A0A3P9P5D9_POERE Loading...

Mitoregulin

AlphaFold DB , UniProt , Accession A0A3P9P5D9, Species POERE (Poecilia reticulata, Guppy), Gene n/a, Length 56 aa.

						>A0A3P9P5D9_POERE|A0A3P9P5D9
MGDVSERTLQCAVVFSFAVGFLTGWQANRMRRRFLDWRKKRLQDKLSETQKKLDLA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49	Very low	78.7	Confident	246 Å²	246	122.1 Å²	122.1	100%	1.212	66%	0.66	S	S	*	*				0	113.4	0	-80.8	172.6	167.6	0	0	105.9
2	G	58.8	Low	80	Confident	67 Å²	67	116.2 Å²	116.2	69%	0.691	64%	0.64	S	S	*	*			trans	-61.7	146.1	-168	0	0	0	0	0	112.4	V4	G2-V4 PolarHBondContact O-N 3.32Å
3	D	66.6	Low	81.2	Confident	171 Å²	171	114.5 Å²	114.5	91%	0.914	63%	0.634	S	S	*	*			trans	-55.6	94.3	179	-133.7	-75	0	0	0	110.4	S5	D3-S5 PolarHBondContact O-N 3.22Å
4	V	69.4	Low	82.3	Confident	91 Å²	91	113.3 Å²	113.3	55%	0.552	63%	0.631	S	S	*	*			trans	-81	111.5	173.7	179.2	0	0	0	0	106.6	G2 E6 T8	G2-V4 PolarHBondContact O-N 3.32Å; V4-E6 PolarHBondContact O-N 2.74Å; V4-T8 HydrophobicContact CG1-CG2 4.11Å
5	S	80.9	Confident	83.3	Confident	63 Å²	63	115.3 Å²	115.3	44%	0.441	63%	0.631	S	S	.	*			trans	-53.2	134.5	175.6	-175.4	0	0	0	0	110.3	D3 R7 T8 L9	D3-S5 PolarHBondContact O-N 3.22Å; S5-R7 PolarHBondContact O-N 3.29Å; S5-T8 WeakPolarHBondContact O-CA 3.31Å; S5-T8 VanDerWaalsContact O-CB 3.29Å; S5-T8 WeakPolarHBondContact O-CB 3.2Å; S5-T8 PolarHBondContact O-N 3.43Å; S5-L9 PolarHBondContact O-N 3.45Å; S5-L9 VanDerWaalsContact O-N 3.17Å
6	E	84.9	Confident	84.1	Confident	140 Å²	140	113.4 Å²	113.4	65%	0.654	63%	0.629	S	S	*	*	H	α-helix	trans	-49.8	-34.2	179.4	-170.8	-178.7	170.4	0	0	112.5	V4 L9 Q10	V4-E6 PolarHBondContact O-N 2.74Å; E6-L9 WeakPolarHBondContact O-CB 3.4Å; E6-L9 PolarHBondContact O-N 2.88Å; E6-Q10 WeakPolarHBondContact O-CG 3.28Å; E6-Q10 PolarHBondContact O-N 3.41Å
7	R	87.3	Confident	84.8	Confident	195 Å²	195	115.6 Å²	115.6	74%	0.736	63%	0.631	S	S	*	*	H	α-helix	trans	-63.9	-42	175.3	-64	-179.7	-179.7	-178.1	0.2	112.6	S5 L9 Q10 C11	S5-R7 PolarHBondContact O-N 3.29Å; R7-L9 VanDerWaalsContact C-N 3.3Å; R7-L9 PolarHBondContact O-N 3.16Å; R7-Q10 PolarHBondContact O-N 2.69Å; R7-C11 WeakPolarHBondContact O-CB 3.47Å; R7-C11 PolarHBondContact O-N 2.85Å; R7-C11 PolarHBondContact O-SG 2.85Å
8	T	90.4	Very high	85.5	Confident	85 Å²	85	111.3 Å²	111.3	52%	0.521	61%	0.614	S	S	.	*	H	α-helix	trans	-64	-40.1	176	-53.8	0	0	0	0	110.5	V4 S5 C11 A12	V4-T8 HydrophobicContact CG1-CG2 4.11Å; S5-T8 WeakPolarHBondContact O-CA 3.31Å; S5-T8 VanDerWaalsContact O-CB 3.29Å; S5-T8 WeakPolarHBondContact O-CB 3.2Å; S5-T8 PolarHBondContact O-N 3.43Å; T8-C11 PolarHBondContact O-N 3.08Å; T8-A12 WeakPolarHBondContact O-CB 3.43Å; T8-A12 PolarHBondContact O-N 3.08Å
9	L	91.5	Very high	86.1	Confident	106 Å²	106	110.2 Å²	110.2	56%	0.555	61%	0.61	S	S	*	*	H	α-helix	trans	-64.3	-47.2	176	-160.3	89.1	0	0	0	111.3	S5 E6 R7 C11 A12 V13	S5-L9 PolarHBondContact O-N 3.45Å; S5-L9 VanDerWaalsContact O-N 3.17Å; E6-L9 WeakPolarHBondContact O-CB 3.4Å; E6-L9 PolarHBondContact O-N 2.88Å; R7-L9 VanDerWaalsContact C-N 3.3Å; R7-L9 PolarHBondContact O-N 3.16Å; L9-C11 PolarHBondContact O-N 3.05Å; L9-A12 PolarHBondContact O-N 3.25Å; L9-V13 WeakPolarHBondContact O-CG2 3.39Å; L9-V13 PolarHBondContact O-N 3.31Å
10	Q	92.1	Very high	86.6	Confident	110 Å²	110	106.8 Å²	106.8	51%	0.514	60%	0.601	S	S	.	*	H	α-helix	trans	-59.6	-45.1	176.7	-75	178.5	1.6	0	0	111.6	E6 R7 A12 V13 V14	E6-Q10 WeakPolarHBondContact O-CG 3.28Å; E6-Q10 PolarHBondContact O-N 3.41Å; R7-Q10 PolarHBondContact O-N 2.69Å; Q10-A12 PolarHBondContact O-N 3.31Å; Q10-V13 PolarHBondContact O-N 2.99Å; Q10-V14 WeakPolarHBondContact O-CG2 3.45Å; Q10-V14 PolarHBondContact O-N 3.15Å
11	C	95.1	Very high	87	Confident	69 Å²	69	107.6 Å²	107.6	47%	0.466	60%	0.599	S	S	.	*	H	α-helix	trans	-59	-48.1	174.4	-73.1	0	0	0	0	111.3	R7 T8 L9 V13 V14 F15	R7-C11 WeakPolarHBondContact O-CB 3.47Å; R7-C11 PolarHBondContact O-N 2.85Å; R7-C11 PolarHBondContact O-SG 2.85Å; T8-C11 PolarHBondContact O-N 3.08Å; L9-C11 PolarHBondContact O-N 3.05Å; C11-V13 VanDerWaalsContact C-N 3.28Å; C11-V13 PolarHBondContact O-N 3.31Å; C11-V14 PolarHBondContact O-N 2.86Å; C11-F15 HydrophobicContact CB-CD2 4.35Å; C11-F15 HydrophobicContact CB-CE2 4.46Å; C11-F15 WeakPolarHBondContact O-CB 3.48Å; C11-F15 WeakPolarHBondContact O-CD2 3.47Å; C11-F15 PolarHBondContact O-N 3.18Å
12	A	94.2	Very high	89.3	Confident	51 Å²	51	101 Å²	101	42%	0.421	57%	0.567	S	S	.	*	H	α-helix	trans	-58.9	-39.9	180	0	0	0	0	0	112.3	T8 L9 Q10 S16	T8-A12 WeakPolarHBondContact O-CB 3.43Å; T8-A12 PolarHBondContact O-N 3.08Å; L9-A12 PolarHBondContact O-N 3.25Å; Q10-A12 PolarHBondContact O-N 3.31Å; A12-S16 VanDerWaalsContact O-CB 3.31Å; A12-S16 WeakPolarHBondContact O-CB 3.47Å; A12-S16 PolarHBondContact O-N 2.91Å; A12-S16 PolarHBondContact O-OG 3.44Å
13	V	95.6	Very high	91	Very high	94 Å²	94	101.9 Å²	101.9	57%	0.57	56%	0.56	S	S	*	*	H	α-helix	trans	-65.2	-47.9	176.3	173.5	0	0	0	0	111.1	L9 Q10 C11 F15 S16 F17	L9-V13 WeakPolarHBondContact O-CG2 3.39Å; L9-V13 PolarHBondContact O-N 3.31Å; Q10-V13 PolarHBondContact O-N 2.99Å; C11-V13 VanDerWaalsContact C-N 3.28Å; C11-V13 PolarHBondContact O-N 3.31Å; V13-F15 VanDerWaalsContact C-N 3.35Å; V13-F15 PolarHBondContact O-N 3.21Å; V13-S16 PolarHBondContact O-N 3.5Å; V13-F17 WeakPolarHBondContact O-CB 3.35Å; V13-F17 PolarHBondContact O-N 3.29Å
14	V	97	Very high	92.3	Very high	98 Å²	98	95.7 Å²	95.7	59%	0.594	54%	0.536	S	S	*	.	H	α-helix	trans	-62.2	-43.3	179	173.2	0	0	0	0	111.1	Q10 C11 F17 A18	Q10-V14 WeakPolarHBondContact O-CG2 3.45Å; Q10-V14 PolarHBondContact O-N 3.15Å; C11-V14 PolarHBondContact O-N 2.86Å; V14-F17 PolarHBondContact O-N 3.01Å; V14-A18 WeakPolarHBondContact O-CB 3.45Å; V14-A18 PolarHBondContact O-N 3.38Å
15	F	96.8	Very high	93.5	Very high	143 Å²	143	97.2 Å²	97.2	63%	0.627	53%	0.532	S	S	*	.	H	α-helix	trans	-62.8	-46	176.6	-85.4	-68.2	0	0	0	111.9	C11 V13 F17 A18 V19	C11-F15 HydrophobicContact CB-CD2 4.35Å; C11-F15 HydrophobicContact CB-CE2 4.46Å; C11-F15 WeakPolarHBondContact O-CB 3.48Å; C11-F15 WeakPolarHBondContact O-CD2 3.47Å; C11-F15 PolarHBondContact O-N 3.18Å; V13-F15 VanDerWaalsContact C-N 3.35Å; V13-F15 PolarHBondContact O-N 3.21Å; F15-F17 VanDerWaalsContact C-N 3.3Å; F15-F17 PolarHBondContact O-N 3.49Å; F15-A18 PolarHBondContact O-N 3.12Å; F15-V19 WeakPolarHBondContact O-CB 3.36Å; F15-V19 VanDerWaalsContact O-CG2 3.28Å; F15-V19 WeakPolarHBondContact O-CG2 3.47Å; F15-V19 PolarHBondContact O-N 3.31Å
16	S	96.3	Very high	94.1	Very high	86 Å²	86	99.3 Å²	99.3	60%	0.601	54%	0.535	S	S	*	.	H	α-helix	trans	-60.7	-42.6	178.4	-58.6	0	0	0	0	111.3	A12 V13 G20	A12-S16 VanDerWaalsContact O-CB 3.31Å; A12-S16 WeakPolarHBondContact O-CB 3.47Å; A12-S16 PolarHBondContact O-N 2.91Å; A12-S16 PolarHBondContact O-OG 3.44Å; V13-S16 PolarHBondContact O-N 3.5Å; S16-G20 PolarHBondContact O-N 2.94Å
17	F	96.2	Very high	94.5	Very high	150 Å²	150	95.6 Å²	95.6	66%	0.658	53%	0.528	S	S	*	.	H	α-helix	trans	-64.3	-47.2	175.9	-178.4	-98.5	0	0	0	112.2	V13 V14 F15 V19 G20 F21	V13-F17 WeakPolarHBondContact O-CB 3.35Å; V13-F17 PolarHBondContact O-N 3.29Å; V14-F17 PolarHBondContact O-N 3.01Å; F15-F17 VanDerWaalsContact C-N 3.3Å; F15-F17 PolarHBondContact O-N 3.49Å; F17-V19 VanDerWaalsContact C-N 3.33Å; F17-V19 PolarHBondContact O-N 3.03Å; F17-G20 PolarHBondContact O-N 3.34Å; F17-F21 WeakPolarHBondContact O-CB 3.33Å; F17-F21 PolarHBondContact O-N 3.47Å
18	A	96.9	Very high	94.8	Very high	39 Å²	39	89.8 Å²	89.8	32%	0.322	51%	0.512	S	S	.	.	H	α-helix	trans	-60.7	-42.4	179.7	0	0	0	0	0	111.8	V14 F15 F21 L22	V14-A18 WeakPolarHBondContact O-CB 3.45Å; V14-A18 PolarHBondContact O-N 3.38Å; F15-A18 PolarHBondContact O-N 3.12Å; A18-F21 PolarHBondContact O-N 3.43Å; A18-L22 WeakPolarHBondContact O-CB 3.31Å; A18-L22 VanDerWaalsContact O-CG 3.26Å; A18-L22 WeakPolarHBondContact O-CG 3.32Å; A18-L22 PolarHBondContact O-N 2.95Å
19	V	96.9	Very high	94.9	Very high	90 Å²	90	91 Å²	91	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-64.2	-45.7	176.3	172.7	0	0	0	0	110.9	F15 F17 F21 L22 T23	F15-V19 WeakPolarHBondContact O-CB 3.36Å; F15-V19 VanDerWaalsContact O-CG2 3.28Å; F15-V19 WeakPolarHBondContact O-CG2 3.47Å; F15-V19 PolarHBondContact O-N 3.31Å; F17-V19 VanDerWaalsContact C-N 3.33Å; F17-V19 PolarHBondContact O-N 3.03Å; V19-F21 VanDerWaalsContact C-N 3.34Å; V19-F21 PolarHBondContact O-N 2.97Å; V19-L22 PolarHBondContact O-N 3.32Å; V19-T23 HydrophobicContact CG1-CG2 4.47Å; V19-T23 WeakPolarHBondContact O-CB 3.42Å; V19-T23 WeakPolarHBondContact O-CG2 3.49Å; V19-T23 PolarHBondContact O-N 3.23Å; V19-T23 PolarHBondContact O-OG1 2.88Å
20	G	95.9	Very high	94.9	Very high	42 Å²	42	91.2 Å²	91.2	43%	0.433	51%	0.506	S	S	.	.	H	α-helix	trans	-60.3	-42.4	175.6	0	0	0	0	0	112.7	S16 F17 T23 G24	S16-G20 PolarHBondContact O-N 2.94Å; F17-G20 PolarHBondContact O-N 3.34Å; G20-T23 WeakPolarHBondContact CA-OG1 3.35Å; G20-T23 PolarHBondContact O-OG1 3.47Å; G20-G24 PolarHBondContact O-N 3.44Å
21	F	96	Very high	95	Very high	124 Å²	124	94.3 Å²	94.3	54%	0.544	51%	0.513	S	S	.	.	H	α-helix	trans	-65.7	-46.5	178.2	-176.1	-98.2	0	0	0	112.3	F17 A18 V19 G24 W25	F17-F21 WeakPolarHBondContact O-CB 3.33Å; F17-F21 PolarHBondContact O-N 3.47Å; A18-F21 PolarHBondContact O-N 3.43Å; V19-F21 VanDerWaalsContact C-N 3.34Å; V19-F21 PolarHBondContact O-N 2.97Å; F21-G24 PolarHBondContact O-N 2.94Å; F21-W25 VanDerWaalsContact O-CB 3.3Å; F21-W25 WeakPolarHBondContact O-CB 3.49Å; F21-W25 PolarHBondContact O-N 2.82Å
22	L	96.4	Very high	94.9	Very high	106 Å²	106	96.2 Å²	96.2	56%	0.555	51%	0.511	S	S	*	.	H	α-helix	trans	-65.7	-40.1	-179.5	-72.7	174.3	0	0	0	112.3	A18 V19 W25 Q26	A18-L22 WeakPolarHBondContact O-CB 3.31Å; A18-L22 VanDerWaalsContact O-CG 3.26Å; A18-L22 WeakPolarHBondContact O-CG 3.32Å; A18-L22 PolarHBondContact O-N 2.95Å; V19-L22 PolarHBondContact O-N 3.32Å; L22-W25 PolarHBondContact O-N 3.37Å; L22-Q26 WeakPolarHBondContact O-CB 3.41Å; L22-Q26 WeakPolarHBondContact O-CG 3.26Å; L22-Q26 PolarHBondContact O-N 2.91Å
23	T	95.1	Very high	94.8	Very high	87 Å²	87	100.2 Å²	100.2	53%	0.534	52%	0.515	S	S	.	.	H	α-helix	trans	-65.5	-44.7	176.2	50.6	0	0	0	0	111.5	V19 G20 W25 Q26 A27	V19-T23 HydrophobicContact CG1-CG2 4.47Å; V19-T23 WeakPolarHBondContact O-CB 3.42Å; V19-T23 WeakPolarHBondContact O-CG2 3.49Å; V19-T23 PolarHBondContact O-N 3.23Å; V19-T23 PolarHBondContact O-OG1 2.88Å; G20-T23 WeakPolarHBondContact CA-OG1 3.35Å; G20-T23 PolarHBondContact O-OG1 3.47Å; T23-W25 VanDerWaalsContact C-N 3.34Å; T23-W25 PolarHBondContact O-N 3.02Å; T23-Q26 PolarHBondContact O-N 3.38Å; T23-A27 WeakPolarHBondContact O-CB 3.44Å; T23-A27 PolarHBondContact O-N 2.97Å
24	G	93.9	Very high	94.7	Very high	40 Å²	40	101 Å²	101	41%	0.412	51%	0.511	S	S	.	.	H	α-helix	trans	-61	-40.9	172.9	0	0	0	0	0	113	G20 F21 A27 N28	G20-G24 PolarHBondContact O-N 3.44Å; F21-G24 PolarHBondContact O-N 2.94Å; G24-A27 PolarHBondContact O-N 3.29Å; G24-N28 WeakPolarHBondContact O-CB 3.3Å; G24-N28 PolarHBondContact O-N 3.45Å
25	W	94	Very high	94.6	Very high	123 Å²	123	100.5 Å²	100.5	47%	0.466	50%	0.504	S	S	.	.	H	α-helix	trans	-64	-44.9	177	-178.4	-101.6	0	0	0	112.5	F21 L22 T23 N28 R29	F21-W25 VanDerWaalsContact O-CB 3.3Å; F21-W25 WeakPolarHBondContact O-CB 3.49Å; F21-W25 PolarHBondContact O-N 2.82Å; L22-W25 PolarHBondContact O-N 3.37Å; T23-W25 VanDerWaalsContact C-N 3.34Å; T23-W25 PolarHBondContact O-N 3.02Å; W25-N28 PolarHBondContact O-N 2.88Å; W25-R29 WeakPolarHBondContact O-CB 3.44Å; W25-R29 PolarHBondContact O-N 3.37Å
26	Q	94.6	Very high	94.5	Very high	107 Å²	107	98.6 Å²	98.6	50%	0.5	50%	0.501	S	S	.	.	H	α-helix	trans	-62.9	-43.1	176.1	-74.4	-72.2	12.5	0	0	111.6	L22 T23 N28 R29 M30	L22-Q26 WeakPolarHBondContact O-CB 3.41Å; L22-Q26 WeakPolarHBondContact O-CG 3.26Å; L22-Q26 PolarHBondContact O-N 2.91Å; T23-Q26 PolarHBondContact O-N 3.38Å; Q26-N28 VanDerWaalsContact C-N 3.33Å; Q26-N28 PolarHBondContact O-N 3.12Å; Q26-R29 PolarHBondContact O-N 3.33Å; Q26-M30 WeakPolarHBondContact O-CG 3.28Å; Q26-M30 PolarHBondContact O-N 2.92Å
27	A	93.1	Very high	94.5	Very high	62 Å²	62	101.4 Å²	101.4	51%	0.512	50%	0.498	S	S	.	.	H	α-helix	trans	-59.4	-44.4	174.9	0	0	0	0	0	111.5	T23 G24 R29 M30 R31	T23-A27 WeakPolarHBondContact O-CB 3.44Å; T23-A27 PolarHBondContact O-N 2.97Å; G24-A27 PolarHBondContact O-N 3.29Å; A27-R29 VanDerWaalsContact C-N 3.34Å; A27-R29 PolarHBondContact O-N 3.33Å; A27-M30 PolarHBondContact O-N 3.38Å; A27-R31 WeakPolarHBondContact O-CB 3.4Å; A27-R31 PolarHBondContact O-N 2.97Å
28	N	92.6	Very high	94.4	Very high	73 Å²	73	100.9 Å²	100.9	39%	0.39	49%	0.492	S	S	.	.	H	α-helix	trans	-66.1	-35.5	176.9	-170.1	40.1	0	0	0	112.6	G24 W25 Q26 R31 R32	G24-N28 WeakPolarHBondContact O-CB 3.3Å; G24-N28 PolarHBondContact O-N 3.45Å; W25-N28 PolarHBondContact O-N 2.88Å; Q26-N28 VanDerWaalsContact C-N 3.33Å; Q26-N28 PolarHBondContact O-N 3.12Å; N28-R31 PolarHBondContact O-N 3.46Å; N28-R32 WeakPolarHBondContact O-CG 3.32Å; N28-R32 PolarHBondContact O-N 3.41Å
29	R	93.6	Very high	94.3	Very high	111 Å²	111	105.9 Å²	105.9	42%	0.419	51%	0.506	S	S	.	.	H	α-helix	trans	-66	-44.5	175	-174.5	175.4	-178.8	82.6	-5.1	111.7	W25 Q26 A27 R31 R32 R33	W25-R29 WeakPolarHBondContact O-CB 3.44Å; W25-R29 PolarHBondContact O-N 3.37Å; Q26-R29 PolarHBondContact O-N 3.33Å; A27-R29 VanDerWaalsContact C-N 3.34Å; A27-R29 PolarHBondContact O-N 3.33Å; R29-R31 VanDerWaalsContact C-N 3.35Å; R29-R32 PolarHBondContact O-N 3.12Å; R29-R33 PolarHBondContact O-N 3.02Å; R29-R33 VanDerWaalsContact O-N 3.12Å
30	M	91.6	Very high	94.1	Very high	111 Å²	111	108.1 Å²	108.1	55%	0.547	51%	0.508	S	S	.	.	H	α-helix	trans	-64.3	-41.1	176	-70.8	-58.3	-167.4	0	0	111.5	Q26 A27 R32 R33 F34	Q26-M30 WeakPolarHBondContact O-CG 3.28Å; Q26-M30 PolarHBondContact O-N 2.92Å; A27-M30 PolarHBondContact O-N 3.38Å; M30-R32 PolarHBondContact O-N 3.37Å; M30-R33 PolarHBondContact O-N 3Å; M30-F34 PolarHBondContact O-N 3.43Å
31	R	92.6	Very high	94	Very high	174 Å²	174	112.1 Å²	112.1	66%	0.657	51%	0.511	S	S	*	.	H	α-helix	trans	-59	-45.3	175	-175.3	175.4	176.3	154.1	-1.5	112.1	A27 N28 R29 F34 L35	A27-R31 WeakPolarHBondContact O-CB 3.4Å; A27-R31 PolarHBondContact O-N 2.97Å; N28-R31 PolarHBondContact O-N 3.46Å; R29-R31 VanDerWaalsContact C-N 3.35Å; R31-F34 PolarHBondContact O-N 3.5Å; R31-L35 HydrophobicContact CG-CD1 4.14Å; R31-L35 WeakPolarHBondContact O-CG 3.5Å; R31-L35 PolarHBondContact O-N 2.93Å
32	R	94.1	Very high	93.9	Very high	110 Å²	110	110.7 Å²	110.7	42%	0.415	51%	0.508	S	S	.	.	H	α-helix	trans	-59.9	-49.5	176.7	-78.9	-173.5	-82.4	-172.7	-4	111.9	N28 R29 M30 F34 L35 D36	N28-R32 WeakPolarHBondContact O-CG 3.32Å; N28-R32 PolarHBondContact O-N 3.41Å; R29-R32 PolarHBondContact O-N 3.12Å; M30-R32 PolarHBondContact O-N 3.37Å; R32-F34 VanDerWaalsContact C-N 3.29Å; R32-F34 PolarHBondContact O-N 2.87Å; R32-L35 PolarHBondContact O-N 3.3Å; R32-L35 VanDerWaalsContact O-N 3.12Å; R32-D36 VanDerWaalsContact O-CG 3.29Å; R32-D36 PolarHBondContact O-N 2.84Å
33	R	92.4	Very high	93.8	Very high	135 Å²	135	111.7 Å²	111.7	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-57.1	-41.8	176.9	-71.7	177.3	176.4	174.6	-6.6	112.6	R29 M30 W37	R29-R33 PolarHBondContact O-N 3.02Å; R29-R33 VanDerWaalsContact O-N 3.12Å; M30-R33 PolarHBondContact O-N 3Å; R33-W37 WeakPolarHBondContact O-CB 3.46Å; R33-W37 PolarHBondContact O-N 3.19Å
34	F	92.9	Very high	93.8	Very high	111 Å²	111	111.4 Å²	111.4	49%	0.487	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-44.1	177.1	176.8	-101.1	0	0	0	112.2	M30 R31 R32 W37 R38	M30-F34 PolarHBondContact O-N 3.43Å; R31-F34 PolarHBondContact O-N 3.5Å; R32-F34 VanDerWaalsContact C-N 3.29Å; R32-F34 PolarHBondContact O-N 2.87Å; F34-W37 HydrophobicContact CD2-CE3 4.43Å; F34-W37 HydrophobicContact CE2-CE3 4.31Å; F34-W37 HydrophobicContact CE2-CZ3 4.28Å; F34-W37 PolarHBondContact O-N 3.42Å; F34-R38 VanDerWaalsContact O-CB 3.32Å; F34-R38 WeakPolarHBondContact O-CB 3.46Å; F34-R38 PolarHBondContact O-N 3.04Å
35	L	94.8	Very high	93.6	Very high	86 Å²	86	115.3 Å²	115.3	45%	0.45	51%	0.511	S	S	.	.	H	α-helix	trans	-64.9	-42.2	178.1	-70.6	173.7	0	0	0	111.7	R31 R32 R38 K39	R31-L35 HydrophobicContact CG-CD1 4.14Å; R31-L35 WeakPolarHBondContact O-CG 3.5Å; R31-L35 PolarHBondContact O-N 2.93Å; R32-L35 PolarHBondContact O-N 3.3Å; R32-L35 VanDerWaalsContact O-N 3.12Å; L35-R38 PolarHBondContact O-N 2.92Å; L35-K39 VanDerWaalsContact O-CB 3.31Å; L35-K39 WeakPolarHBondContact O-CB 3.49Å; L35-K39 PolarHBondContact O-N 3.46Å
36	D	95.4	Very high	93.6	Very high	104 Å²	104	115.4 Å²	115.4	56%	0.556	52%	0.52	S	S	*	.	H	α-helix	trans	-63.5	-44.2	176.9	-67.7	-30.3	0	0	0	111.2	R32 K39 K40	R32-D36 VanDerWaalsContact O-CG 3.29Å; R32-D36 PolarHBondContact O-N 2.84Å; D36-K39 PolarHBondContact O-N 2.95Å; D36-K40 WeakPolarHBondContact O-CB 3.46Å; D36-K40 PolarHBondContact O-N 3Å
37	W	94.9	Very high	93.4	Very high	144 Å²	144	112.8 Å²	112.8	55%	0.545	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-46.2	174.5	174.9	82.7	0	0	0	111.9	R33 F34 K39 K40 R41	R33-W37 WeakPolarHBondContact O-CB 3.46Å; R33-W37 PolarHBondContact O-N 3.19Å; F34-W37 HydrophobicContact CD2-CE3 4.43Å; F34-W37 HydrophobicContact CE2-CE3 4.31Å; F34-W37 HydrophobicContact CE2-CZ3 4.28Å; F34-W37 PolarHBondContact O-N 3.42Å; W37-K39 VanDerWaalsContact C-N 3.34Å; W37-K39 PolarHBondContact O-N 3.44Å; W37-K40 PolarHBondContact O-N 2.83Å; W37-R41 HydrophobicContact CD2-CG 4.21Å; W37-R41 HydrophobicContact CH2-CG 4.33Å; W37-R41 HydrophobicContact CZ2-CG 3.83Å; W37-R41 WeakPolarHBondContact O-CB 3.46Å; W37-R41 PolarHBondContact O-N 3.4Å
38	R	94.6	Very high	93.3	Very high	140 Å²	140	114.8 Å²	114.8	53%	0.528	51%	0.512	S	S	.	.	H	α-helix	trans	-63.7	-41.1	179	-175.8	177.2	173.8	176.2	-1	111.3	F34 L35 R41 L42	F34-R38 VanDerWaalsContact O-CB 3.32Å; F34-R38 WeakPolarHBondContact O-CB 3.46Å; F34-R38 PolarHBondContact O-N 3.04Å; L35-R38 PolarHBondContact O-N 2.92Å; R38-R41 PolarHBondContact O-N 2.92Å; R38-L42 HydrophobicContact CG-CD1 4.27Å; R38-L42 WeakPolarHBondContact O-CG 3.33Å; R38-L42 PolarHBondContact O-N 3.24Å
39	K	94.4	Very high	93.1	Very high	143 Å²	143	115 Å²	115	62%	0.622	52%	0.516	S	S	*	.	H	α-helix	trans	-61.1	-48.4	176.1	-176	178.3	179.2	-177.5	0	110.7	L35 D36 W37 R41 L42 Q43	L35-K39 VanDerWaalsContact O-CB 3.31Å; L35-K39 WeakPolarHBondContact O-CB 3.49Å; L35-K39 PolarHBondContact O-N 3.46Å; D36-K39 PolarHBondContact O-N 2.95Å; W37-K39 VanDerWaalsContact C-N 3.34Å; W37-K39 PolarHBondContact O-N 3.44Å; K39-R41 PolarHBondContact O-N 3.39Å; K39-L42 PolarHBondContact O-N 3.02Å; K39-Q43 WeakPolarHBondContact O-CB 3.38Å; K39-Q43 PolarHBondContact O-N 2.94Å
40	K	93.6	Very high	92.9	Very high	137 Å²	137	114.4 Å²	114.4	60%	0.596	52%	0.518	S	S	*	.	H	α-helix	trans	-58.8	-48.1	177.4	-171.1	173.5	-178.9	177.8	0	111.7	D36 W37 L42 Q43 D44	D36-K40 WeakPolarHBondContact O-CB 3.46Å; D36-K40 PolarHBondContact O-N 3Å; W37-K40 PolarHBondContact O-N 2.83Å; K40-L42 VanDerWaalsContact C-N 3.31Å; K40-L42 PolarHBondContact O-N 3.41Å; K40-Q43 PolarHBondContact O-N 3.28Å; K40-Q43 VanDerWaalsContact O-N 3.15Å; K40-D44 PolarHBondContact O-N 2.86Å
41	R	93.9	Very high	92.6	Very high	127 Å²	127	115.6 Å²	115.6	48%	0.479	52%	0.52	S	S	.	.	H	α-helix	trans	-56.3	-41.5	175.8	-83.9	-94.3	-75.7	-172.2	-4.2	113.5	W37 R38 K39 K45	W37-R41 HydrophobicContact CD2-CG 4.21Å; W37-R41 HydrophobicContact CH2-CG 4.33Å; W37-R41 HydrophobicContact CZ2-CG 3.83Å; W37-R41 WeakPolarHBondContact O-CB 3.46Å; W37-R41 PolarHBondContact O-N 3.4Å; R38-R41 PolarHBondContact O-N 2.92Å; K39-R41 PolarHBondContact O-N 3.39Å; R41-K45 WeakPolarHBondContact O-CG 3.37Å; R41-K45 PolarHBondContact O-N 2.84Å
42	L	94.4	Very high	92.2	Very high	94 Å²	94	113.3 Å²	113.3	49%	0.492	52%	0.515	S	S	.	.	H	α-helix	trans	-70.3	-40.3	178.1	-73	171	0	0	0	111.6	R38 K39 K40 K45 L46	R38-L42 HydrophobicContact CG-CD1 4.27Å; R38-L42 WeakPolarHBondContact O-CG 3.33Å; R38-L42 PolarHBondContact O-N 3.24Å; K39-L42 PolarHBondContact O-N 3.02Å; K40-L42 VanDerWaalsContact C-N 3.31Å; K40-L42 PolarHBondContact O-N 3.41Å; L42-K45 PolarHBondContact O-N 3.32Å; L42-L46 WeakPolarHBondContact O-CG 3.15Å; L42-L46 PolarHBondContact O-N 3.01Å
43	Q	94.3	Very high	91.7	Very high	126 Å²	126	113.2 Å²	113.2	59%	0.589	52%	0.522	S	S	*	.	H	α-helix	trans	-64.5	-40.8	176.9	-171.1	170.2	-1.6	0	0	111.9	K39 K40 K45 L46 S47	K39-Q43 WeakPolarHBondContact O-CB 3.38Å; K39-Q43 PolarHBondContact O-N 2.94Å; K40-Q43 PolarHBondContact O-N 3.28Å; K40-Q43 VanDerWaalsContact O-N 3.15Å; Q43-K45 PolarHBondContact O-N 3.2Å; Q43-L46 PolarHBondContact O-N 3.32Å; Q43-S47 PolarHBondContact O-N 3.45Å
44	D	93.8	Very high	91.1	Very high	82 Å²	82	112.2 Å²	112.2	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-60.4	-46.9	175.9	-67.5	-23.7	0	0	0	110.9	K40 L46 S47 E48	K40-D44 PolarHBondContact O-N 2.86Å; D44-L46 PolarHBondContact O-N 2.86Å; D44-S47 PolarHBondContact O-N 3.47Å; D44-S47 PolarHBondContact O-OG 3.33Å; D44-E48 PolarHBondContact O-N 3.48Å
45	K	90.8	Very high	90	Very high	122 Å²	122	114.2 Å²	114.2	53%	0.53	54%	0.542	S	S	.	.	H	α-helix	trans	-60.8	-43	176.2	-72.4	-173.4	-179.2	-162.1	0	112.7	R41 L42 Q43 S47 E48 T49	R41-K45 WeakPolarHBondContact O-CG 3.37Å; R41-K45 PolarHBondContact O-N 2.84Å; L42-K45 PolarHBondContact O-N 3.32Å; Q43-K45 PolarHBondContact O-N 3.2Å; K45-S47 VanDerWaalsContact C-N 3.32Å; K45-S47 PolarHBondContact O-N 2.91Å; K45-E48 PolarHBondContact O-N 3.4Å; K45-T49 PolarHBondContact O-N 3.31Å; K45-T49 PolarHBondContact O-OG1 3.45Å; K45-T49 VanDerWaalsContact O-OG1 3.12Å
46	L	93	Very high	88.2	Confident	124 Å²	124	116.8 Å²	116.8	65%	0.649	58%	0.575	S	S	*	*	H	α-helix	trans	-61.9	-42.9	176.5	-75.1	173.8	0	0	0	111.2	L42 Q43 D44 E48 T49 Q50	L42-L46 WeakPolarHBondContact O-CG 3.15Å; L42-L46 PolarHBondContact O-N 3.01Å; Q43-L46 PolarHBondContact O-N 3.32Å; D44-L46 PolarHBondContact O-N 2.86Å; L46-E48 VanDerWaalsContact C-N 3.3Å; L46-E48 PolarHBondContact O-N 3.38Å; L46-T49 PolarHBondContact O-N 2.93Å; L46-Q50 WeakPolarHBondContact O-CB 3.42Å; L46-Q50 PolarHBondContact O-N 2.72Å
47	S	91.4	Very high	87.9	Confident	53 Å²	53	117.4 Å²	117.4	37%	0.371	58%	0.576	S	S	.	*	H	α-helix	trans	-64	-35.4	177.9	76.6	0	0	0	0	112.7	Q43 D44 K45 K51	Q43-S47 PolarHBondContact O-N 3.45Å; D44-S47 PolarHBondContact O-N 3.47Å; D44-S47 PolarHBondContact O-OG 3.33Å; K45-S47 VanDerWaalsContact C-N 3.32Å; K45-S47 PolarHBondContact O-N 2.91Å; S47-K51 VanDerWaalsContact O-CG 3.28Å; S47-K51 WeakPolarHBondContact O-CG 3.31Å; S47-K51 PolarHBondContact O-N 3.49Å; S47-K51 VanDerWaalsContact O-N 3.08Å
48	E	89.6	Confident	87.5	Confident	104 Å²	104	116 Å²	116	49%	0.486	58%	0.578	S	S	.	*	H	α-helix	trans	-69.3	-42.3	176.5	-165.9	-166.2	146.6	0	0	111.4	D44 K45 L46 K51 K52	D44-E48 PolarHBondContact O-N 3.48Å; K45-E48 PolarHBondContact O-N 3.4Å; L46-E48 VanDerWaalsContact C-N 3.3Å; L46-E48 PolarHBondContact O-N 3.38Å; E48-K51 PolarHBondContact O-N 3.17Å; E48-K52 WeakPolarHBondContact O-CG 3.39Å; E48-K52 PolarHBondContact O-N 2.92Å; E48-K52 VanDerWaalsContact O-N 3.16Å; E48-K52 WeakPolarHBondContact OE1-CE 3.29Å; E48-K52 IonicContact OE1-NZ 2.74Å; E48-K52 PolarHBondContact OE1-NZ 3.38Å
49	T	89.3	Confident	87.1	Confident	77 Å²	77	114.7 Å²	114.7	47%	0.472	58%	0.581	S	S	.	*	H	α-helix	trans	-64.6	-42.8	175.2	-57.4	0	0	0	0	111.7	K45 L46 K51 K52 L53	K45-T49 PolarHBondContact O-N 3.31Å; K45-T49 PolarHBondContact O-OG1 3.45Å; K45-T49 VanDerWaalsContact O-OG1 3.12Å; L46-T49 PolarHBondContact O-N 2.93Å; T49-K51 VanDerWaalsContact C-N 3.34Å; T49-K51 PolarHBondContact O-N 3.28Å; T49-K52 PolarHBondContact O-N 2.93Å; T49-L53 HydrophobicContact CG2-CD1 4.19Å; T49-L53 PolarHBondContact O-N 2.97Å
50	Q	88.3	Confident	86.7	Confident	99 Å²	99	113 Å²	113	46%	0.463	58%	0.578	S	S	.	*	H	α-helix	trans	-60.1	-44.8	176.6	-174.9	62.2	41	0	0	111.2	L46 K52 L53 D54	L46-Q50 WeakPolarHBondContact O-CB 3.42Å; L46-Q50 PolarHBondContact O-N 2.72Å; Q50-K52 VanDerWaalsContact C-N 3.28Å; Q50-K52 PolarHBondContact O-N 2.82Å; Q50-L53 WeakPolarHBondContact O-CB 3.43Å; Q50-L53 PolarHBondContact O-N 3.2Å; Q50-L53 VanDerWaalsContact O-N 3.08Å; Q50-D54 PolarHBondContact NE2-OD1 3.38Å; Q50-D54 PolarHBondContact O-N 2.89Å
51	K	86.5	Confident	86.2	Confident	135 Å²	135	111.5 Å²	111.5	59%	0.587	58%	0.577	S	S	*	*	H	α-helix	trans	-59.8	-36.9	176.2	-75.3	171.3	177.9	-179.4	0	112.9	S47 E48 T49 L53 L55	S47-K51 VanDerWaalsContact O-CG 3.28Å; S47-K51 WeakPolarHBondContact O-CG 3.31Å; S47-K51 PolarHBondContact O-N 3.49Å; S47-K51 VanDerWaalsContact O-N 3.08Å; E48-K51 PolarHBondContact O-N 3.17Å; T49-K51 VanDerWaalsContact C-N 3.34Å; T49-K51 PolarHBondContact O-N 3.28Å; K51-L53 VanDerWaalsContact C-N 3.34Å; K51-L55 WeakPolarHBondContact O-CB 3.34Å; K51-L55 VanDerWaalsContact O-CD1 3.31Å; K51-L55 WeakPolarHBondContact O-CD1 3.45Å; K51-L55 WeakPolarHBondContact O-CG 3.37Å; K51-L55 PolarHBondContact O-N 2.88Å
52	K	83	Confident	85.7	Confident	127 Å²	127	110.5 Å²	110.5	55%	0.552	58%	0.584	S	S	*	*	H	α-helix	trans	-69.4	-33.3	176.3	-70.7	174.9	-172.9	169.4	0	112.2	E48 T49 Q50	E48-K52 WeakPolarHBondContact O-CG 3.39Å; E48-K52 PolarHBondContact O-N 2.92Å; E48-K52 VanDerWaalsContact O-N 3.16Å; E48-K52 WeakPolarHBondContact OE1-CE 3.29Å; E48-K52 IonicContact OE1-NZ 2.74Å; E48-K52 PolarHBondContact OE1-NZ 3.38Å; T49-K52 PolarHBondContact O-N 2.93Å; Q50-K52 VanDerWaalsContact C-N 3.28Å; Q50-K52 PolarHBondContact O-N 2.82Å
53	L	83.9	Confident	85.1	Confident	107 Å²	107	111.6 Å²	111.6	56%	0.56	59%	0.59	S	S	*	*	H	α-helix	trans	-73.1	-40.1	174.7	-75.1	163.2	0	0	0	111.9	T49 Q50 K51 L55 A56	T49-L53 HydrophobicContact CG2-CD1 4.19Å; T49-L53 PolarHBondContact O-N 2.97Å; Q50-L53 WeakPolarHBondContact O-CB 3.43Å; Q50-L53 PolarHBondContact O-N 3.2Å; Q50-L53 VanDerWaalsContact O-N 3.08Å; K51-L53 VanDerWaalsContact C-N 3.34Å; L53-L55 PolarHBondContact O-N 3.36Å; L53-A56 PolarHBondContact O-N 3.03Å
54	D	79.7	Confident	84.4	Confident	115 Å²	115	110.5 Å²	110.5	62%	0.615	59%	0.59	S	S	*	*	H	α-helix	trans	-70	-17.8	177.9	-68	-21.3	0	0	0	113	Q50	Q50-D54 PolarHBondContact NE2-OD1 3.38Å; Q50-D54 PolarHBondContact O-N 2.89Å
55	L	70.1	Confident	83.6	Confident	153 Å²	153	112.9 Å²	112.9	80%	0.801	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.3	-6.5	177.4	-76.3	167.9	0	0	0	113.7	K51 L53	K51-L55 WeakPolarHBondContact O-CB 3.34Å; K51-L55 VanDerWaalsContact O-CD1 3.31Å; K51-L55 WeakPolarHBondContact O-CD1 3.45Å; K51-L55 WeakPolarHBondContact O-CG 3.37Å; K51-L55 PolarHBondContact O-N 2.88Å; L53-L55 PolarHBondContact O-N 3.36Å
56	A	57.7	Low	82.9	Confident	139 Å²	139	112.1 Å²	112.1	100%	1.149	61%	0.61	S	S	*	*			trans	-101.7	0	178.8	0	0	0	0	0	111	L53	L53-A56 PolarHBondContact O-N 3.03Å

Retrieved 56 of 56 residues in 107.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).