A0A3P9NAA2_POERE Loading...

General transcription and DNA repair factor IIH subunit TFB5

In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape.

AlphaFold DB , UniProt , Accession A0A3P9NAA2, Species POERE (Poecilia reticulata, Guppy), Gene n/a, Length 71 aa.

						>A0A3P9NAA2_POERE|A0A3P9NAA2
MVNVHKGVLVECDPAMKQFLLYLDETMALGKKFILKDLDDTHVFILAEVVQILQERVGELMDQNSFPITQK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.8	Very low	63.7	Low	240 Å²	240	114.7 Å²	114.7	100%	1.182	60%	0.604	S	S	*	*				0	115.2	0	-73.3	169.4	174.9	0	0	106.8
2	V	35.1	Very low	64.5	Low	133 Å²	133	108.4 Å²	108.4	81%	0.806	58%	0.576	S	S	*	*			trans	-100.8	109.8	-174.9	-68.9	0	0	0	0	109.1	V4	V2-V4 HydrophobicContact CG2-CG2 4.48Å; V2-V4 PolarHBondContact O-N 3.26Å
3	N	49	Very low	65.6	Low	134 Å²	134	109.4 Å²	109.4	72%	0.717	58%	0.581	S	S	*	*			trans	-82.3	98.9	172.4	-103.6	58.8	0	0	0	108.1	H5	N3-H5 PolarHBondContact ND2-NE2 3.27Å; N3-H5 PolarHBondContact O-N 3.27Å
4	V	45.5	Very low	66.5	Low	125 Å²	125	106.4 Å²	106.4	76%	0.758	57%	0.571	S	S	*	*			trans	-86.4	90.1	173.5	-172.3	0	0	0	0	107.8	V2	V2-V4 HydrophobicContact CG2-CG2 4.48Å; V2-V4 PolarHBondContact O-N 3.26Å
5	H	63	Low	67.1	Low	101 Å²	101	104.5 Å²	104.5	47%	0.468	58%	0.576	S	S	.	*			trans	-91.7	124.2	167.5	-78	-82.5	0	0	0	109.3	N3 G7 L35	N3-H5 PolarHBondContact ND2-NE2 3.27Å; N3-H5 PolarHBondContact O-N 3.27Å; H5-G7 PolarHBondContact O-N 2.83Å; H5-L35 HydrophobicContact CB-CD1 4.14Å; H5-L35 HydrophobicContact CB-CD2 4.36Å
6	K	66.9	Low	67.6	Low	192 Å²	192	102.6 Å²	102.6	84%	0.835	56%	0.563	S	S	*	*			trans	-73	110.2	169.3	-67.2	-176.2	-179.9	-177.5	0	107.7
7	G	78.1	Confident	68.2	Low	25 Å²	25	99.5 Å²	99.5	26%	0.258	54%	0.542	S	S	.	.			trans	-145.8	175.5	-179.2	0	0	0	0	0	110.9	H5 I45	H5-G7 PolarHBondContact O-N 2.83Å; G7-I45 CarbonylContact C-O 3.5Å; G7-I45 VanDerWaalsContact CA-O 3.23Å; G7-I45 WeakPolarHBondContact CA-O 3.23Å
8	V	80.8	Confident	68.6	Low	57 Å²	57	101.7 Å²	101.7	35%	0.345	55%	0.549	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	130	173.8	175.7	0	0	0	0	107.8	V10 I45 A47 V50	V8-V10 HydrophobicContact CG1-CG2 3.96Å; V8-I45 PolarHBondContact N-O 3.21Å; V8-I45 PolarHBondContact O-N 3.26Å; V8-A47 HydrophobicContact CG2-CB 3.62Å; V8-V50 HydrophobicContact CB-CG2 3.99Å; V8-V50 HydrophobicContact CG1-CG2 4.43Å; V8-V50 HydrophobicContact CG2-CG2 4.23Å
9	L	82.2	Confident	69	Low	85 Å²	85	99.8 Å²	99.8	45%	0.445	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	120.2	165.4	-175.2	80.7	0	0	0	107.4	L38 H42 F44	L9-L38 HydrophobicContact CD1-CD1 3.37Å; L9-H42 HydrophobicContact CD1-CB 4.48Å; L9-F44 HydrophobicContact CB-CD2 3.97Å; L9-F44 HydrophobicContact CB-CE2 3.96Å; L9-F44 HydrophobicContact CD1-CD2 3.73Å; L9-F44 HydrophobicContact CD1-CE2 4.35Å; L9-F44 HydrophobicContact CG-CD2 4.5Å
10	V	78.1	Confident	69.4	Low	29 Å²	29	95.2 Å²	95.2	18%	0.176	51%	0.51	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	120.6	174.9	177.2	0	0	0	0	107.7	V8 C12 V43 I45	V8-V10 HydrophobicContact CG1-CG2 3.96Å; V10-C12 HydrophobicContact CG1-CB 4.38Å; V10-C12 WeakPolarHBondContact CG1-SG 3.49Å; V10-V43 HydrophobicContact CB-CG1 4.05Å; V10-V43 PolarHBondContact N-O 3.35Å; V10-V43 PolarHBondContact O-N 2.8Å; V10-I45 HydrophobicContact CG2-CD1 3.87Å; V10-I45 HydrophobicContact CG2-CG1 3.78Å
11	E	82.1	Confident	69.7	Low	141 Å²	141	94.3 Å²	94.3	66%	0.659	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.9	118.7	171.1	-166.3	176.6	116.2	0	0	108.2	T41 H42	E11-T41 CarbonylContact C-O 3.5Å; E11-T41 WeakPolarHBondContact CA-O 3.13Å; E11-H42 VanDerWaalsContact CD-NE2 3.27Å; E11-H42 WeakPolarHBondContact CG-NE2 3.29Å; E11-H42 IonicContact OE2-CD2 3.88Å; E11-H42 IonicContact OE2-CE1 3.51Å; E11-H42 IonicContact OE2-NE2 3.68Å; E11-H42 PolarHBondContact OE2-NE2 3.01Å
12	C	73.1	Confident	71.5	Confident	39 Å²	39	89.4 Å²	89.4	26%	0.264	47%	0.474	S	S	.	.			trans	-150.8	158.7	-175.8	-75.2	0	0	0	0	111.5	V10 M16 T41	V10-C12 HydrophobicContact CG1-CB 4.38Å; V10-C12 WeakPolarHBondContact CG1-SG 3.49Å; C12-M16 HydrophobicContact CB-CB 3.71Å; C12-M16 HydrophobicContact CB-CG 3.93Å; C12-T41 PolarHBondContact N-O 2.87Å; C12-T41 CarbonylContact O-C 3.49Å; C12-T41 WeakPolarHBondContact O-CA 3.37Å
13	D	79.3	Confident	73.3	Confident	121 Å²	121	83.1 Å²	83.1	65%	0.647	44%	0.436	S	S	*	.			trans	-63.8	156	174	-80	-88.6	0	0	0	114	A15 M16 K17	D13-A15 PolarHBondContact O-N 2.71Å; D13-A15 VanDerWaalsContact O-N 3.08Å; D13-M16 WeakPolarHBondContact O-CA 3.26Å; D13-M16 VanDerWaalsContact O-CB 3.29Å; D13-M16 WeakPolarHBondContact O-CB 3.36Å; D13-M16 PolarHBondContact O-N 2.85Å; D13-K17 PolarHBondContact O-N 3.04Å; D13-K17 VanDerWaalsContact O-N 3.17Å
14	P	77.7	Confident	74.4	Confident	68 Å²	68	77.6 Å²	77.6	44%	0.442	41%	0.406	S	S	.	.	H	α-helix	trans	-58.3	-26.8	-179	20.2	-32.4	0	0	0	113.8	M16 K17 Q18	P14-M16 VanDerWaalsContact C-N 3.35Å; P14-K17 WeakPolarHBondContact O-CB 3.02Å; P14-K17 PolarHBondContact O-N 3.18Å; P14-Q18 PolarHBondContact O-N 3.49Å; P14-Q18 VanDerWaalsContact O-N 3.09Å
15	A	76.4	Confident	75.7	Confident	78 Å²	78	79.4 Å²	79.4	65%	0.645	41%	0.407	S	S	*	.	H	α-helix	trans	-63.4	-40.6	172.3	0	0	0	0	0	112.1	D13 Q18 F19	D13-A15 PolarHBondContact O-N 2.71Å; D13-A15 VanDerWaalsContact O-N 3.08Å; A15-Q18 WeakPolarHBondContact O-CB 3.4Å; A15-Q18 PolarHBondContact O-N 3.4Å; A15-F19 PolarHBondContact O-N 3.42Å; A15-F19 VanDerWaalsContact O-N 3.1Å
16	M	74	Confident	75.8	Confident	74 Å²	74	78 Å²	78	37%	0.365	41%	0.405	S	S	.	.	H	α-helix	trans	-71.1	-35.3	177.9	-155.4	70.1	162.6	0	0	111.2	C12 D13 P14 Q18 F19 L20 V57	C12-M16 HydrophobicContact CB-CB 3.71Å; C12-M16 HydrophobicContact CB-CG 3.93Å; D13-M16 WeakPolarHBondContact O-CA 3.26Å; D13-M16 VanDerWaalsContact O-CB 3.29Å; D13-M16 WeakPolarHBondContact O-CB 3.36Å; D13-M16 PolarHBondContact O-N 2.85Å; P14-M16 VanDerWaalsContact C-N 3.35Å; M16-Q18 VanDerWaalsContact C-N 3.34Å; M16-Q18 PolarHBondContact O-N 3.1Å; M16-F19 CarbonylContact O-C 3.6Å; M16-F19 WeakPolarHBondContact O-CB 3.25Å; M16-F19 PolarHBondContact O-N 2.75Å; M16-F19 VanDerWaalsContact O-N 3.16Å; M16-L20 VanDerWaalsContact O-CG 3.28Å; M16-L20 WeakPolarHBondContact O-CG 3.48Å; M16-L20 PolarHBondContact O-N 2.94Å; M16-V57 HydrophobicContact CE-CG1 4.27Å
17	K	77.6	Confident	75.5	Confident	49 Å²	49	75 Å²	75	21%	0.213	40%	0.396	C	S	.	.	H	α-helix	trans	-58.2	-45.8	170.9	175.6	-177.8	170.3	-177.5	0	111.4	D13 P14 F19 L20 L21 D40	D13-K17 PolarHBondContact O-N 3.04Å; D13-K17 VanDerWaalsContact O-N 3.17Å; P14-K17 WeakPolarHBondContact O-CB 3.02Å; P14-K17 PolarHBondContact O-N 3.18Å; K17-F19 VanDerWaalsContact C-N 3.26Å; K17-F19 PolarHBondContact O-N 3.31Å; K17-L20 WeakPolarHBondContact O-CB 3.44Å; K17-L20 PolarHBondContact O-N 3.45Å; K17-L21 HydrophobicContact CG-CD1 4.19Å; K17-L21 PolarHBondContact O-N 2.87Å; K17-D40 IonicContact NZ-OD1 2.71Å; K17-D40 PolarHBondContact NZ-OD1 3.19Å
18	Q	76.7	Confident	74.4	Confident	140 Å²	140	75.6 Å²	75.6	65%	0.654	40%	0.399	S	S	*	.	H	α-helix	trans	-61.3	-38.5	175.8	-149.8	97	-91.9	0	0	111.4	P14 A15 M16 L21 Y22	P14-Q18 PolarHBondContact O-N 3.49Å; P14-Q18 VanDerWaalsContact O-N 3.09Å; A15-Q18 WeakPolarHBondContact O-CB 3.4Å; A15-Q18 PolarHBondContact O-N 3.4Å; M16-Q18 VanDerWaalsContact C-N 3.34Å; M16-Q18 PolarHBondContact O-N 3.1Å; Q18-L21 PolarHBondContact O-N 2.8Å; Q18-Y22 WeakPolarHBondContact O-CB 3.1Å; Q18-Y22 PolarHBondContact O-N 3.36Å
19	F	75.6	Confident	73.2	Confident	65 Å²	65	75.2 Å²	75.2	29%	0.285	39%	0.394	S	S	.	.	H	α-helix	trans	-66.1	-41.2	175.9	-160.8	-100.9	0	0	0	112.4	A15 M16 K17 Y22 L23 V57 L60	A15-F19 PolarHBondContact O-N 3.42Å; A15-F19 VanDerWaalsContact O-N 3.1Å; M16-F19 CarbonylContact O-C 3.6Å; M16-F19 WeakPolarHBondContact O-CB 3.25Å; M16-F19 PolarHBondContact O-N 2.75Å; M16-F19 VanDerWaalsContact O-N 3.16Å; K17-F19 VanDerWaalsContact C-N 3.26Å; K17-F19 PolarHBondContact O-N 3.31Å; F19-Y22 WeakPolarHBondContact O-CB 3.31Å; F19-Y22 PolarHBondContact O-N 2.97Å; F19-L23 HydrophobicContact CD1-CD1 3.64Å; F19-L23 HydrophobicContact CD1-CG 4.24Å; F19-L23 HydrophobicContact CE1-CD1 3.57Å; F19-L23 HydrophobicContact CE1-CG 4.1Å; F19-L23 WeakPolarHBondContact O-CB 3.26Å; F19-L23 WeakPolarHBondContact O-CG 3.4Å; F19-L23 PolarHBondContact O-N 3.26Å; F19-V57 HydrophobicContact CD1-CG1 4.38Å; F19-V57 HydrophobicContact CD1-CG2 4.01Å; F19-V57 HydrophobicContact CE1-CB 4.12Å; F19-V57 HydrophobicContact CE1-CG1 3.88Å; F19-V57 HydrophobicContact CE1-CG2 3.67Å; F19-L60 HydrophobicContact CZ-CB 4.36Å
20	L	76.2	Confident	72.1	Confident	8 Å²	8	73.6 Å²	73.6	4%	0.042	40%	0.399	C	S	.	.	H	α-helix	trans	-63.2	-42.7	174.6	-72.8	161.8	0	0	0	111.6	M16 K17 L23 D24 F33 I34 V43 L53	M16-L20 VanDerWaalsContact O-CG 3.28Å; M16-L20 WeakPolarHBondContact O-CG 3.48Å; M16-L20 PolarHBondContact O-N 2.94Å; K17-L20 WeakPolarHBondContact O-CB 3.44Å; K17-L20 PolarHBondContact O-N 3.45Å; L20-L23 PolarHBondContact O-N 2.88Å; L20-D24 WeakPolarHBondContact O-CB 3.21Å; L20-D24 PolarHBondContact O-N 3Å; L20-F33 HydrophobicContact CD2-CE2 3.91Å; L20-F33 HydrophobicContact CD2-CZ 4.48Å; L20-F33 WeakPolarHBondContact O-CZ 3.38Å; L20-I34 HydrophobicContact CB-CD1 4.35Å; L20-V43 HydrophobicContact CD1-CG1 3.91Å; L20-L53 HydrophobicContact CD2-CD1 3.62Å; L20-L53 HydrophobicContact CD2-CD2 3.39Å; L20-L53 HydrophobicContact CD2-CG 4.14Å
21	L	76.8	Confident	71.5	Confident	77 Å²	77	80.2 Å²	80.2	40%	0.403	43%	0.425	S	S	.	.	H	α-helix	trans	-62	-43.1	173.2	-81	158.9	0	0	0	111.6	K17 Q18 L23 D24 E25 I34	K17-L21 HydrophobicContact CG-CD1 4.19Å; K17-L21 PolarHBondContact O-N 2.87Å; Q18-L21 PolarHBondContact O-N 2.8Å; L21-L23 VanDerWaalsContact C-N 3.34Å; L21-L23 PolarHBondContact O-N 3.29Å; L21-D24 WeakPolarHBondContact O-CB 3.26Å; L21-D24 PolarHBondContact O-N 3.11Å; L21-E25 WeakPolarHBondContact O-CB 3.28Å; L21-E25 PolarHBondContact O-N 2.75Å; L21-I34 HydrophobicContact CD2-CD1 4.24Å; L21-I34 HydrophobicContact CG-CD1 4.3Å
22	Y	76.4	Confident	71.1	Confident	136 Å²	136	81.3 Å²	81.3	53%	0.533	43%	0.427	S	S	.	.	H	α-helix	trans	-61.9	-41.2	175.6	179.9	-101	0	0	0	112	Q18 F19 E25 T26	Q18-Y22 WeakPolarHBondContact O-CB 3.1Å; Q18-Y22 PolarHBondContact O-N 3.36Å; F19-Y22 WeakPolarHBondContact O-CB 3.31Å; F19-Y22 PolarHBondContact O-N 2.97Å; Y22-E25 PolarHBondContact O-N 2.86Å; Y22-T26 HydrophobicContact CE1-CG2 4.14Å; Y22-T26 HydrophobicContact CE2-CG2 4.45Å; Y22-T26 PolarHBondContact O-N 2.82Å; Y22-T26 PolarHBondContact O-OG1 3.23Å
23	L	73.3	Confident	71.3	Confident	2 Å²	2	79.5 Å²	79.5	1%	0.01	42%	0.415	C	S	.	.	H	α-helix	trans	-67.3	-36.2	175	-78.8	170.4	0	0	0	113.3	F19 L20 L21 E25 T26 M27 A28 F33 L53 V57 L60	F19-L23 HydrophobicContact CD1-CD1 3.64Å; F19-L23 HydrophobicContact CD1-CG 4.24Å; F19-L23 HydrophobicContact CE1-CD1 3.57Å; F19-L23 HydrophobicContact CE1-CG 4.1Å; F19-L23 WeakPolarHBondContact O-CB 3.26Å; F19-L23 WeakPolarHBondContact O-CG 3.4Å; F19-L23 PolarHBondContact O-N 3.26Å; L20-L23 PolarHBondContact O-N 2.88Å; L21-L23 VanDerWaalsContact C-N 3.34Å; L21-L23 PolarHBondContact O-N 3.29Å; L23-E25 VanDerWaalsContact C-N 3.35Å; L23-T26 VanDerWaalsContact CA-OG1 3.3Å; L23-T26 WeakPolarHBondContact CA-OG1 3.44Å; L23-T26 PolarHBondContact O-OG1 3.4Å; L23-M27 PolarHBondContact O-N 3.14Å; L23-A28 HydrophobicContact CD2-CB 4Å; L23-A28 PolarHBondContact O-N 3.41Å; L23-F33 HydrophobicContact CB-CE1 4.29Å; L23-F33 HydrophobicContact CB-CZ 3.94Å; L23-L53 HydrophobicContact CD1-CD1 4.17Å; L23-L53 HydrophobicContact CD1-CD2 4.36Å; L23-L53 HydrophobicContact CD1-CG 4.03Å; L23-V57 HydrophobicContact CD1-CG2 3.58Å; L23-L60 HydrophobicContact CD2-CD1 3.64Å
24	D	72	Confident	71.4	Confident	17 Å²	17	75.7 Å²	75.7	9%	0.091	39%	0.394	C	S	.	.	H	α-helix	trans	-63.8	-42.7	172.4	-166.7	-97.3	0	0	0	110.3	L20 L21 M27 K32 F33 I34	L20-D24 WeakPolarHBondContact O-CB 3.21Å; L20-D24 PolarHBondContact O-N 3Å; L21-D24 WeakPolarHBondContact O-CB 3.26Å; L21-D24 PolarHBondContact O-N 3.11Å; D24-M27 PolarHBondContact O-N 3.15Å; D24-K32 WeakPolarHBondContact OD1-CD 3.17Å; D24-K32 WeakPolarHBondContact OD1-CE 3.3Å; D24-K32 WeakPolarHBondContact OD1-CG 2.93Å; D24-K32 WeakPolarHBondContact OD2-CA 3.4Å; D24-K32 WeakPolarHBondContact OD2-CB 3.13Å; D24-F33 HydrophobicContact CB-CE1 4.12Å; D24-F33 HydrophobicContact CB-CZ 4.09Å; D24-F33 PolarHBondContact OD2-N 3.42Å; D24-F33 VanDerWaalsContact OD2-N 3.14Å; D24-I34 HydrophobicContact CB-CD1 4.22Å
25	E	72.7	Confident	71.5	Confident	163 Å²	163	75.1 Å²	75.1	76%	0.762	39%	0.387	S	S	*	.	H	α-helix	trans	-71.7	-39.6	-180	-159.3	-178.8	122.9	0	0	112.8	L21 Y22 L23 M27	L21-E25 WeakPolarHBondContact O-CB 3.28Å; L21-E25 PolarHBondContact O-N 2.75Å; Y22-E25 PolarHBondContact O-N 2.86Å; L23-E25 VanDerWaalsContact C-N 3.35Å; E25-M27 PolarHBondContact O-N 2.75Å; E25-M27 VanDerWaalsContact O-N 3.13Å
26	T	65.8	Low	71.5	Confident	72 Å²	72	78 Å²	78	44%	0.442	39%	0.385	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.8	-5.5	172.9	29.3	0	0	0	0	112.8	Y22 L23 A28	Y22-T26 HydrophobicContact CE1-CG2 4.14Å; Y22-T26 HydrophobicContact CE2-CG2 4.45Å; Y22-T26 PolarHBondContact O-N 2.82Å; Y22-T26 PolarHBondContact O-OG1 3.23Å; L23-T26 VanDerWaalsContact CA-OG1 3.3Å; L23-T26 WeakPolarHBondContact CA-OG1 3.44Å; L23-T26 PolarHBondContact O-OG1 3.4Å; T26-A28 PolarHBondContact O-N 2.85Å; T26-A28 VanDerWaalsContact O-N 3.12Å
27	M	60.3	Low	71.6	Confident	128 Å²	128	79.6 Å²	79.6	63%	0.631	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.9	39.9	-177.4	-94.7	-174.6	-102.1	0	0	111.1	L23 D24 E25 L29 G30	L23-M27 PolarHBondContact O-N 3.14Å; D24-M27 PolarHBondContact O-N 3.15Å; E25-M27 PolarHBondContact O-N 2.75Å; E25-M27 VanDerWaalsContact O-N 3.13Å; M27-L29 PolarHBondContact O-N 3.14Å; M27-G30 PolarHBondContact O-N 2.85Å
28	A	56.1	Low	71.7	Confident	39 Å²	39	81.7 Å²	81.7	32%	0.322	41%	0.409	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.8	-19	-177.5	0	0	0	0	0	112.9	L23 T26	L23-A28 HydrophobicContact CD2-CB 4Å; L23-A28 PolarHBondContact O-N 3.41Å; T26-A28 PolarHBondContact O-N 2.85Å; T26-A28 VanDerWaalsContact O-N 3.12Å
29	L	56	Low	71.8	Confident	48 Å²	48	80 Å²	80	25%	0.251	40%	0.404	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.3	0.5	179.3	-78.2	148.4	0	0	0	114.1	M27 K31 F33 V49 I52	M27-L29 PolarHBondContact O-N 3.14Å; L29-K31 PolarHBondContact O-N 3.25Å; L29-K31 VanDerWaalsContact O-N 3.14Å; L29-F33 HydrophobicContact CD1-CD1 3.72Å; L29-F33 HydrophobicContact CD1-CE1 4.02Å; L29-F33 HydrophobicContact CD1-CG 4.44Å; L29-V49 HydrophobicContact CD1-CB 4.13Å; L29-I52 HydrophobicContact CD2-CB 3.74Å; L29-I52 HydrophobicContact CD2-CD1 3.59Å; L29-I52 HydrophobicContact CD2-CG1 4.27Å; L29-I52 HydrophobicContact CD2-CG2 3.44Å; L29-I52 VanDerWaalsContact CD2-CG2 3.44Å; L29-I52 HydrophobicContact CG-CG2 4.3Å
30	G	57.9	Low	71.7	Confident	52 Å²	52	81.9 Å²	81.9	54%	0.536	42%	0.417	S	S	.	.	S	Bend	trans	68.8	2.4	-177.6	0	0	0	0	0	115.7	M27	M27-G30 PolarHBondContact O-N 2.85Å
31	K	66.5	Low	71.8	Confident	168 Å²	168	84.3 Å²	84.3	73%	0.73	43%	0.432	S	S	*	.	S	Bend	trans	-147	150.1	174.5	-74.7	-172.5	-178.6	174.5	0	111.4	L29 F33	L29-K31 PolarHBondContact O-N 3.25Å; L29-K31 VanDerWaalsContact O-N 3.14Å; K31-F33 PolarHBondContact O-N 2.78Å
32	K	72.1	Confident	72.1	Confident	163 Å²	163	82.8 Å²	82.8	71%	0.709	42%	0.423	S	S	*	.			trans	-65	126.9	169.3	-64.3	-161.7	169.1	-167.1	0	110.2	D24	D24-K32 WeakPolarHBondContact OD1-CD 3.17Å; D24-K32 WeakPolarHBondContact OD1-CE 3.3Å; D24-K32 WeakPolarHBondContact OD1-CG 2.93Å; D24-K32 WeakPolarHBondContact OD2-CA 3.4Å; D24-K32 WeakPolarHBondContact OD2-CB 3.13Å
33	F	77.5	Confident	72.4	Confident	2 Å²	2	76.8 Å²	76.8	1%	0.009	40%	0.4	C	S	.	.			trans	-112.9	-13.6	-176.6	57.5	-98.7	0	0	0	113.7	L20 L23 D24 L29 K31 L35 I45 L46 V49 L53	L20-F33 HydrophobicContact CD2-CE2 3.91Å; L20-F33 HydrophobicContact CD2-CZ 4.48Å; L20-F33 WeakPolarHBondContact O-CZ 3.38Å; L23-F33 HydrophobicContact CB-CE1 4.29Å; L23-F33 HydrophobicContact CB-CZ 3.94Å; D24-F33 HydrophobicContact CB-CE1 4.12Å; D24-F33 HydrophobicContact CB-CZ 4.09Å; D24-F33 PolarHBondContact OD2-N 3.42Å; D24-F33 VanDerWaalsContact OD2-N 3.14Å; L29-F33 HydrophobicContact CD1-CD1 3.72Å; L29-F33 HydrophobicContact CD1-CE1 4.02Å; L29-F33 HydrophobicContact CD1-CG 4.44Å; K31-F33 PolarHBondContact O-N 2.78Å; F33-L35 PolarHBondContact O-N 2.81Å; F33-I45 HydrophobicContact CD2-CB 4.39Å; F33-I45 HydrophobicContact CD2-CG2 4Å; F33-I45 HydrophobicContact CE2-CG2 4.49Å; F33-I45 VanDerWaalsContact O-CA 3.25Å; F33-I45 WeakPolarHBondContact O-CA 3.47Å; F33-I45 WeakPolarHBondContact O-CB 3.48Å; F33-L46 PolarHBondContact O-N 3.24Å; F33-V49 HydrophobicContact CB-CB 3.89Å; F33-V49 HydrophobicContact CB-CG1 3.82Å; F33-V49 HydrophobicContact CB-CG2 3.3Å; F33-V49 HydrophobicContact CD2-CG2 4.03Å; F33-V49 HydrophobicContact CG-CB 4.39Å; F33-V49 HydrophobicContact CG-CG2 3.79Å; F33-L53 HydrophobicContact CD1-CD1 4.35Å; F33-L53 HydrophobicContact CD2-CD1 3.75Å; F33-L53 HydrophobicContact CE1-CD1 3.79Å; F33-L53 HydrophobicContact CE2-CD1 3.12Å; F33-L53 HydrophobicContact CG-CD1 4.35Å; F33-L53 HydrophobicContact CZ-CD1 3.15Å
34	I	81	Confident	72.9	Confident	40 Å²	40	79.4 Å²	79.4	21%	0.205	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.6	109	166.8	-57.7	177.7	0	0	0	107.7	L20 L21 D24 V43 I45	L20-I34 HydrophobicContact CB-CD1 4.35Å; L21-I34 HydrophobicContact CD2-CD1 4.24Å; L21-I34 HydrophobicContact CG-CD1 4.3Å; D24-I34 HydrophobicContact CB-CD1 4.22Å; I34-V43 HydrophobicContact CG2-CG2 3.73Å; I34-I45 HydrophobicContact CB-CG2 4.45Å; I34-I45 HydrophobicContact CG1-CG2 4.08Å
35	L	80.4	Confident	73.3	Confident	56 Å²	56	78.7 Å²	78.7	29%	0.293	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	-46.6	175.5	-70.2	164.9	0	0	0	110.2	H5 F33 F44 L46	H5-L35 HydrophobicContact CB-CD1 4.14Å; H5-L35 HydrophobicContact CB-CD2 4.36Å; F33-L35 PolarHBondContact O-N 2.81Å; L35-F44 WeakPolarHBondContact CA-O 3.48Å; L35-F44 HydrophobicContact CB-CD1 4.22Å; L35-F44 WeakPolarHBondContact CB-O 3.22Å; L35-F44 HydrophobicContact CD1-CD1 3.76Å; L35-F44 HydrophobicContact CD1-CE1 4.18Å; L35-F44 PolarHBondContact N-O 3.17Å; L35-L46 HydrophobicContact CD1-CD2 3.99Å; L35-L46 HydrophobicContact CD1-CG 3.93Å; L35-L46 HydrophobicContact CD2-CD1 4.41Å; L35-L46 HydrophobicContact CD2-CD2 4.06Å; L35-L46 HydrophobicContact CD2-CG 3.94Å; L35-L46 HydrophobicContact CG-CD2 4.34Å; L35-L46 HydrophobicContact CG-CG 3.94Å
36	K	76.9	Confident	73.8	Confident	138 Å²	138	73.5 Å²	73.5	60%	0.6	39%	0.385	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-160.7	130.5	-176.9	-160.7	157.6	-176.2	174	0	111.3	F44	K36-F44 HydrophobicContact CB-CB 4.19Å; K36-F44 PolarHBondContact N-O 3.45Å; K36-F44 VanDerWaalsContact N-O 3.15Å; K36-F44 WeakPolarHBondContact O-CA 3.41Å; K36-F44 VanDerWaalsContact O-CB 3.26Å; K36-F44 WeakPolarHBondContact O-CB 3.46Å; K36-F44 PolarHBondContact O-N 3.08Å
37	D	76.4	Confident	74.2	Confident	108 Å²	108	72.4 Å²	72.4	58%	0.578	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.2	128.2	161.7	57.4	-58.4	0	0	0	109.1
38	L	79	Confident	74.9	Confident	94 Å²	94	74.2 Å²	74.2	49%	0.492	39%	0.39	S	S	.	.			trans	-96.9	-48.4	173.4	-78.7	148.1	0	0	0	109.1	L9 H42 F44	L9-L38 HydrophobicContact CD1-CD1 3.37Å; L38-H42 HydrophobicContact CB-CB 3.98Å; L38-H42 PolarHBondContact N-O 2.92Å; L38-F44 HydrophobicContact CD1-CB 4.47Å; L38-F44 HydrophobicContact CD1-CD2 4.37Å
39	D	79.5	Confident	75.6	Confident	105 Å²	105	73.3 Å²	73.3	56%	0.561	38%	0.381	S	S	*	.	S	Bend	trans	-152.1	178.5	-178.4	-77.9	-77.6	0	0	0	110.9	T41 H42	D39-T41 PolarHBondContact O-N 2.8Å; D39-H42 HydrophobicContact CB-CB 4.25Å; D39-H42 PolarHBondContact N-O 3.26Å; D39-H42 VanDerWaalsContact N-O 3.11Å; D39-H42 PolarHBondContact O-N 3.43Å; D39-H42 VanDerWaalsContact O-O 3.1Å
40	D	73.5	Confident	76.5	Confident	103 Å²	103	72.3 Å²	72.3	55%	0.551	38%	0.376	S	S	*	.	S	Bend	trans	-62	-25.2	175.6	-87.9	-60.1	0	0	0	113.9	K17	K17-D40 IonicContact NZ-OD1 2.71Å; K17-D40 PolarHBondContact NZ-OD1 3.19Å
41	T	78.6	Confident	77.3	Confident	59 Å²	59	76.6 Å²	76.6	36%	0.362	38%	0.383	S	S	.	.	S	Bend	trans	-104.5	-7.6	177.3	50.5	0	0	0	0	114.4	E11 C12 D39	E11-T41 CarbonylContact C-O 3.5Å; E11-T41 WeakPolarHBondContact CA-O 3.13Å; C12-T41 PolarHBondContact N-O 2.87Å; C12-T41 CarbonylContact O-C 3.49Å; C12-T41 WeakPolarHBondContact O-CA 3.37Å; D39-T41 PolarHBondContact O-N 2.8Å
42	H	82.5	Confident	77.7	Confident	45 Å²	45	72.1 Å²	72.1	21%	0.208	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	116.8	-171.3	-63.3	86	0	0	0	110.8	L9 E11 L38 D39	L9-H42 HydrophobicContact CD1-CB 4.48Å; E11-H42 VanDerWaalsContact CD-NE2 3.27Å; E11-H42 WeakPolarHBondContact CG-NE2 3.29Å; E11-H42 IonicContact OE2-CD2 3.88Å; E11-H42 IonicContact OE2-CE1 3.51Å; E11-H42 IonicContact OE2-NE2 3.68Å; E11-H42 PolarHBondContact OE2-NE2 3.01Å; L38-H42 HydrophobicContact CB-CB 3.98Å; L38-H42 PolarHBondContact N-O 2.92Å; D39-H42 HydrophobicContact CB-CB 4.25Å; D39-H42 PolarHBondContact N-O 3.26Å; D39-H42 VanDerWaalsContact N-O 3.11Å; D39-H42 PolarHBondContact O-N 3.43Å; D39-H42 VanDerWaalsContact O-O 3.1Å
43	V	81.9	Confident	77.8	Confident	11 Å²	11	65 Å²	65	7%	0.067	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	139.2	177	77.5	0	0	0	0	110.6	V10 L20 I34 I45	V10-V43 HydrophobicContact CB-CG1 4.05Å; V10-V43 PolarHBondContact N-O 3.35Å; V10-V43 PolarHBondContact O-N 2.8Å; L20-V43 HydrophobicContact CD1-CG1 3.91Å; I34-V43 HydrophobicContact CG2-CG2 3.73Å; V43-I45 HydrophobicContact CG1-CG2 4.18Å; V43-I45 HydrophobicContact CG2-CG2 4.28Å
44	F	83.5	Confident	77.5	Confident	56 Å²	56	71.5 Å²	71.5	25%	0.246	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	118.3	177.5	-146.6	-101.1	0	0	0	108.9	L9 L35 K36 L38	L9-F44 HydrophobicContact CB-CD2 3.97Å; L9-F44 HydrophobicContact CB-CE2 3.96Å; L9-F44 HydrophobicContact CD1-CD2 3.73Å; L9-F44 HydrophobicContact CD1-CE2 4.35Å; L9-F44 HydrophobicContact CG-CD2 4.5Å; L35-F44 WeakPolarHBondContact CA-O 3.48Å; L35-F44 HydrophobicContact CB-CD1 4.22Å; L35-F44 WeakPolarHBondContact CB-O 3.22Å; L35-F44 HydrophobicContact CD1-CD1 3.76Å; L35-F44 HydrophobicContact CD1-CE1 4.18Å; L35-F44 PolarHBondContact N-O 3.17Å; K36-F44 HydrophobicContact CB-CB 4.19Å; K36-F44 PolarHBondContact N-O 3.45Å; K36-F44 VanDerWaalsContact N-O 3.15Å; K36-F44 WeakPolarHBondContact O-CA 3.41Å; K36-F44 VanDerWaalsContact O-CB 3.26Å; K36-F44 WeakPolarHBondContact O-CB 3.46Å; K36-F44 PolarHBondContact O-N 3.08Å; L38-F44 HydrophobicContact CD1-CB 4.47Å; L38-F44 HydrophobicContact CD1-CD2 4.37Å
45	I	81.9	Confident	77.3	Confident	3 Å²	3	76 Å²	76	2%	0.015	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	161.3	-178.2	59.7	161.2	0	0	0	111.3	G7 V8 V10 F33 I34 V43 A47 V49 V50	G7-I45 CarbonylContact C-O 3.5Å; G7-I45 VanDerWaalsContact CA-O 3.23Å; G7-I45 WeakPolarHBondContact CA-O 3.23Å; V8-I45 PolarHBondContact N-O 3.21Å; V8-I45 PolarHBondContact O-N 3.26Å; V10-I45 HydrophobicContact CG2-CD1 3.87Å; V10-I45 HydrophobicContact CG2-CG1 3.78Å; F33-I45 HydrophobicContact CD2-CB 4.39Å; F33-I45 HydrophobicContact CD2-CG2 4Å; F33-I45 HydrophobicContact CE2-CG2 4.49Å; F33-I45 VanDerWaalsContact O-CA 3.25Å; F33-I45 WeakPolarHBondContact O-CA 3.47Å; F33-I45 WeakPolarHBondContact O-CB 3.48Å; I34-I45 HydrophobicContact CB-CG2 4.45Å; I34-I45 HydrophobicContact CG1-CG2 4.08Å; V43-I45 HydrophobicContact CG1-CG2 4.18Å; V43-I45 HydrophobicContact CG2-CG2 4.28Å; I45-A47 PolarHBondContact O-N 2.86Å; I45-V49 HydrophobicContact CD1-CG2 4.49Å; I45-V50 HydrophobicContact CD1-CB 4.39Å; I45-V50 HydrophobicContact CD1-CG2 3.36Å; I45-V50 HydrophobicContact CG1-CG2 3.76Å
46	L	81.5	Confident	76.8	Confident	53 Å²	53	78.6 Å²	78.6	28%	0.277	39%	0.392	S	S	.	.			trans	-67.9	130.4	176.9	-74.9	159.7	0	0	0	110.8	F33 L35 E48 V49 V50	F33-L46 PolarHBondContact O-N 3.24Å; L35-L46 HydrophobicContact CD1-CD2 3.99Å; L35-L46 HydrophobicContact CD1-CG 3.93Å; L35-L46 HydrophobicContact CD2-CD1 4.41Å; L35-L46 HydrophobicContact CD2-CD2 4.06Å; L35-L46 HydrophobicContact CD2-CG 3.94Å; L35-L46 HydrophobicContact CG-CD2 4.34Å; L35-L46 HydrophobicContact CG-CG 3.94Å; L46-E48 PolarHBondContact O-N 3.16Å; L46-V49 HydrophobicContact CB-CG1 4.27Å; L46-V49 HydrophobicContact CB-CG2 4.08Å; L46-V49 WeakPolarHBondContact O-CG2 3.38Å; L46-V49 PolarHBondContact O-N 3.1Å; L46-V49 VanDerWaalsContact O-N 3.1Å; L46-V50 PolarHBondContact O-N 2.91Å
47	A	74.9	Confident	76.5	Confident	49 Å²	49	72.6 Å²	72.6	41%	0.405	37%	0.367	S	S	.	.	H	α-helix	trans	-58.1	-35.6	-178.8	0	0	0	0	0	113.1	V8 I45 V49 V50	V8-A47 HydrophobicContact CG2-CB 3.62Å; I45-A47 PolarHBondContact O-N 2.86Å; A47-V49 VanDerWaalsContact C-N 3.25Å; A47-V49 PolarHBondContact O-N 2.83Å; A47-V50 WeakPolarHBondContact O-CB 3.49Å; A47-V50 PolarHBondContact O-N 3.4Å
48	E	74.5	Confident	76.1	Confident	166 Å²	166	69.2 Å²	69.2	78%	0.776	36%	0.357	S	S	*	.	H	α-helix	trans	-64.3	-30.1	-179.9	-71.6	179.1	88.5	0	0	112.9	L46	L46-E48 PolarHBondContact O-N 3.16Å
49	V	72.5	Confident	75.8	Confident	20 Å²	20	69.1 Å²	69.1	12%	0.121	36%	0.355	C	S	.	.	H	α-helix	trans	-88.1	-18	179.9	-54.1	0	0	0	0	112.5	L29 F33 I45 L46 A47 Q51 I52 L53	L29-V49 HydrophobicContact CD1-CB 4.13Å; F33-V49 HydrophobicContact CB-CB 3.89Å; F33-V49 HydrophobicContact CB-CG1 3.82Å; F33-V49 HydrophobicContact CB-CG2 3.3Å; F33-V49 HydrophobicContact CD2-CG2 4.03Å; F33-V49 HydrophobicContact CG-CB 4.39Å; F33-V49 HydrophobicContact CG-CG2 3.79Å; I45-V49 HydrophobicContact CD1-CG2 4.49Å; L46-V49 HydrophobicContact CB-CG1 4.27Å; L46-V49 HydrophobicContact CB-CG2 4.08Å; L46-V49 WeakPolarHBondContact O-CG2 3.38Å; L46-V49 PolarHBondContact O-N 3.1Å; L46-V49 VanDerWaalsContact O-N 3.1Å; A47-V49 VanDerWaalsContact C-N 3.25Å; A47-V49 PolarHBondContact O-N 2.83Å; V49-Q51 VanDerWaalsContact C-N 3.28Å; V49-Q51 PolarHBondContact O-N 3.27Å; V49-I52 PolarHBondContact O-N 2.87Å; V49-L53 WeakPolarHBondContact O-CB 3.38Å; V49-L53 PolarHBondContact O-N 2.87Å
50	V	74.7	Confident	75.1	Confident	27 Å²	27	67.1 Å²	67.1	16%	0.164	34%	0.344	C	S	.	.	H	α-helix	trans	-59.6	-43.3	-175.6	168.8	0	0	0	0	110.3	V8 I45 L46 A47 L53 Q54	V8-V50 HydrophobicContact CB-CG2 3.99Å; V8-V50 HydrophobicContact CG1-CG2 4.43Å; V8-V50 HydrophobicContact CG2-CG2 4.23Å; I45-V50 HydrophobicContact CD1-CB 4.39Å; I45-V50 HydrophobicContact CD1-CG2 3.36Å; I45-V50 HydrophobicContact CG1-CG2 3.76Å; L46-V50 PolarHBondContact O-N 2.91Å; A47-V50 WeakPolarHBondContact O-CB 3.49Å; A47-V50 PolarHBondContact O-N 3.4Å; V50-L53 PolarHBondContact O-N 3.5Å; V50-Q54 PolarHBondContact O-N 3.22Å
51	Q	74.6	Confident	74.7	Confident	142 Å²	142	68.2 Å²	68.2	66%	0.664	35%	0.347	S	S	*	.	H	α-helix	trans	-62.5	-51.4	177.5	-82.1	-175.6	-16.6	0	0	111.4	V49 L53 Q54 E55	V49-Q51 VanDerWaalsContact C-N 3.28Å; V49-Q51 PolarHBondContact O-N 3.27Å; Q51-L53 PolarHBondContact O-N 3.43Å; Q51-Q54 PolarHBondContact O-N 2.89Å; Q51-E55 PolarHBondContact O-N 3.44Å
52	I	74.3	Confident	74.1	Confident	75 Å²	75	71.4 Å²	71.4	39%	0.385	36%	0.361	S	S	.	.	H	α-helix	trans	-64.5	-34.4	-179.1	-50.6	165.8	0	0	0	110.4	L29 V49 E55 R56	L29-I52 HydrophobicContact CD2-CB 3.74Å; L29-I52 HydrophobicContact CD2-CD1 3.59Å; L29-I52 HydrophobicContact CD2-CG1 4.27Å; L29-I52 HydrophobicContact CD2-CG2 3.44Å; L29-I52 VanDerWaalsContact CD2-CG2 3.44Å; L29-I52 HydrophobicContact CG-CG2 4.3Å; V49-I52 PolarHBondContact O-N 2.87Å; I52-E55 PolarHBondContact O-N 3.12Å; I52-R56 HydrophobicContact CG2-CG 4.27Å; I52-R56 VanDerWaalsContact O-CB 3.26Å; I52-R56 WeakPolarHBondContact O-CB 3.46Å; I52-R56 VanDerWaalsContact O-CG 3.31Å; I52-R56 WeakPolarHBondContact O-CG 3.4Å; I52-R56 PolarHBondContact O-N 3.47Å
53	L	74.4	Confident	73.1	Confident	14 Å²	14	75.7 Å²	75.7	7%	0.073	38%	0.382	C	S	.	.	H	α-helix	trans	-70.2	-41.9	177.4	-165.3	136.4	0	0	0	111.1	L20 L23 F33 V49 V50 Q51 E55 R56 V57	L20-L53 HydrophobicContact CD2-CD1 3.62Å; L20-L53 HydrophobicContact CD2-CD2 3.39Å; L20-L53 HydrophobicContact CD2-CG 4.14Å; L23-L53 HydrophobicContact CD1-CD1 4.17Å; L23-L53 HydrophobicContact CD1-CD2 4.36Å; L23-L53 HydrophobicContact CD1-CG 4.03Å; F33-L53 HydrophobicContact CD1-CD1 4.35Å; F33-L53 HydrophobicContact CD2-CD1 3.75Å; F33-L53 HydrophobicContact CE1-CD1 3.79Å; F33-L53 HydrophobicContact CE2-CD1 3.12Å; F33-L53 HydrophobicContact CG-CD1 4.35Å; F33-L53 HydrophobicContact CZ-CD1 3.15Å; V49-L53 WeakPolarHBondContact O-CB 3.38Å; V49-L53 PolarHBondContact O-N 2.87Å; V50-L53 PolarHBondContact O-N 3.5Å; Q51-L53 PolarHBondContact O-N 3.43Å; L53-E55 VanDerWaalsContact C-N 3.35Å; L53-R56 PolarHBondContact O-N 3.32Å; L53-V57 HydrophobicContact CD2-CG2 3.59Å; L53-V57 HydrophobicContact CG-CG2 4.07Å; L53-V57 WeakPolarHBondContact O-CB 3.48Å; L53-V57 WeakPolarHBondContact O-CG2 3.23Å; L53-V57 PolarHBondContact O-N 3.33Å
54	Q	71.5	Confident	71.6	Confident	138 Å²	138	81.2 Å²	81.2	65%	0.645	41%	0.411	S	S	*	.	H	α-helix	trans	-60.4	-43.8	171.1	-85.4	-178	6.5	0	0	112	V50 Q51 G58	V50-Q54 PolarHBondContact O-N 3.22Å; Q51-Q54 PolarHBondContact O-N 2.89Å; Q54-G58 PolarHBondContact O-N 2.64Å
55	E	75.4	Confident	69.8	Low	135 Å²	135	82.5 Å²	82.5	63%	0.631	43%	0.427	S	S	*	.	H	α-helix	trans	-62.6	-48.1	176	-74.2	-173.2	92.2	0	0	111.3	Q51 I52 L53 G58 E59	Q51-E55 PolarHBondContact O-N 3.44Å; I52-E55 PolarHBondContact O-N 3.12Å; L53-E55 VanDerWaalsContact C-N 3.35Å; E55-G58 PolarHBondContact O-N 2.75Å; E55-E59 WeakPolarHBondContact O-CG 3.39Å; E55-E59 PolarHBondContact O-N 3.37Å
56	R	71.6	Confident	68	Low	109 Å²	109	89.9 Å²	89.9	41%	0.411	46%	0.459	S	S	.	.	H	α-helix	trans	-66.6	-41.1	178.7	-78.2	-58.5	-157.1	-170.3	6.2	113.4	I52 L53 G58 E59 L60	I52-R56 HydrophobicContact CG2-CG 4.27Å; I52-R56 VanDerWaalsContact O-CB 3.26Å; I52-R56 WeakPolarHBondContact O-CB 3.46Å; I52-R56 VanDerWaalsContact O-CG 3.31Å; I52-R56 WeakPolarHBondContact O-CG 3.4Å; I52-R56 PolarHBondContact O-N 3.47Å; L53-R56 PolarHBondContact O-N 3.32Å; R56-G58 VanDerWaalsContact C-N 3.29Å; R56-E59 IonicContact CZ-OE2 2.92Å; R56-E59 IonicContact NH1-OE2 2.8Å; R56-E59 PolarHBondContact NH1-OE2 3.4Å; R56-E59 PolarHBondContact O-N 3.36Å; R56-L60 VanDerWaalsContact O-CB 3.22Å; R56-L60 WeakPolarHBondContact O-CB 3.49Å; R56-L60 WeakPolarHBondContact O-CG 3.44Å; R56-L60 PolarHBondContact O-N 3.13Å
57	V	70.7	Confident	66.2	Low	13 Å²	13	91.9 Å²	91.9	8%	0.079	48%	0.475	C	S	.	.	H	α-helix	trans	-61.6	-43.2	173.7	172.4	0	0	0	0	109	M16 F19 L23 L53 L60 M61	M16-V57 HydrophobicContact CE-CG1 4.27Å; F19-V57 HydrophobicContact CD1-CG1 4.38Å; F19-V57 HydrophobicContact CD1-CG2 4.01Å; F19-V57 HydrophobicContact CE1-CB 4.12Å; F19-V57 HydrophobicContact CE1-CG1 3.88Å; F19-V57 HydrophobicContact CE1-CG2 3.67Å; L23-V57 HydrophobicContact CD1-CG2 3.58Å; L53-V57 HydrophobicContact CD2-CG2 3.59Å; L53-V57 HydrophobicContact CG-CG2 4.07Å; L53-V57 WeakPolarHBondContact O-CB 3.48Å; L53-V57 WeakPolarHBondContact O-CG2 3.23Å; L53-V57 PolarHBondContact O-N 3.33Å; V57-L60 PolarHBondContact O-N 2.83Å; V57-M61 VanDerWaalsContact O-CB 3.3Å; V57-M61 WeakPolarHBondContact O-CB 3.3Å; V57-M61 PolarHBondContact O-N 3.26Å
58	G	67.6	Low	64.9	Low	36 Å²	36	97.9 Å²	97.9	37%	0.371	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-50.1	175.3	0	0	0	0	0	112.5	Q54 E55 R56 L60 M61 D62	Q54-G58 PolarHBondContact O-N 2.64Å; E55-G58 PolarHBondContact O-N 2.75Å; R56-G58 VanDerWaalsContact C-N 3.29Å; G58-L60 VanDerWaalsContact C-N 3.33Å; G58-L60 PolarHBondContact O-N 2.85Å; G58-M61 PolarHBondContact O-N 2.79Å; G58-D62 WeakPolarHBondContact O-CB 3.41Å; G58-D62 PolarHBondContact O-N 3.26Å
59	E	71.3	Confident	63.4	Low	93 Å²	93	95.7 Å²	95.7	44%	0.435	50%	0.497	S	S	.	.	H	α-helix	trans	-60.9	-40.1	175.7	-73.7	-162.7	113.8	0	0	112.1	E55 R56 D62 Q63	E55-E59 WeakPolarHBondContact O-CG 3.39Å; E55-E59 PolarHBondContact O-N 3.37Å; R56-E59 IonicContact CZ-OE2 2.92Å; R56-E59 IonicContact NH1-OE2 2.8Å; R56-E59 PolarHBondContact NH1-OE2 3.4Å; R56-E59 PolarHBondContact O-N 3.36Å; E59-D62 PolarHBondContact O-N 2.8Å; E59-Q63 VanDerWaalsContact O-CB 3.3Å; E59-Q63 WeakPolarHBondContact O-CB 3.3Å; E59-Q63 VanDerWaalsContact O-CG 3.3Å; E59-Q63 WeakPolarHBondContact O-CG 3.37Å; E59-Q63 PolarHBondContact O-N 3.4Å
60	L	66.4	Low	61.9	Low	63 Å²	63	103.6 Å²	103.6	33%	0.33	53%	0.532	S	S	.	.	H	α-helix	trans	-72	-35.1	176.9	-82.3	161.3	0	0	0	112.1	F19 L23 R56 V57 G58 D62 N64	F19-L60 HydrophobicContact CZ-CB 4.36Å; L23-L60 HydrophobicContact CD2-CD1 3.64Å; R56-L60 VanDerWaalsContact O-CB 3.22Å; R56-L60 WeakPolarHBondContact O-CB 3.49Å; R56-L60 WeakPolarHBondContact O-CG 3.44Å; R56-L60 PolarHBondContact O-N 3.13Å; V57-L60 PolarHBondContact O-N 2.83Å; G58-L60 VanDerWaalsContact C-N 3.33Å; G58-L60 PolarHBondContact O-N 2.85Å; L60-D62 VanDerWaalsContact C-N 3.31Å; L60-N64 WeakPolarHBondContact O-CA 3.3Å; L60-N64 WeakPolarHBondContact O-CB 2.98Å; L60-N64 PolarHBondContact O-N 3.09Å
61	M	63.8	Low	60.1	Low	126 Å²	126	114.9 Å²	114.9	62%	0.621	58%	0.579	S	S	*	*	H	α-helix	trans	-67.3	-34.1	171.7	-94.9	-171.9	156.3	0	0	111.7	V57 G58 S65	V57-M61 VanDerWaalsContact O-CB 3.3Å; V57-M61 WeakPolarHBondContact O-CB 3.3Å; V57-M61 PolarHBondContact O-N 3.26Å; G58-M61 PolarHBondContact O-N 2.79Å; M61-S65 VanDerWaalsContact O-CB 3.23Å; M61-S65 WeakPolarHBondContact O-CB 3.48Å; M61-S65 PolarHBondContact O-N 2.91Å; M61-S65 PolarHBondContact O-OG 2.73Å
62	D	66.8	Low	59.4	Low	125 Å²	125	113.6 Å²	113.6	67%	0.668	58%	0.575	S	S	*	*	H	α-helix	trans	-74.7	-45	176.4	-165.9	-100.5	0	0	0	111.2	G58 E59 L60 S65	G58-D62 WeakPolarHBondContact O-CB 3.41Å; G58-D62 PolarHBondContact O-N 3.26Å; E59-D62 PolarHBondContact O-N 2.8Å; L60-D62 VanDerWaalsContact C-N 3.31Å; D62-S65 WeakPolarHBondContact O-CB 3.42Å; D62-S65 PolarHBondContact O-N 3.29Å
63	Q	62	Low	58.6	Low	135 Å²	135	115.6 Å²	115.6	63%	0.631	59%	0.585	S	S	*	*	H	α-helix	trans	-69.1	-35.2	175.5	-74.1	-173.6	20.5	0	0	113.3	E59 S65	E59-Q63 VanDerWaalsContact O-CB 3.3Å; E59-Q63 WeakPolarHBondContact O-CB 3.3Å; E59-Q63 VanDerWaalsContact O-CG 3.3Å; E59-Q63 WeakPolarHBondContact O-CG 3.37Å; E59-Q63 PolarHBondContact O-N 3.4Å; Q63-S65 VanDerWaalsContact C-N 3.34Å
64	N	50	Low	57.7	Low	127 Å²	127	121.2 Å²	121.2	68%	0.679	61%	0.614	S	S	*	*	S	Bend	trans	-90.3	-1.4	175.5	-158.4	28.4	0	0	0	112.5	L60 F66	L60-N64 WeakPolarHBondContact O-CA 3.3Å; L60-N64 WeakPolarHBondContact O-CB 2.98Å; L60-N64 PolarHBondContact O-N 3.09Å; N64-F66 PolarHBondContact O-N 3.35Å
65	S	46	Very low	56.9	Low	83 Å²	83	120.2 Å²	120.2	58%	0.58	61%	0.612	S	S	*	*			trans	-71.2	58.6	153.4	-73.9	0	0	0	0	108.7	M61 D62 Q63 P67	M61-S65 VanDerWaalsContact O-CB 3.23Å; M61-S65 WeakPolarHBondContact O-CB 3.48Å; M61-S65 PolarHBondContact O-N 2.91Å; M61-S65 PolarHBondContact O-OG 2.73Å; D62-S65 WeakPolarHBondContact O-CB 3.42Å; D62-S65 PolarHBondContact O-N 3.29Å; Q63-S65 VanDerWaalsContact C-N 3.34Å; S65-P67 WeakPolarHBondContact O-CD 3.47Å
66	F	42.8	Very low	55.7	Low	159 Å²	159	119.3 Å²	119.3	70%	0.697	61%	0.611	S	S	*	*			trans	-52.8	124	142.1	-90.8	-90.1	0	0	0	105.6	N64 I68	N64-F66 PolarHBondContact O-N 3.35Å; F66-I68 VanDerWaalsContact C-N 3.3Å; F66-I68 PolarHBondContact O-N 2.83Å
67	P	45	Very low	54.7	Low	95 Å²	95	120 Å²	120	62%	0.617	62%	0.624	S	S	*	*			trans	-60.7	98.9	178.9	23.5	-31.2	0	0	0	107.9	S65 T69	S65-P67 WeakPolarHBondContact O-CD 3.47Å; P67-T69 HydrophobicContact CB-CG2 3.56Å; P67-T69 PolarHBondContact O-N 3.29Å
68	I	46.8	Very low	53.5	Low	175 Å²	175	127.6 Å²	127.6	90%	0.897	66%	0.663	S	S	*	*			trans	-67.5	13.1	159.5	40.9	167	0	0	0	111.3	F66 Q70	F66-I68 VanDerWaalsContact C-N 3.3Å; F66-I68 PolarHBondContact O-N 2.83Å; I68-Q70 PolarHBondContact O-N 3.01Å
69	T	44.1	Very low	52.5	Low	119 Å²	119	134.7 Å²	134.7	73%	0.73	69%	0.685	S	S	*	*			trans	-84.7	56.3	157.5	-177	0	0	0	0	111.2	P67	P67-T69 HydrophobicContact CB-CG2 3.56Å; P67-T69 PolarHBondContact O-N 3.29Å
70	Q	39.7	Very low	50.9	Low	186 Å²	186	138.2 Å²	138.2	87%	0.869	71%	0.706	S	S	*	*			trans	-92.9	103.5	153.8	-160	178.5	-91.1	0	0	107.7	I68	I68-Q70 PolarHBondContact O-N 3.01Å
71	K	37.4	Very low	49.5	Very low	265 Å²	265	145 Å²	145	100%	1.152	74%	0.74	S	S	*	*			trans	-63.8	0	169.3	-170.1	-175.4	-178.1	-176.4	0	111.1

Retrieved 71 of 71 residues in 14.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).