG-CG2 4.07Å; L11-I44 HydrophobicContact CD2-CD1 4.34Å; F40-I44 HydrophobicContact CE1-CG2 4.15Å; F40-I44 HydrophobicContact CE2-CB 4.32Å; F40-I44 HydrophobicContact CZ-CB 4.29Å; F40-I44 HydrophobicContact CZ-CG1 4.5Å; F40-I44 HydrophobicContact CZ-CG2 4.21Å; F40-I44 WeakPolarHBondContact O-CG2 3.41Å; F40-I44 PolarHBondContact O-N 3.08Å; I44-A46 VanDerWaalsContact C-N 3.34Å; I44-A46 PolarHBondContact O-N 2.94Å; I44-A47 PolarHBondContact O-N 3.5Å; I44-L48 HydrophobicContact CD1-CD1 4.39Å; I44-L48 HydrophobicContact CD1-CG 4.27Å; I44-L48 HydrophobicContact CG1-CD1 4.08Å; I44-L48 HydrophobicContact CG1-CG 4.39Å; I44-L48 WeakPolarHBondContact O-CB 3.3Å; I44-L48 WeakPolarHBondContact O-CG 3.35Å; I44-L48 PolarHBondContact O-N 3Å
45	N	95.8	Very high	96.8	Very high	36 Å²	36	79.6 Å²	79.6	19%	0.193	41%	0.405	C	S	.	.	H	α-helix	trans	-61.2	-44.1	176	-80.3	-94.9	0	0	0	110.7	A2 Y3 D41 A49	A2-N45 HydrophobicContact CB-CB 4.47Å; Y3-N45 PolarHBondContact N-ND2 3.39Å; Y3-N45 PolarHBondContact O-ND2 3.02Å; Y3-N45 VanDerWaalsContact O-ND2 3.08Å; D41-N45 WeakPolarHBondContact O-CB 3.46Å; D41-N45 PolarHBondContact O-N 3.25Å; D41-N45 PolarHBondContact O-ND2 2.82Å; N45-A49 WeakPolarHBondContact O-CB 3.49Å; N45-A49 PolarHBondContact O-N 3.47Å; N45-A49 VanDerWaalsContact O-N 3.14Å
46	A	95.2	Very high	96.7	Very high	56 Å²	56	78.3 Å²	78.3	46%	0.463	40%	0.404	S	S	.	.	H	α-helix	trans	-66.3	-42.5	177.6	0	0	0	0	0	112.6	K42 A43 I44 A49 S50	K42-A46 VanDerWaalsContact O-CB 3.31Å; K42-A46 WeakPolarHBondContact O-CB 3.32Å; K42-A46 PolarHBondContact O-N 2.86Å; A43-A46 PolarHBondContact O-N 3.5Å; I44-A46 VanDerWaalsContact C-N 3.34Å; I44-A46 PolarHBondContact O-N 2.94Å; A46-A49 PolarHBondContact O-N 3.34Å; A46-S50 WeakPolarHBondContact O-CB 3.2Å; A46-S50 PolarHBondContact O-N 3.4Å; A46-S50 PolarHBondContact O-OG 3.44Å
47	A	97.1	Very high	96.6	Very high	30 Å²	30	79.9 Å²	79.9	25%	0.248	41%	0.41	C	S	.	.	H	α-helix	trans	-64.4	-46.2	-179.7	0	0	0	0	0	111.7	A43 I44 A49 S50 R51	A43-A47 VanDerWaalsContact O-CB 3.28Å; A43-A47 WeakPolarHBondContact O-CB 3.44Å; A43-A47 PolarHBondContact O-N 2.82Å; I44-A47 PolarHBondContact O-N 3.5Å; A47-A49 PolarHBondContact O-N 2.84Å; A47-S50 PolarHBondContact O-N 3.13Å; A47-R51 VanDerWaalsContact O-CB 3.26Å; A47-R51 WeakPolarHBondContact O-CB 3.41Å; A47-R51 PolarHBondContact O-N 3.4Å
48	L	95.9	Very high	96.6	Very high	68 Å²	68	84.1 Å²	84.1	36%	0.356	43%	0.428	S	S	.	.	H	α-helix	trans	-62	-42.9	177.1	-70	174.6	0	0	0	111.6	Y6 I44 V52	Y6-L48 HydrophobicContact CD1-CD1 4.1Å; Y6-L48 HydrophobicContact CD2-CD1 4.47Å; Y6-L48 HydrophobicContact CE1-CD1 3.58Å; Y6-L48 HydrophobicContact CE2-CD1 3.99Å; I44-L48 HydrophobicContact CD1-CD1 4.39Å; I44-L48 HydrophobicContact CD1-CG 4.27Å; I44-L48 HydrophobicContact CG1-CD1 4.08Å; I44-L48 HydrophobicContact CG1-CG 4.39Å; I44-L48 WeakPolarHBondContact O-CB 3.3Å; I44-L48 WeakPolarHBondContact O-CG 3.35Å; I44-L48 PolarHBondContact O-N 3Å; L48-V52 HydrophobicContact CD2-CG2 3.97Å; L48-V52 WeakPolarHBondContact O-CB 3.49Å
49	A	93.6	Very high	96.6	Very high	75 Å²	75	88.5 Å²	88.5	62%	0.62	44%	0.441	S	S	*	.	H	α-helix	trans	-69.8	-36.6	-178.9	0	0	0	0	0	113.9	N45 A46 A47	N45-A49 WeakPolarHBondContact O-CB 3.49Å; N45-A49 PolarHBondContact O-N 3.47Å; N45-A49 VanDerWaalsContact O-N 3.14Å; A46-A49 PolarHBondContact O-N 3.34Å; A47-A49 PolarHBondContact O-N 2.84Å
50	S	95.1	Very high	96.6	Very high	67 Å²	67	85 Å²	85	47%	0.469	43%	0.434	S	S	.	.	H	α-helix	trans	-100	-29.6	-170.6	62	0	0	0	0	114.6	A46 A47 R53	A46-S50 WeakPolarHBondContact O-CB 3.2Å; A46-S50 PolarHBondContact O-N 3.4Å; A46-S50 PolarHBondContact O-OG 3.44Å; A47-S50 PolarHBondContact O-N 3.13Å; S50-R53 PolarHBondContact O-NH2 3.33Å
51	R	96.8	Very high	96.6	Very high	206 Å²	206	87.1 Å²	87.1	78%	0.777	45%	0.452	S	S	*	.	H	α-helix	trans	-105.2	-25.6	-171.1	-53.8	-176.7	179.8	-165.6	-1.5	113.5	A47	A47-R51 VanDerWaalsContact O-CB 3.26Å; A47-R51 WeakPolarHBondContact O-CB 3.41Å; A47-R51 PolarHBondContact O-N 3.4Å
52	V	96.4	Very high	96.6	Very high	68 Å²	68	91.5 Å²	91.5	41%	0.412	48%	0.475	S	S	.	.			trans	-91	130.3	-176.5	-174.8	0	0	0	0	109.9	L48 N54	L48-V52 HydrophobicContact CD2-CG2 3.97Å; L48-V52 WeakPolarHBondContact O-CB 3.49Å; V52-N54 WeakPolarHBondContact CG1-OD1 3.44Å
53	R	95.1	Very high	96.7	Very high	198 Å²	198	89.5 Å²	89.5	75%	0.747	47%	0.47	S	S	*	.			trans	-131.6	-12.9	-174.6	-61.8	-63.5	-176	-145.9	1.8	114	S50	S50-R53 PolarHBondContact O-NH2 3.33Å
54	N	94.6	Very high	96.7	Very high	96 Å²	96	90 Å²	90	51%	0.513	47%	0.468	S	S	.	.			trans	-69.7	153.4	-179.4	63.6	-49.6	0	0	0	111.1	V52 E83	V52-N54 WeakPolarHBondContact CG1-OD1 3.44Å; N54-E83 WeakPolarHBondContact CB-OE1 3.34Å; N54-E83 PolarHBondContact ND2-OE1 2.71Å
55	R	94.8	Very high	96.8	Very high	193 Å²	193	95.9 Å²	95.9	73%	0.728	49%	0.489	S	S	*	.			trans	-123.2	133.8	-179.4	-179.8	177.5	173.7	175.4	-0.2	109.2
56	V	97.2	Very high	96.9	Very high	70 Å²	70	100.8 Å²	100.8	42%	0.424	51%	0.505	S	S	.	.			trans	-114.5	139.6	175	178.8	0	0	0	0	108.7	F81	V56-F81 HydrophobicContact CG1-CB 4.26Å; V56-F81 HydrophobicContact CG1-CD1 4.02Å
57	N	97.6	Very high	97	Very high	87 Å²	87	103.1 Å²	103.1	47%	0.465	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	149.1	167.5	-61.4	-70.3	0	0	0	108.7	R82	N57-R82 PolarHBondContact N-O 3.34Å; N57-R82 PolarHBondContact O-N 3.44Å
58	F	98.3	Very high	97	Very high	109 Å²	109	105 Å²	105	48%	0.478	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.5	153.7	175.8	69.2	-83.3	0	0	0	111.9	L76 V79 E80 F81 I95	F58-L76 HydrophobicContact CD2-CD2 4.47Å; F58-L76 HydrophobicContact CE2-CD2 4.07Å; F58-V79 HydrophobicContact CB-CG1 4.37Å; F58-V79 HydrophobicContact CD2-CG1 4.29Å; F58-E80 CarbonylContact C-O 3.51Å; F58-E80 WeakPolarHBondContact CA-O 3.5Å; F58-E80 WeakPolarHBondContact CB-O 3.16Å; F58-F81 HydrophobicContact CB-CD1 3.52Å; F58-F81 HydrophobicContact CB-CE1 3.74Å; F58-F81 HydrophobicContact CB-CG 4.14Å; F58-F81 HydrophobicContact CD1-CE1 4.3Å; F58-F81 HydrophobicContact CD2-CE1 4.49Å; F58-F81 HydrophobicContact CG-CD1 4.19Å; F58-F81 AromaticContact CG-CE1 3.94Å; F58-F81 HydrophobicContact CG-CE1 3.94Å; F58-I95 HydrophobicContact CE2-CD1 3.92Å; F58-I95 HydrophobicContact CZ-CD1 3.96Å
59	R	98	Very high	96.8	Very high	151 Å²	151	108.7 Å²	108.7	57%	0.57	54%	0.535	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-138.2	148.2	170.6	70.6	177.1	-169.5	-83.2	-7	110.1	V79 E80	R59-V79 CarbonylContact O-C 3.57Å; R59-V79 WeakPolarHBondContact O-CA 3.45Å; R59-V79 WeakPolarHBondContact O-CG1 3.35Å; R59-E80 HydrophobicContact CG-CB 4.32Å; R59-E80 IonicContact CZ-OE1 3.3Å; R59-E80 IonicContact CZ-OE2 3.49Å; R59-E80 VanDerWaalsContact CZ-OE2 3.3Å; R59-E80 PolarHBondContact N-O 3.48Å; R59-E80 IonicContact NH1-OE1 3.43Å; R59-E80 PolarHBondContact NH1-OE1 2.9Å; R59-E80 IonicContact NH1-OE2 2.78Å; R59-E80 PolarHBondContact NH1-OE2 3.44Å; R59-E80 VanDerWaalsContact NH2-CD 3.33Å; R59-E80 IonicContact NH2-OE1 2.68Å; R59-E80 PolarHBondContact NH2-OE1 2.9Å; R59-E80 IonicContact NH2-OE2 3.48Å; R59-E80 PolarHBondContact NH2-OE2 2.96Å; R59-E80 PolarHBondContact O-N 3Å
60	G	98.1	Very high	96.8	Very high	37 Å²	37	110.2 Å²	110.2	38%	0.381	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-179.7	177.5	177.5	0	0	0	0	0	111.5
61	S	98.6	Very high	96.8	Very high	70 Å²	70	109 Å²	109	49%	0.49	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	119.4	-178.4	-63.6	0	0	0	0	110.2	N63 L76 N77	S61-N63 PolarHBondContact O-N 3.41Å; S61-L76 CarbonylContact O-C 3.49Å; S61-L76 VanDerWaalsContact O-CA 3.25Å; S61-L76 WeakPolarHBondContact O-CA 3.38Å; S61-N77 PolarHBondContact N-O 3.11Å; S61-N77 PolarHBondContact O-N 2.97Å
62	L	98.7	Very high	96.9	Very high	96 Å²	96	104 Å²	104	50%	0.503	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.1	122.3	176.3	-178.1	63.6	0	0	0	110.2	Y65 F74 L76	L62-Y65 HydrophobicContact CD2-CD1 3.83Å; L62-F74 HydrophobicContact CD1-CB 4.27Å; L62-F74 HydrophobicContact CD1-CD1 4Å; L62-L76 HydrophobicContact CD1-CD1 4.49Å; L62-L76 HydrophobicContact CD1-CG 4.31Å
63	N	98.4	Very high	97	Very high	83 Å²	83	101.9 Å²	101.9	44%	0.444	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	-55.1	178	-177.7	-31	0	0	0	110.6	S61 V75 N77	S61-N63 PolarHBondContact O-N 3.41Å; N63-V75 WeakPolarHBondContact CA-O 3.35Å; N63-V75 HydrophobicContact CB-CG1 4.34Å; N63-V75 VanDerWaalsContact CB-O 3.28Å; N63-V75 WeakPolarHBondContact CB-O 3.41Å; N63-V75 PolarHBondContact N-O 2.86Å; N63-N77 PolarHBondContact ND2-ND2 2.83Å; N63-N77 PolarHBondContact ND2-OD1 2.85Å
64	T	98.7	Very high	97.1	Very high	63 Å²	63	95.1 Å²	95.1	39%	0.387	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.1	155.2	176.9	-174.9	0	0	0	0	111	V75	T64-V75 HydrophobicContact CG2-CB 3.73Å; T64-V75 HydrophobicContact CG2-CG2 3.85Å; T64-V75 PolarHBondContact N-O 3.34Å; T64-V75 PolarHBondContact O-N 3.31Å
65	Y	98.6	Very high	97.3	Very high	154 Å²	154	91.8 Å²	91.8	60%	0.604	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-139	154	176.6	65.7	-89.9	0	0	0	111	L62 W72 T73	L62-Y65 HydrophobicContact CD2-CD1 3.83Å; Y65-W72 AromaticContact CD2-CZ3 3.95Å; Y65-W72 HydrophobicContact CD2-CZ3 3.95Å; Y65-T73 CarbonylContact C-O 3.03Å; Y65-T73 VanDerWaalsContact CA-O 3.31Å; Y65-T73 WeakPolarHBondContact CA-O 3.45Å
66	R	98.6	Very high	97.5	Very high	140 Å²	140	83.2 Å²	83.2	53%	0.528	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	140.2	174.3	-173.4	-172.2	-55.6	88	6.4	109.7	W72 T73	R66-W72 WeakPolarHBondContact O-CA 3.31Å; R66-T73 PolarHBondContact N-O 3.29Å; R66-T73 PolarHBondContact O-N 3.23Å
67	F	97.9	Very high	97.6	Very high	104 Å²	104	82.1 Å²	82.1	46%	0.456	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	121.7	167.3	-178	-115.6	0	0	0	109.2	W72	F67-W72 HydrophobicContact CB-CD2 3.96Å; F67-W72 HydrophobicContact CB-CE3 3.92Å; F67-W72 HydrophobicContact CB-CH2 3.86Å; F67-W72 HydrophobicContact CB-CZ2 3.87Å; F67-W72 HydrophobicContact CB-CZ3 3.89Å; F67-W72 AromaticContact CD2-CD1 3.52Å; F67-W72 AromaticContact CD2-CD2 3.73Å; F67-W72 HydrophobicContact CD2-CD2 3.73Å; F67-W72 AromaticContact CD2-CE2 3.46Å; F67-W72 VanDerWaalsContact CD2-CE2 3.46Å; F67-W72 AromaticContact CD2-CG 3.77Å; F67-W72 HydrophobicContact CD2-CG 3.77Å; F67-W72 HydrophobicContact CD2-CZ2 4.07Å; F67-W72 AromaticContact CD2-NE1 3.31Å; F67-W72 VanDerWaalsContact CD2-NE1 3.31Å; F67-W72 AromaticContact CE2-CD1 3.76Å; F67-W72 HydrophobicContact CE2-CG 4.42Å; F67-W72 AromaticContact CE2-NE1 3.55Å; F67-W72 HydrophobicContact CG-CD2 4.18Å; F67-W72 AromaticContact CG-CE2 3.81Å; F67-W72 HydrophobicContact CG-CH2 4.44Å; F67-W72 AromaticContact CG-CZ2 3.95Å; F67-W72 HydrophobicContact CG-CZ2 3.95Å
68	C	95.1	Very high	97.6	Very high	69 Å²	69	83.6 Å²	83.6	47%	0.466	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.8	140.9	177.3	-167.1	0	0	0	0	108.1	N70 V71	C68-N70 VanDerWaalsContact C-N 3.27Å; C68-N70 PolarHBondContact O-N 2.9Å; C68-V71 PolarHBondContact N-O 2.75Å; C68-V71 PolarHBondContact O-N 3.08Å
69	D	93.5	Very high	97.7	Very high	146 Å²	146	78.5 Å²	78.5	78%	0.781	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	51	40	177.6	-54.9	-35.4	0	0	0	114.9	V71	D69-V71 PolarHBondContact O-N 2.99Å
70	N	92.1	Very high	97.7	Very high	107 Å²	107	72 Å²	72	57%	0.572	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.1	22.7	-176.3	-58	-45.9	0	0	0	114.7	C68 D99	C68-N70 VanDerWaalsContact C-N 3.27Å; C68-N70 PolarHBondContact O-N 2.9Å; N70-D99 PolarHBondContact O-N 2.91Å
71	V	96	Very high	97.7	Very high	41 Å²	41	72.8 Å²	72.8	25%	0.248	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	124.6	174.2	-177	0	0	0	0	109.8	C68 D69 V96 A97	C68-V71 PolarHBondContact N-O 2.75Å; C68-V71 PolarHBondContact O-N 3.08Å; D69-V71 PolarHBondContact O-N 2.99Å; V71-V96 HydrophobicContact CG1-CG1 3.6Å; V71-A97 WeakPolarHBondContact CA-O 3.43Å
72	W	98	Very high	97.6	Very high	101 Å²	101	75.2 Å²	75.2	38%	0.383	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	135.3	168.6	-80.5	97.7	0	0	0	110.4	Y65 R66 F67 F74 V96 A97	Y65-W72 AromaticContact CD2-CZ3 3.95Å; Y65-W72 HydrophobicContact CD2-CZ3 3.95Å; R66-W72 WeakPolarHBondContact O-CA 3.31Å; F67-W72 HydrophobicContact CB-CD2 3.96Å; F67-W72 HydrophobicContact CB-CE3 3.92Å; F67-W72 HydrophobicContact CB-CH2 3.86Å; F67-W72 HydrophobicContact CB-CZ2 3.87Å; F67-W72 HydrophobicContact CB-CZ3 3.89Å; F67-W72 AromaticContact CD2-CD1 3.52Å; F67-W72 AromaticContact CD2-CD2 3.73Å; F67-W72 HydrophobicContact CD2-CD2 3.73Å; F67-W72 AromaticContact CD2-CE2 3.46Å; F67-W72 VanDerWaalsContact CD2-CE2 3.46Å; F67-W72 AromaticContact CD2-CG 3.77Å; F67-W72 HydrophobicContact CD2-CG 3.77Å; F67-W72 HydrophobicContact CD2-CZ2 4.07Å; F67-W72 AromaticContact CD2-NE1 3.31Å; F67-W72 VanDerWaalsContact CD2-NE1 3.31Å; F67-W72 AromaticContact CE2-CD1 3.76Å; F67-W72 HydrophobicContact CE2-CG 4.42Å; F67-W72 AromaticContact CE2-NE1 3.55Å; F67-W72 HydrophobicContact CG-CD2 4.18Å; F67-W72 AromaticContact CG-CE2 3.81Å; F67-W72 HydrophobicContact CG-CH2 4.44Å; F67-W72 AromaticContact CG-CZ2 3.95Å; F67-W72 HydrophobicContact CG-CZ2 3.95Å; W72-F74 HydrophobicContact CB-CD2 4.36Å; W72-F74 HydrophobicContact CB-CE2 3.58Å; W72-F74 HydrophobicContact CB-CZ 3.92Å; W72-F74 HydrophobicContact CD2-CE1 4.37Å; W72-F74 HydrophobicContact CD2-CE2 4.27Å; W72-F74 AromaticContact CD2-CZ 3.67Å; W72-F74 HydrophobicContact CD2-CZ 3.67Å; W72-F74 AromaticContact CE3-CE1 3.55Å; W72-F74 HydrophobicContact CE3-CE1 3.55Å; W72-F74 HydrophobicContact CE3-CE2 4.14Å; W72-F74 AromaticContact CE3-CZ 3.3Å; W72-F74 HydrophobicContact CE3-CZ 3.3Å; W72-F74 HydrophobicContact CG-CE2 4.08Å; W72-F74 AromaticContact CG-CZ 3.95Å; W72-F74 HydrophobicContact CG-CZ 3.95Å; W72-F74 AromaticContact CZ3-CE1 3.93Å; W72-F74 HydrophobicContact CZ3-CE1 3.93Å; W72-F74 HydrophobicContact CZ3-CZ 4.03Å; W72-V96 CarbonylContact O-C 3.59Å; W72-V96 WeakPolarHBondContact O-CA 3.04Å; W72-A97 HydrophobicContact CB-CB 4.39Å; W72-A97 PolarHBondContact N-O 2.91Å; W72-A97 PolarHBondContact O-N 2.77Å
73	T	98.4	Very high	97.4	Very high	24 Å²	24	73.7 Å²	73.7	15%	0.147	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	120.9	168.3	-60.1	0	0	0	0	109.2	Y65 R66 K94 I95 V96	Y65-T73 CarbonylContact C-O 3.03Å; Y65-T73 VanDerWaalsContact CA-O 3.31Å; Y65-T73 WeakPolarHBondContact CA-O 3.45Å; R66-T73 PolarHBondContact N-O 3.29Å; R66-T73 PolarHBondContact O-N 3.23Å; T73-K94 HydrophobicContact CG2-CG 4.29Å; T73-I95 CarbonylContact C-O 3.49Å; T73-I95 VanDerWaalsContact CA-O 3.3Å; T73-I95 WeakPolarHBondContact CA-O 3.44Å; T73-V96 HydrophobicContact CG2-CG2 4.32Å
74	F	98.8	Very high	97	Very high	57 Å²	57	76.4 Å²	76.4	25%	0.25	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	146.5	174.1	-53.1	-82.2	0	0	0	110	L62 W72 L76 K94 I95	L62-F74 HydrophobicContact CD1-CB 4.27Å; L62-F74 HydrophobicContact CD1-CD1 4Å; W72-F74 HydrophobicContact CB-CD2 4.36Å; W72-F74 HydrophobicContact CB-CE2 3.58Å; W72-F74 HydrophobicContact CB-CZ 3.92Å; W72-F74 HydrophobicContact CD2-CE1 4.37Å; W72-F74 HydrophobicContact CD2-CE2 4.27Å; W72-F74 AromaticContact CD2-CZ 3.67Å; W72-F74 HydrophobicContact CD2-CZ 3.67Å; W72-F74 AromaticContact CE3-CE1 3.55Å; W72-F74 HydrophobicContact CE3-CE1 3.55Å; W72-F74 HydrophobicContact CE3-CE2 4.14Å; W72-F74 AromaticContact CE3-CZ 3.3Å; W72-F74 HydrophobicContact CE3-CZ 3.3Å; W72-F74 HydrophobicContact CG-CE2 4.08Å; W72-F74 AromaticContact CG-CZ 3.95Å; W72-F74 HydrophobicContact CG-CZ 3.95Å; W72-F74 AromaticContact CZ3-CE1 3.93Å; W72-F74 HydrophobicContact CZ3-CE1 3.93Å; W72-F74 HydrophobicContact CZ3-CZ 4.03Å; F74-L76 HydrophobicContact CB-CD1 3.66Å; F74-K94 CarbonylContact O-C 3.56Å; F74-K94 VanDerWaalsContact O-CA 3.31Å; F74-K94 WeakPolarHBondContact O-CA 3.39Å; F74-I95 HydrophobicContact CB-CB 4.31Å; F74-I95 HydrophobicContact CD2-CB 4.33Å; F74-I95 HydrophobicContact CD2-CG2 4.39Å; F74-I95 PolarHBondContact N-O 2.78Å; F74-I95 PolarHBondContact O-N 3.48Å
75	V	98.8	Very high	96.6	Very high	25 Å²	25	79.4 Å²	79.4	15%	0.152	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	125.3	162.5	-179.8	0	0	0	0	106.8	N63 T64 K92 V93 K94	N63-V75 WeakPolarHBondContact CA-O 3.35Å; N63-V75 HydrophobicContact CB-CG1 4.34Å; N63-V75 VanDerWaalsContact CB-O 3.28Å; N63-V75 WeakPolarHBondContact CB-O 3.41Å; N63-V75 PolarHBondContact N-O 2.86Å; T64-V75 HydrophobicContact CG2-CB 3.73Å; T64-V75 HydrophobicContact CG2-CG2 3.85Å; T64-V75 PolarHBondContact N-O 3.34Å; T64-V75 PolarHBondContact O-N 3.31Å; V75-K92 HydrophobicContact CG1-CD 4.29Å; V75-K92 HydrophobicContact CG1-CG 3.98Å; V75-V93 VanDerWaalsContact CA-O 3.32Å; V75-V93 WeakPolarHBondContact CA-O 3.26Å; V75-K94 HydrophobicContact CG2-CG 4.47Å
76	L	98.8	Very high	96.4	Very high	14 Å²	14	77.7 Å²	77.7	7%	0.073	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	148.4	177.7	-64.9	83.3	0	0	0	109	F58 S61 L62 F74 V79 K92 V93 I95	F58-L76 HydrophobicContact CD2-CD2 4.47Å; F58-L76 HydrophobicContact CE2-CD2 4.07Å; S61-L76 CarbonylContact O-C 3.49Å; S61-L76 VanDerWaalsContact O-CA 3.25Å; S61-L76 WeakPolarHBondContact O-CA 3.38Å; L62-L76 HydrophobicContact CD1-CD1 4.49Å; L62-L76 HydrophobicContact CD1-CG 4.31Å; F74-L76 HydrophobicContact CB-CD1 3.66Å; L76-V79 HydrophobicContact CB-CG2 3.44Å; L76-V79 VanDerWaalsContact CB-CG2 3.44Å; L76-V79 HydrophobicContact CD2-CG2 4.39Å; L76-K92 CarbonylContact O-C 3.54Å; L76-K92 VanDerWaalsContact O-CA 3.3Å; L76-K92 WeakPolarHBondContact O-CA 3.32Å; L76-V93 HydrophobicContact CB-CG1 3.99Å; L76-V93 HydrophobicContact CD1-CG1 4.39Å; L76-V93 PolarHBondContact N-O 3.07Å; L76-V93 PolarHBondContact O-N 3.43Å; L76-I95 HydrophobicContact CD1-CD1 3.83Å; L76-I95 HydrophobicContact CD1-CG1 4.27Å
77	N	98.7	Very high	96.3	Very high	47 Å²	47	74.8 Å²	74.8	25%	0.251	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	157	170.8	-58.8	-18.3	0	0	0	110	S61 N63 V79 D91	S61-N77 PolarHBondContact N-O 3.11Å; S61-N77 PolarHBondContact O-N 2.97Å; N63-N77 PolarHBondContact ND2-ND2 2.83Å; N63-N77 PolarHBondContact ND2-OD1 2.85Å; N77-V79 PolarHBondContact O-N 3.3Å; N77-D91 CarbonylContact C-O 3.59Å; N77-D91 WeakPolarHBondContact CA-O 3.35Å
78	D	98.4	Very high	96.3	Very high	118 Å²	118	73.2 Å²	73.2	63%	0.631	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.7	53.8	173.3	-52.2	-55.1	0	0	0	112.7	D91	D78-D91 PolarHBondContact N-O 2.89Å
79	V	98.6	Very high	96.4	Very high	2 Å²	2	77.3 Å²	77.3	1%	0.012	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	133.9	-172.2	-170.9	0	0	0	0	111.3	F58 R59 L76 N77 F81 K89 V90 V93	F58-V79 HydrophobicContact CB-CG1 4.37Å; F58-V79 HydrophobicContact CD2-CG1 4.29Å; R59-V79 CarbonylContact O-C 3.57Å; R59-V79 WeakPolarHBondContact O-CA 3.45Å; R59-V79 WeakPolarHBondContact O-CG1 3.35Å; L76-V79 HydrophobicContact CB-CG2 3.44Å; L76-V79 VanDerWaalsContact CB-CG2 3.44Å; L76-V79 HydrophobicContact CD2-CG2 4.39Å; N77-V79 PolarHBondContact O-N 3.3Å; V79-F81 HydrophobicContact CB-CE2 4.17Å; V79-F81 HydrophobicContact CG1-CD2 3.93Å; V79-F81 HydrophobicContact CG1-CE2 3.5Å; V79-F81 HydrophobicContact CG1-CZ 3.83Å; V79-K89 CarbonylContact O-C 3.59Å; V79-K89 WeakPolarHBondContact O-CA 3.38Å; V79-V90 HydrophobicContact CB-CG2 3.87Å; V79-V90 PolarHBondContact N-O 2.84Å; V79-V90 PolarHBondContact O-N 3.23Å; V79-V93 HydrophobicContact CB-CG1 4.16Å; V79-V93 HydrophobicContact CG1-CG1 4.29Å; V79-V93 HydrophobicContact CG2-CG1 3.56Å
80	E	98.4	Very high	96.6	Very high	15 Å²	15	72.7 Å²	72.7	7%	0.07	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	116.2	168.4	-175.7	-179.1	125.7	0	0	109.3	F58 R59 R82 L87 V88 K89	F58-E80 CarbonylContact C-O 3.51Å; F58-E80 WeakPolarHBondContact CA-O 3.5Å; F58-E80 WeakPolarHBondContact CB-O 3.16Å; R59-E80 HydrophobicContact CG-CB 4.32Å; R59-E80 IonicContact CZ-OE1 3.3Å; R59-E80 IonicContact CZ-OE2 3.49Å; R59-E80 VanDerWaalsContact CZ-OE2 3.3Å; R59-E80 PolarHBondContact N-O 3.48Å; R59-E80 IonicContact NH1-OE1 3.43Å; R59-E80 PolarHBondContact NH1-OE1 2.9Å; R59-E80 IonicContact NH1-OE2 2.78Å; R59-E80 PolarHBondContact NH1-OE2 3.44Å; R59-E80 VanDerWaalsContact NH2-CD 3.33Å; R59-E80 IonicContact NH2-OE1 2.68Å; R59-E80 PolarHBondContact NH2-OE1 2.9Å; R59-E80 IonicContact NH2-OE2 3.48Å; R59-E80 PolarHBondContact NH2-OE2 2.96Å; R59-E80 PolarHBondContact O-N 3Å; E80-R82 IonicContact OE1-CZ 3.57Å; E80-R82 IonicContact OE1-NE 3.52Å; E80-R82 IonicContact OE1-NH2 2.77Å; E80-R82 PolarHBondContact OE1-NH2 3.14Å; E80-L87 HydrophobicContact CG-CD1 4.12Å; E80-L87 HydrophobicContact CG-CD2 3.81Å; E80-L87 HydrophobicContact CG-CG 3.75Å; E80-L87 WeakPolarHBondContact OE1-CD1 3.28Å; E80-V88 WeakPolarHBondContact CA-O 3.38Å; E80-K89 HydrophobicContact CG-CG 4.45Å
81	F	98.3	Very high	97	Very high	53 Å²	53	74.1 Å²	74.1	23%	0.232	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	136	166.7	-66.3	-88.4	0	0	0	109.4	V56 F58 V79 L87 V88 V90 V93	V56-F81 HydrophobicContact CG1-CB 4.26Å; V56-F81 HydrophobicContact CG1-CD1 4.02Å; F58-F81 HydrophobicContact CB-CD1 3.52Å; F58-F81 HydrophobicContact CB-CE1 3.74Å; F58-F81 HydrophobicContact CB-CG 4.14Å; F58-F81 HydrophobicContact CD1-CE1 4.3Å; F58-F81 HydrophobicContact CD2-CE1 4.49Å; F58-F81 HydrophobicContact CG-CD1 4.19Å; F58-F81 AromaticContact CG-CE1 3.94Å; F58-F81 HydrophobicContact CG-CE1 3.94Å; V79-F81 HydrophobicContact CB-CE2 4.17Å; V79-F81 HydrophobicContact CG1-CD2 3.93Å; V79-F81 HydrophobicContact CG1-CE2 3.5Å; V79-F81 HydrophobicContact CG1-CZ 3.83Å; F81-L87 WeakPolarHBondContact O-CA 3.45Å; F81-V88 HydrophobicContact CB-CB 4.39Å; F81-V88 PolarHBondContact N-O 2.69Å; F81-V88 PolarHBondContact O-N 3.01Å; F81-V90 HydrophobicContact CD2-CG2 4.31Å; F81-V90 HydrophobicContact CE2-CG2 3.88Å; F81-V93 HydrophobicContact CE2-CB 4.47Å; F81-V93 HydrophobicContact CE2-CG1 4.39Å; F81-V93 HydrophobicContact CE2-CG2 4.3Å; F81-V93 HydrophobicContact CZ-CG1 4.21Å; F81-V93 HydrophobicContact CZ-CG2 4.09Å
82	R	97.4	Very high	97.1	Very high	121 Å²	121	78.7 Å²	78.7	46%	0.457	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	118.3	-179.1	-175.7	178.1	-64.9	-111.8	1.4	110.3	N57 E80 E86	N57-R82 PolarHBondContact N-O 3.34Å; N57-R82 PolarHBondContact O-N 3.44Å; E80-R82 IonicContact OE1-CZ 3.57Å; E80-R82 IonicContact OE1-NE 3.52Å; E80-R82 IonicContact OE1-NH2 2.77Å; E80-R82 PolarHBondContact OE1-NH2 3.14Å; R82-E86 WeakPolarHBondContact CA-O 3.48Å
83	E	93.6	Very high	97.1	Very high	63 Å²	63	75.4 Å²	75.4	29%	0.294	39%	0.385	S	S	.	.			trans	-98.4	-173.5	162.9	-162.5	166.8	-150.1	0	0	109.1	N54 T85 E86	N54-E83 WeakPolarHBondContact CB-OE1 3.34Å; N54-E83 PolarHBondContact ND2-OE1 2.71Å; E83-T85 VanDerWaalsContact C-N 3.3Å; E83-T85 PolarHBondContact O-N 3.44Å; E83-E86 PolarHBondContact N-O 2.89Å
84	V	90.7	Very high	97.1	Very high	141 Å²	141	81.1 Å²	81.1	86%	0.855	41%	0.408	S	S	*	.	S	Bend	trans	-56.7	-43.6	-176.6	-178	0	0	0	0	111.9
85	T	90.1	Very high	97.1	Very high	126 Å²	126	80.4 Å²	80.4	77%	0.773	41%	0.406	S	S	*	.	S	Bend	trans	-119	-14	-175.5	50.1	0	0	0	0	113.6	E83	E83-T85 VanDerWaalsContact C-N 3.3Å; E83-T85 PolarHBondContact O-N 3.44Å
86	E	94.6	Very high	97.1	Very high	117 Å²	117	81.6 Å²	81.6	55%	0.547	41%	0.414	S	S	.	.			trans	-115	143.3	-171.1	-63.7	-167.8	-179.8	0	0	112.4	R82 E83	R82-E86 WeakPolarHBondContact CA-O 3.48Å; E83-E86 PolarHBondContact N-O 2.89Å
87	L	95.7	Very high	97	Very high	79 Å²	79	82.9 Å²	82.9	41%	0.414	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	119.9	176.3	-173.5	160.7	0	0	0	108.4	E80 F81 K89	E80-L87 HydrophobicContact CG-CD1 4.12Å; E80-L87 HydrophobicContact CG-CD2 3.81Å; E80-L87 HydrophobicContact CG-CG 3.75Å; E80-L87 WeakPolarHBondContact OE1-CD1 3.28Å; F81-L87 WeakPolarHBondContact O-CA 3.45Å; L87-K89 HydrophobicContact CD2-CD 4.22Å; L87-K89 HydrophobicContact CD2-CG 3.59Å
88	V	97.9	Very high	96.8	Very high	72 Å²	72	82.3 Å²	82.3	44%	0.436	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	126.3	179.2	-178.6	0	0	0	0	108.7	E80 F81 V90	E80-V88 WeakPolarHBondContact CA-O 3.38Å; F81-V88 HydrophobicContact CB-CB 4.39Å; F81-V88 PolarHBondContact N-O 2.69Å; F81-V88 PolarHBondContact O-N 3.01Å; V88-V90 HydrophobicContact CG1-CG1 4.26Å
89	K	98.1	Very high	96.4	Very high	154 Å²	154	79.6 Å²	79.6	67%	0.67	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.3	136.7	174.7	-63	-173.8	179.8	-179.8	0	110	V79 E80 L87	V79-K89 CarbonylContact O-C 3.59Å; V79-K89 WeakPolarHBondContact O-CA 3.38Å; E80-K89 HydrophobicContact CG-CG 4.45Å; L87-K89 HydrophobicContact CD2-CD 4.22Å; L87-K89 HydrophobicContact CD2-CG 3.59Å
90	V	98.3	Very high	95.7	Very high	49 Å²	49	81.7 Å²	81.7	30%	0.297	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	137	176.1	-62.7	0	0	0	0	110.5	V79 F81 V88 K92 V93	V79-V90 HydrophobicContact CB-CG2 3.87Å; V79-V90 PolarHBondContact N-O 2.84Å; V79-V90 PolarHBondContact O-N 3.23Å; F81-V90 HydrophobicContact CD2-CG2 4.31Å; F81-V90 HydrophobicContact CE2-CG2 3.88Å; V88-V90 HydrophobicContact CG1-CG1 4.26Å; V90-K92 PolarHBondContact O-N 2.68Å; V90-V93 HydrophobicContact CG2-CB 4.13Å
91	D	98.6	Very high	94.4	Very high	138 Å²	138	89 Å²	89	74%	0.738	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.3	-32.2	-179.1	-60.4	-16.9	0	0	0	111.8	N77 D78	N77-D91 CarbonylContact C-O 3.59Å; N77-D91 WeakPolarHBondContact CA-O 3.35Å; D78-D91 PolarHBondContact N-O 2.89Å
92	K	98.4	Very high	92.5	Very high	136 Å²	136	92.4 Å²	92.4	59%	0.591	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-153.4	136.8	-177.4	-165.8	172.9	-174.6	176.1	0	111.7	V75 L76 V90	V75-K92 HydrophobicContact CG1-CD 4.29Å; V75-K92 HydrophobicContact CG1-CG 3.98Å; L76-K92 CarbonylContact O-C 3.54Å; L76-K92 VanDerWaalsContact O-CA 3.3Å; L76-K92 WeakPolarHBondContact O-CA 3.32Å; V90-K92 PolarHBondContact O-N 2.68Å
93	V	98.6	Very high	90.5	Very high	33 Å²	33	91.5 Å²	91.5	20%	0.2	50%	0.497	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	144.3	175.4	70.4	0	0	0	0	111.3	V75 L76 V79 F81 V90 I95	V75-V93 VanDerWaalsContact CA-O 3.32Å; V75-V93 WeakPolarHBondContact CA-O 3.26Å; L76-V93 HydrophobicContact CB-CG1 3.99Å; L76-V93 HydrophobicContact CD1-CG1 4.39Å; L76-V93 PolarHBondContact N-O 3.07Å; L76-V93 PolarHBondContact O-N 3.43Å; V79-V93 HydrophobicContact CB-CG1 4.16Å; V79-V93 HydrophobicContact CG1-CG1 4.29Å; V79-V93 HydrophobicContact CG2-CG1 3.56Å; F81-V93 HydrophobicContact CE2-CB 4.47Å; F81-V93 HydrophobicContact CE2-CG1 4.39Å; F81-V93 HydrophobicContact CE2-CG2 4.3Å; F81-V93 HydrophobicContact CZ-CG1 4.21Å; F81-V93 HydrophobicContact CZ-CG2 4.09Å; V90-V93 HydrophobicContact CG2-CB 4.13Å; V93-I95 HydrophobicContact CG1-CG1 4.44Å
94	K	98.6	Very high	88.3	Confident	144 Å²	144	91.2 Å²	91.2	63%	0.626	51%	0.511	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.3	123	170.4	-178.2	-175.1	176.9	-174.4	0	109.1	T73 F74 V75 V96	T73-K94 HydrophobicContact CG2-CG 4.29Å; F74-K94 CarbonylContact O-C 3.56Å; F74-K94 VanDerWaalsContact O-CA 3.31Å; F74-K94 WeakPolarHBondContact O-CA 3.39Å; V75-K94 HydrophobicContact CG2-CG 4.47Å; K94-V96 HydrophobicContact CD-CG2 4.31Å; K94-V96 HydrophobicContact CG-CG2 4.22Å
95	I	98.4	Very high	85.8	Confident	42 Å²	42	88.7 Å²	88.7	22%	0.215	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	122.1	175.6	-56.5	178	0	0	0	108	F58 T73 F74 L76 V93	F58-I95 HydrophobicContact CE2-CD1 3.92Å; F58-I95 HydrophobicContact CZ-CD1 3.96Å; T73-I95 CarbonylContact C-O 3.49Å; T73-I95 VanDerWaalsContact CA-O 3.3Å; T73-I95 WeakPolarHBondContact CA-O 3.44Å; F74-I95 HydrophobicContact CB-CB 4.31Å; F74-I95 HydrophobicContact CD2-CB 4.33Å; F74-I95 HydrophobicContact CD2-CG2 4.39Å; F74-I95 PolarHBondContact N-O 2.78Å; F74-I95 PolarHBondContact O-N 3.48Å; L76-I95 HydrophobicContact CD1-CD1 3.83Å; L76-I95 HydrophobicContact CD1-CG1 4.27Å; V93-I95 HydrophobicContact CG1-CG1 4.44Å
96	V	98.2	Very high	83.4	Confident	50 Å²	50	90.7 Å²	90.7	30%	0.303	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	121.5	173	-174.5	0	0	0	0	108	L5 V71 W72 T73 K94	L5-V96 HydrophobicContact CD1-CB 4.15Å; L5-V96 HydrophobicContact CD1-CG1 3.65Å; L5-V96 HydrophobicContact CD2-CG1 4.22Å; V71-V96 HydrophobicContact CG1-CG1 3.6Å; W72-V96 CarbonylContact O-C 3.59Å; W72-V96 WeakPolarHBondContact O-CA 3.04Å; T73-V96 HydrophobicContact CG2-CG2 4.32Å; K94-V96 HydrophobicContact CD-CG2 4.31Å; K94-V96 HydrophobicContact CG-CG2 4.22Å
97	A	96.9	Very high	80.7	Confident	40 Å²	40	91.2 Å²	91.2	33%	0.331	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	120.7	-174.5	0	0	0	0	0	110.7	V71 W72	V71-A97 WeakPolarHBondContact CA-O 3.43Å; W72-A97 HydrophobicContact CB-CB 4.39Å; W72-A97 PolarHBondContact N-O 2.91Å; W72-A97 PolarHBondContact O-N 2.77Å
98	C	94.4	Very high	77.7	Confident	36 Å²	36	91.8 Å²	91.8	24%	0.243	53%	0.533	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	155.2	168.1	-61.1	0	0	0	0	110.2	Y3 G100	Y3-C98 HydrophobicContact CD1-CB 3.63Å; Y3-C98 HydrophobicContact CD2-CB 4.32Å; Y3-C98 HydrophobicContact CE1-CB 3.54Å; Y3-C98 HydrophobicContact CE2-CB 4.25Å; Y3-C98 HydrophobicContact CG-CB 4.05Å; C98-G100 PolarHBondContact O-N 2.77Å
99	D	90.3	Very high	74.6	Confident	61 Å²	61	101.1 Å²	101.1	33%	0.326	57%	0.572	S	S	.	*			trans	-58.8	126.6	174.9	-173.7	7.9	0	0	0	112	Y3 N70 K101	Y3-D99 PolarHBondContact OH-O 3.46Å; N70-D99 PolarHBondContact O-N 2.91Å; D99-K101 WeakPolarHBondContact OD1-CB 3.26Å; D99-K101 VanDerWaalsContact OD1-CG 3.26Å; D99-K101 WeakPolarHBondContact OD1-CG 3.36Å; D99-K101 PolarHBondContact OD1-N 2.81Å
100	G	84.1	Confident	73.4	Confident	45 Å²	45	98.5 Å²	98.5	46%	0.464	57%	0.567	S	S	.	*	S	Bend	trans	-82.7	-14.3	177.5	0	0	0	0	0	114.2	C98 N102 S103	C98-G100 PolarHBondContact O-N 2.77Å; G100-N102 VanDerWaalsContact C-N 3.29Å; G100-N102 PolarHBondContact O-N 2.91Å; G100-S103 PolarHBondContact O-N 3.49Å; G100-S103 VanDerWaalsContact O-N 3.11Å; G100-S103 PolarHBondContact O-OG 3.44Å
101	K	71.8	Confident	72.1	Confident	168 Å²	168	101.1 Å²	101.1	73%	0.73	58%	0.581	S	S	*	*	G	3₁₀ helix	trans	-62.8	-30.9	-169	-69.9	173.6	-178.4	179.8	0	114	D99 S103	D99-K101 WeakPolarHBondContact OD1-CB 3.26Å; D99-K101 VanDerWaalsContact OD1-CG 3.26Å; D99-K101 WeakPolarHBondContact OD1-CG 3.36Å; D99-K101 PolarHBondContact OD1-N 2.81Å; K101-S103 PolarHBondContact O-N 2.66Å
102	N	57.7	Low	70.6	Confident	126 Å²	126	99 Å²	99	67%	0.674	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-79.8	0.6	179.6	-79.4	-2.7	0	0	0	114.7	G100	G100-N102 VanDerWaalsContact C-N 3.29Å; G100-N102 PolarHBondContact O-N 2.91Å
103	S	54.8	Low	69	Low	101 Å²	101	96.8 Å²	96.8	71%	0.706	57%	0.571	S	S	*	*	G	3₁₀ helix	trans	-96	-6.1	177.2	66.7	0	0	0	0	113.9	G100 K101	G100-S103 PolarHBondContact O-N 3.49Å; G100-S103 VanDerWaalsContact O-N 3.11Å; G100-S103 PolarHBondContact O-OG 3.44Å; K101-S103 PolarHBondContact O-N 2.66Å
104	G	47.9	Very low	67.2	Low	57 Å²	57	100.8 Å²	100.8	59%	0.588	59%	0.594	S	S	*	*			trans	-127.4	8.6	-173	0	0	0	0	0	116.4	N106	G104-N106 PolarHBondContact O-N 3.34Å
105	S	38.3	Very low	65.1	Low	88 Å²	88	97.9 Å²	97.9	62%	0.615	59%	0.592	S	S	*	*			trans	-77.1	76.8	179.4	63.3	0	0	0	0	111.7
106	N	40.7	Very low	62.7	Low	168 Å²	168	101.9 Å²	101.9	90%	0.898	62%	0.619	S	S	*	*			trans	-120.7	38.7	151.6	-124.9	25.8	0	0	0	108.8	G104 A108	G104-N106 PolarHBondContact O-N 3.34Å; N106-A108 PolarHBondContact O-N 3.21Å
107	T	36	Very low	59.9	Low	129 Å²	129	105.9 Å²	105.9	79%	0.791	64%	0.644	S	S	*	*			trans	-82.4	106	161.5	35.9	0	0	0	0	107.2
108	A	34.5	Very low	56.9	Low	91 Å²	91	111.4 Å²	111.4	75%	0.752	67%	0.67	S	S	*	*			trans	-51.1	151.3	167	0	0	0	0	0	111.5	N106	N106-A108 PolarHBondContact O-N 3.21Å
109	E	31.8	Very low	53.4	Low	267 Å²	267	118.3 Å²	118.3	100%	1.248	71%	0.708	S	S	*	*			trans	-50.6	0	149.8	-72.2	179.6	146.3	0	0	111.3

Retrieved 109 of 109 residues in 29.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).