A0A3Q0KBC1_SCHMA Loading...

GH97_N domain-containing protein

AlphaFold DB , UniProt , Accession A0A3Q0KBC1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 98 aa.

						>A0A3Q0KBC1_SCHMA|A0A3Q0KBC1
MNYLLVTGFFTICLLLPNTFAKRKSETLNVPFHINEKGDMVIEVGGVKFSLNSKQVLKFNDGESKTEIDFGAPTPEELENKHGTRRITEYFNESEEQE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.3	Low	59.4	Low	205 Å²	205	122 Å²	122	100%	1.01	62%	0.622	S	S	*	*				0	-24.8	0	-81.7	163.4	74.7	0	0	114.4
2	N	60.3	Low	59.6	Low	132 Å²	132	120.8 Å²	120.8	71%	0.706	62%	0.616	S	S	*	*	H	α-helix	trans	-69.2	-36.8	178.3	-90.3	-9.6	0	0	0	115.1	L4 L5 V6	N2-L4 VanDerWaalsContact C-N 3.33Å; N2-L4 PolarHBondContact O-N 3.11Å; N2-L5 PolarHBondContact O-N 3.13Å; N2-V6 WeakPolarHBondContact O-CG2 3.42Å; N2-V6 PolarHBondContact O-N 2.92Å
3	Y	59.1	Low	59.7	Low	196 Å²	196	116.5 Å²	116.5	77%	0.769	60%	0.603	S	S	*	*	H	α-helix	trans	-66.7	-34.9	-176.3	-144.6	-94.5	0	0	0	112.9	L5 V6 T7	Y3-L5 PolarHBondContact O-N 2.94Å; Y3-V6 PolarHBondContact O-N 3.16Å; Y3-T7 HydrophobicContact CD1-CG2 4.11Å; Y3-T7 HydrophobicContact CE1-CG2 4.17Å; Y3-T7 WeakPolarHBondContact O-CG2 3Å; Y3-T7 PolarHBondContact O-N 3.36Å; Y3-T7 VanDerWaalsContact O-N 3.14Å; Y3-T7 PolarHBondContact O-OG1 3.13Å
4	L	59.8	Low	59.8	Low	139 Å²	139	118.8 Å²	118.8	73%	0.728	62%	0.615	S	S	*	*	H	α-helix	trans	-67	-32.9	177.1	-91.1	152.9	0	0	0	113.1	N2 T7 G8	N2-L4 VanDerWaalsContact C-N 3.33Å; N2-L4 PolarHBondContact O-N 3.11Å; L4-T7 PolarHBondContact O-OG1 2.9Å; L4-G8 PolarHBondContact O-N 2.96Å
5	L	59.9	Low	59.8	Low	127 Å²	127	119.7 Å²	119.7	67%	0.665	62%	0.62	S	S	*	*	H	α-helix	trans	-74.1	-37.4	177.6	-70.4	170.9	0	0	0	111.5	N2 Y3 F9	N2-L5 PolarHBondContact O-N 3.13Å; Y3-L5 PolarHBondContact O-N 2.94Å; L5-F9 PolarHBondContact O-N 3.49Å
6	V	59.7	Low	59.9	Low	85 Å²	85	120.3 Å²	120.3	52%	0.515	62%	0.624	S	S	.	*	H	α-helix	trans	-70.1	-41.8	179.6	178.9	0	0	0	0	111.4	N2 Y3 G8 F9 F10	N2-V6 WeakPolarHBondContact O-CG2 3.42Å; N2-V6 PolarHBondContact O-N 2.92Å; Y3-V6 PolarHBondContact O-N 3.16Å; V6-G8 VanDerWaalsContact C-N 3.35Å; V6-F9 PolarHBondContact O-N 3.01Å; V6-F10 HydrophobicContact CG1-CD2 4.34Å; V6-F10 HydrophobicContact CG1-CE2 4.49Å; V6-F10 PolarHBondContact O-N 2.99Å
7	T	59.2	Low	59.8	Low	66 Å²	66	119.1 Å²	119.1	41%	0.405	63%	0.625	S	S	.	*	H	α-helix	trans	-68	-35.2	177.4	55.2	0	0	0	0	112.4	Y3 L4 F9 F10 T11	Y3-T7 HydrophobicContact CD1-CG2 4.11Å; Y3-T7 HydrophobicContact CE1-CG2 4.17Å; Y3-T7 WeakPolarHBondContact O-CG2 3Å; Y3-T7 PolarHBondContact O-N 3.36Å; Y3-T7 VanDerWaalsContact O-N 3.14Å; Y3-T7 PolarHBondContact O-OG1 3.13Å; L4-T7 PolarHBondContact O-OG1 2.9Å; T7-F9 VanDerWaalsContact C-N 3.34Å; T7-F9 PolarHBondContact O-N 3.14Å; T7-F10 PolarHBondContact O-N 3.32Å; T7-T11 PolarHBondContact O-N 2.97Å; T7-T11 VanDerWaalsContact O-N 3.17Å; T7-T11 PolarHBondContact O-OG1 2.92Å
8	G	56.4	Low	59.6	Low	31 Å²	31	120.2 Å²	120.2	32%	0.32	63%	0.631	S	S	.	*	H	α-helix	trans	-64.8	-34.1	175.6	0	0	0	0	0	113.8	L4 V6 T11 I12	L4-G8 PolarHBondContact O-N 2.96Å; V6-G8 VanDerWaalsContact C-N 3.35Å; G8-T11 PolarHBondContact O-OG1 2.81Å; G8-I12 PolarHBondContact O-N 2.66Å
9	F	61.1	Low	59.6	Low	139 Å²	139	120.6 Å²	120.6	61%	0.61	64%	0.64	S	S	*	*	H	α-helix	trans	-71.2	-41.4	176.6	-169.6	-99.9	0	0	0	111.9	L5 V6 T7 T11 I12 C13	L5-F9 PolarHBondContact O-N 3.49Å; V6-F9 PolarHBondContact O-N 3.01Å; T7-F9 VanDerWaalsContact C-N 3.34Å; T7-F9 PolarHBondContact O-N 3.14Å; F9-T11 PolarHBondContact O-N 3.29Å; F9-I12 PolarHBondContact O-N 2.93Å; F9-C13 PolarHBondContact O-N 3.3Å
10	F	58.4	Low	59.6	Low	142 Å²	142	123.4 Å²	123.4	62%	0.623	65%	0.646	S	S	*	*	H	α-helix	trans	-64.1	-37.5	177.3	-94.4	-85.3	0	0	0	113	V6 T7 L14	V6-F10 HydrophobicContact CG1-CD2 4.34Å; V6-F10 HydrophobicContact CG1-CE2 4.49Å; V6-F10 PolarHBondContact O-N 2.99Å; T7-F10 PolarHBondContact O-N 3.32Å; F10-L14 PolarHBondContact O-N 3.28Å
11	T	59.8	Low	59.7	Low	80 Å²	80	121.4 Å²	121.4	49%	0.491	65%	0.648	S	S	.	*	H	α-helix	trans	-69.7	-35.5	176	48.5	0	0	0	0	112.5	T7 G8 F9 C13 L14 L15	T7-T11 PolarHBondContact O-N 2.97Å; T7-T11 VanDerWaalsContact O-N 3.17Å; T7-T11 PolarHBondContact O-OG1 2.92Å; G8-T11 PolarHBondContact O-OG1 2.81Å; F9-T11 PolarHBondContact O-N 3.29Å; T11-C13 PolarHBondContact O-N 3.36Å; T11-L14 PolarHBondContact O-N 2.9Å; T11-L15 WeakPolarHBondContact O-CB 3.32Å; T11-L15 WeakPolarHBondContact O-CG 3.34Å; T11-L15 PolarHBondContact O-N 2.83Å; T11-L15 VanDerWaalsContact O-N 3.08Å
12	I	62.6	Low	59.9	Low	108 Å²	108	121 Å²	121	55%	0.554	64%	0.64	S	S	*	*	H	α-helix	trans	-64	-39.4	175.8	-106.2	161.3	0	0	0	112	G8 F9 L15 L16	G8-I12 PolarHBondContact O-N 2.66Å; F9-I12 PolarHBondContact O-N 2.93Å; I12-L15 PolarHBondContact O-N 3.25Å; I12-L16 PolarHBondContact O-N 3.01Å
13	C	60.5	Low	60.2	Low	65 Å²	65	126.4 Å²	126.4	44%	0.439	65%	0.651	S	S	.	*	H	α-helix	trans	-69	-33.9	177.5	-67.6	0	0	0	0	112.8	F9 T11 L15	F9-C13 PolarHBondContact O-N 3.3Å; T11-C13 PolarHBondContact O-N 3.36Å; C13-L15 VanDerWaalsContact C-N 3.3Å
14	L	61.1	Low	61.1	Low	148 Å²	148	125.9 Å²	125.9	78%	0.775	65%	0.653	S	S	*	*	H	α-helix	trans	-71.7	-24.4	173.9	-95.5	137	0	0	0	113	F10 T11	F10-L14 PolarHBondContact O-N 3.28Å; T11-L14 PolarHBondContact O-N 2.9Å
15	L	60.6	Low	62.1	Low	133 Å²	133	124.8 Å²	124.8	70%	0.696	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.6	7.8	177.7	-75	168.7	0	0	0	114.1	T11 I12 C13 P17	T11-L15 WeakPolarHBondContact O-CB 3.32Å; T11-L15 WeakPolarHBondContact O-CG 3.34Å; T11-L15 PolarHBondContact O-N 2.83Å; T11-L15 VanDerWaalsContact O-N 3.08Å; I12-L15 PolarHBondContact O-N 3.25Å; C13-L15 VanDerWaalsContact C-N 3.3Å; L15-P17 WeakPolarHBondContact O-CD 3.35Å
16	L	60.2	Low	63.1	Low	129 Å²	129	126.3 Å²	126.3	68%	0.675	66%	0.66	S	S	*	*	S	Bend	trans	-89.1	84.8	163.2	-69.5	169.2	0	0	0	107.1	I12 N18	I12-L16 PolarHBondContact O-N 3.01Å; L16-N18 PolarHBondContact O-N 3.45Å
17	P	59.1	Low	64.4	Low	99 Å²	99	128.6 Å²	128.6	64%	0.643	67%	0.674	S	S	*	*			trans	-58.7	111.6	176	25.4	-34.3	0	0	0	107.1	L15 T19	L15-P17 WeakPolarHBondContact O-CD 3.35Å; P17-T19 VanDerWaalsContact C-N 3.27Å; P17-T19 WeakPolarHBondContact O-CA 3.35Å; P17-T19 VanDerWaalsContact O-CG2 3.24Å; P17-T19 WeakPolarHBondContact O-CG2 3.43Å; P17-T19 PolarHBondContact O-N 3.06Å
18	N	56.6	Low	65.7	Low	139 Å²	139	131.5 Å²	131.5	74%	0.743	69%	0.687	S	S	*	*			trans	-6.5	78.7	162.5	-121.1	-23.9	0	0	0	112.5	L16 F20	L16-N18 PolarHBondContact O-N 3.45Å; N18-F20 CarbonylContact O-C 3.56Å; N18-F20 PolarHBondContact O-N 2.86Å
19	T	59.2	Low	67.4	Low	128 Å²	128	137.9 Å²	137.9	79%	0.785	71%	0.714	S	S	*	*			trans	-73.5	0	-174.5	48	0	0	0	0	111.4	P17 A21	P17-T19 VanDerWaalsContact C-N 3.27Å; P17-T19 WeakPolarHBondContact O-CA 3.35Å; P17-T19 VanDerWaalsContact O-CG2 3.24Å; P17-T19 WeakPolarHBondContact O-CG2 3.43Å; P17-T19 PolarHBondContact O-N 3.06Å; T19-A21 PolarHBondContact O-N 3.07Å
20	F	59.8	Low	68.8	Low	177 Å²	177	133.7 Å²	133.7	78%	0.776	70%	0.699	S	S	*	*			trans	-69.4	54.1	156.4	-56.8	-76.2	0	0	0	110.8	N18 K22	N18-F20 CarbonylContact O-C 3.56Å; N18-F20 PolarHBondContact O-N 2.86Å; F20-K22 VanDerWaalsContact C-N 3.26Å; F20-K22 PolarHBondContact O-N 3.48Å
21	A	60.4	Low	70.6	Confident	82 Å²	82	132.2 Å²	132.2	68%	0.678	70%	0.704	S	S	*	*			trans	-56.8	102.3	155	0	0	0	0	0	105.4	T19 R23	T19-A21 PolarHBondContact O-N 3.07Å; A21-R23 PolarHBondContact O-N 3.46Å
22	K	65.1	Low	72.3	Confident	196 Å²	196	134.2 Å²	134.2	85%	0.852	71%	0.706	S	S	*	*			trans	-50.8	109	173.2	-72.7	-178.8	178.1	-179.5	0	105.9	F20 K24	F20-K22 VanDerWaalsContact C-N 3.26Å; F20-K22 PolarHBondContact O-N 3.48Å; K22-K24 PolarHBondContact O-N 2.9Å
23	R	66.6	Low	73.9	Confident	245 Å²	245	134.2 Å²	134.2	93%	0.925	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-51.9	118.7	172.6	-74.8	-172.6	-175.6	177.1	1.4	105.6	A21	A21-R23 PolarHBondContact O-N 3.46Å
24	K	76.1	Confident	75.6	Confident	186 Å²	186	135.7 Å²	135.7	81%	0.809	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-63.1	142	173.6	-70.5	-177.4	178.3	179.4	0	106.4	K22 E26	K22-K24 PolarHBondContact O-N 2.9Å; K24-E26 PolarHBondContact O-N 3.4Å
25	S	81.8	Confident	77.3	Confident	116 Å²	116	130.9 Å²	130.9	81%	0.811	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-56.2	123.8	171.3	-174.6	0	0	0	0	108
26	E	81.9	Confident	78.9	Confident	159 Å²	159	134.4 Å²	134.4	74%	0.743	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-103.1	126.3	173	-70.7	179.5	-170.7	0	0	107.9	K24	K24-E26 PolarHBondContact O-N 3.4Å
27	T	86.7	Confident	80.6	Confident	132 Å²	132	136.7 Å²	136.7	81%	0.81	70%	0.699	S	S	*	*	P	Polyproline II helix	trans	-95.5	124.2	172	-58.9	0	0	0	0	107.8
28	L	86.2	Confident	82.3	Confident	127 Å²	127	134.1 Å²	134.1	67%	0.665	69%	0.69	S	S	*	*			trans	-115.7	131.5	179	-61	170.2	0	0	0	108.9	V30	L28-V30 HydrophobicContact CB-CG2 4.39Å
29	N	91.6	Very high	84.2	Confident	165 Å²	165	128.8 Å²	128.8	88%	0.882	66%	0.662	S	S	*	*			trans	-87	116.8	167.2	-67.7	-42	0	0	0	107.8
30	V	91.6	Very high	86.1	Confident	51 Å²	51	126.5 Å²	126.5	31%	0.309	64%	0.643	S	S	.	*			trans	-109.8	129.9	-179.1	-176.2	0	0	0	0	108.5	L28 I42 E43 V44	L28-V30 HydrophobicContact CB-CG2 4.39Å; V30-I42 HydrophobicContact CB-CD1 3.71Å; V30-I42 HydrophobicContact CB-CG1 4.16Å; V30-I42 HydrophobicContact CG1-CD1 3.71Å; V30-I42 HydrophobicContact CG1-CG1 3.56Å; V30-E43 WeakPolarHBondContact CG1-O 3.37Å; V30-V44 HydrophobicContact CB-CG2 4.5Å; V30-V44 HydrophobicContact CG1-CG2 4.04Å; V30-V44 HydrophobicContact CG2-CG2 4.18Å
31	P	94.5	Very high	87.8	Confident	112 Å²	112	118.4 Å²	118.4	73%	0.727	61%	0.608	S	S	*	*			trans	-66.8	143.8	176.3	29.1	-34.4	0	0	0	110.4
32	F	96.3	Very high	89.6	Confident	121 Å²	121	117.1 Å²	117.1	53%	0.531	59%	0.589	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.4	160.6	166.3	71	-91.5	0	0	0	109.4	I34 M40 V41 I42	F32-I34 HydrophobicContact CD2-CD1 4.09Å; F32-I34 HydrophobicContact CE2-CD1 3.95Å; F32-I34 HydrophobicContact CE2-CG1 4.45Å; F32-M40 HydrophobicContact CB-CG 4.09Å; F32-M40 HydrophobicContact CD2-CE 4.07Å; F32-M40 HydrophobicContact CD2-CG 3.71Å; F32-M40 HydrophobicContact CD2-SD 4.21Å; F32-M40 HydrophobicContact CE2-CE 3.86Å; F32-M40 HydrophobicContact CE2-CG 4.41Å; F32-M40 HydrophobicContact CG-CG 4.03Å; F32-M40 HydrophobicContact CG-SD 4.26Å; F32-M40 HydrophobicContact CZ-CE 4.16Å; F32-V41 CarbonylContact C-O 3.55Å; F32-V41 VanDerWaalsContact CA-O 3.25Å; F32-V41 WeakPolarHBondContact CA-O 3.47Å; F32-V41 WeakPolarHBondContact CB-O 3.21Å; F32-I42 HydrophobicContact CB-CB 4.31Å
33	H	96.5	Very high	90.9	Very high	108 Å²	108	113 Å²	113	50%	0.5	57%	0.573	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-128.1	162.3	166.8	65.2	-81.1	0	0	0	109.8	V41	H33-V41 VanDerWaalsContact CE1-CB 3.47Å; H33-V41 WeakPolarHBondContact CE1-CB 3.33Å; H33-V41 VanDerWaalsContact CE1-CG1 3.44Å; H33-V41 WeakPolarHBondContact CE1-CG1 3.4Å; H33-V41 PolarHBondContact N-O 3.06Å; H33-V41 PolarHBondContact ND1-O 2.9Å; H33-V41 PolarHBondContact O-N 2.82Å
34	I	96.9	Very high	92.1	Very high	96 Å²	96	104.4 Å²	104.4	49%	0.492	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	123.8	169.6	-54.3	-54.6	0	0	0	107.1	F32 D39 M40	F32-I34 HydrophobicContact CD2-CD1 4.09Å; F32-I34 HydrophobicContact CE2-CD1 3.95Å; F32-I34 HydrophobicContact CE2-CG1 4.45Å; I34-D39 WeakPolarHBondContact CA-O 3.4Å; I34-M40 HydrophobicContact CD1-CB 3.89Å; I34-M40 HydrophobicContact CD1-CG 4.27Å
35	N	95.7	Very high	92.6	Very high	47 Å²	47	99.6 Å²	99.6	25%	0.251	55%	0.551	S	S	.	*			trans	-78.5	175.9	178	74.1	14.1	0	0	0	111.3	K37 G38 D39 V41	N35-K37 PolarHBondContact O-N 3.32Å; N35-K37 VanDerWaalsContact O-N 3.11Å; N35-K37 WeakPolarHBondContact OD1-CA 3.43Å; N35-K37 WeakPolarHBondContact OD1-CB 3.48Å; N35-K37 PolarHBondContact OD1-N 3.41Å; N35-G38 PolarHBondContact O-N 2.89Å; N35-G38 PolarHBondContact OD1-N 2.81Å; N35-G38 VanDerWaalsContact OD1-N 3.13Å; N35-D39 PolarHBondContact N-O 2.96Å; N35-D39 PolarHBondContact ND2-OD2 2.82Å; N35-D39 PolarHBondContact OD1-N 3.49Å; N35-V41 HydrophobicContact CB-CG2 4.19Å
36	E	95	Very high	92.9	Very high	207 Å²	207	97.1 Å²	97.1	97%	0.967	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-21.3	179.8	-61.8	179.3	173.1	0	0	114	G38	E36-G38 VanDerWaalsContact C-N 3.3Å
37	K	95.1	Very high	93.3	Very high	177 Å²	177	91.6 Å²	91.6	77%	0.77	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.4	-6	176.5	-59.1	-178.3	-179.6	177.9	0	112.7	N35 D39	N35-K37 PolarHBondContact O-N 3.32Å; N35-K37 VanDerWaalsContact O-N 3.11Å; N35-K37 WeakPolarHBondContact OD1-CA 3.43Å; N35-K37 WeakPolarHBondContact OD1-CB 3.48Å; N35-K37 PolarHBondContact OD1-N 3.41Å; K37-D39 VanDerWaalsContact C-N 3.35Å
38	G	95.1	Very high	93.7	Very high	45 Å²	45	91 Å²	91	46%	0.464	51%	0.507	S	S	.	.	S	Bend	trans	83.1	9.2	-174.4	0	0	0	0	0	114	N35 E36	N35-G38 PolarHBondContact O-N 2.89Å; N35-G38 PolarHBondContact OD1-N 2.81Å; N35-G38 VanDerWaalsContact OD1-N 3.13Å; E36-G38 VanDerWaalsContact C-N 3.3Å
39	D	96.8	Very high	94.2	Very high	28 Å²	28	87.8 Å²	87.8	15%	0.15	49%	0.488	C	S	.	.			trans	-79.5	138.6	176.7	-50.3	-35	0	0	0	109.8	I34 N35 K37 L51 N52	I34-D39 WeakPolarHBondContact CA-O 3.4Å; N35-D39 PolarHBondContact N-O 2.96Å; N35-D39 PolarHBondContact ND2-OD2 2.82Å; N35-D39 PolarHBondContact OD1-N 3.49Å; K37-D39 VanDerWaalsContact C-N 3.35Å; D39-L51 WeakPolarHBondContact CA-O 3.3Å; D39-N52 VanDerWaalsContact OD1-CA 3.32Å; D39-N52 WeakPolarHBondContact OD1-CA 3.36Å; D39-N52 WeakPolarHBondContact OD1-CB 3.29Å
40	M	97.6	Very high	94.4	Very high	79 Å²	79	81.2 Å²	81.2	39%	0.389	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	125.7	168.5	179.7	-178.8	-68.5	0	0	109.1	F32 I34 S50 L51	F32-M40 HydrophobicContact CB-CG 4.09Å; F32-M40 HydrophobicContact CD2-CE 4.07Å; F32-M40 HydrophobicContact CD2-CG 3.71Å; F32-M40 HydrophobicContact CD2-SD 4.21Å; F32-M40 HydrophobicContact CE2-CE 3.86Å; F32-M40 HydrophobicContact CE2-CG 4.41Å; F32-M40 HydrophobicContact CG-CG 4.03Å; F32-M40 HydrophobicContact CG-SD 4.26Å; F32-M40 HydrophobicContact CZ-CE 4.16Å; I34-M40 HydrophobicContact CD1-CB 3.89Å; I34-M40 HydrophobicContact CD1-CG 4.27Å; M40-S50 CarbonylContact O-C 3.54Å; M40-S50 VanDerWaalsContact O-CA 3.25Å; M40-S50 WeakPolarHBondContact O-CA 3.34Å; M40-L51 PolarHBondContact N-O 2.97Å; M40-L51 PolarHBondContact O-N 3.11Å
41	V	97	Very high	94.7	Very high	7 Å²	7	81.9 Å²	81.9	4%	0.042	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	128.4	-178	-177	0	0	0	0	109.9	F32 H33 N35 K48 F49	F32-V41 CarbonylContact C-O 3.55Å; F32-V41 VanDerWaalsContact CA-O 3.25Å; F32-V41 WeakPolarHBondContact CA-O 3.47Å; F32-V41 WeakPolarHBondContact CB-O 3.21Å; H33-V41 VanDerWaalsContact CE1-CB 3.47Å; H33-V41 WeakPolarHBondContact CE1-CB 3.33Å; H33-V41 VanDerWaalsContact CE1-CG1 3.44Å; H33-V41 WeakPolarHBondContact CE1-CG1 3.4Å; H33-V41 PolarHBondContact N-O 3.06Å; H33-V41 PolarHBondContact ND1-O 2.9Å; H33-V41 PolarHBondContact O-N 2.82Å; N35-V41 HydrophobicContact CB-CG2 4.19Å; V41-K48 HydrophobicContact CG1-CD 3.92Å; V41-K48 HydrophobicContact CG1-CG 3.7Å; V41-F49 VanDerWaalsContact CA-O 3.32Å; V41-F49 WeakPolarHBondContact CA-O 3.25Å
42	I	96.5	Very high	94.8	Very high	55 Å²	55	78.1 Å²	78.1	28%	0.282	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	143.6	178	-175.5	169.8	0	0	0	109	V30 F32 V44 F49	V30-I42 HydrophobicContact CB-CD1 3.71Å; V30-I42 HydrophobicContact CB-CG1 4.16Å; V30-I42 HydrophobicContact CG1-CD1 3.71Å; V30-I42 HydrophobicContact CG1-CG1 3.56Å; F32-I42 HydrophobicContact CB-CB 4.31Å; I42-V44 HydrophobicContact CD1-CG2 4.21Å; I42-V44 HydrophobicContact CG1-CG2 4.06Å; I42-F49 HydrophobicContact CG2-CB 3.74Å; I42-F49 HydrophobicContact CG2-CD2 4.38Å; I42-F49 HydrophobicContact CG2-CG 4.45Å; I42-F49 PolarHBondContact N-O 2.83Å; I42-F49 PolarHBondContact O-N 2.85Å
43	E	93.6	Very high	94.7	Very high	109 Å²	109	77.8 Å²	77.8	51%	0.509	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	123.2	178.4	-169.3	172.5	150.9	0	0	109.7	V30 V47	V30-E43 WeakPolarHBondContact CG1-O 3.37Å; E43-V47 WeakPolarHBondContact CA-O 3.47Å
44	V	90.9	Very high	94.6	Very high	66 Å²	66	80.4 Å²	80.4	40%	0.4	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	121.1	-178.5	-173.5	0	0	0	0	108.4	V30 I42 G46 V47 F49	V30-V44 HydrophobicContact CB-CG2 4.5Å; V30-V44 HydrophobicContact CG1-CG2 4.04Å; V30-V44 HydrophobicContact CG2-CG2 4.18Å; I42-V44 HydrophobicContact CD1-CG2 4.21Å; I42-V44 HydrophobicContact CG1-CG2 4.06Å; V44-G46 PolarHBondContact O-N 2.77Å; V44-V47 PolarHBondContact N-O 2.75Å; V44-V47 PolarHBondContact O-N 3.17Å; V44-F49 HydrophobicContact CB-CE2 4.32Å
45	G	87.9	Confident	94.5	Very high	85 Å²	85	80.1 Å²	80.1	88%	0.876	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.2	30.9	177	0	0	0	0	0	114.2	V47	G45-V47 VanDerWaalsContact C-N 3.26Å; G45-V47 PolarHBondContact O-N 3.35Å
46	G	87.4	Confident	94.6	Very high	63 Å²	63	79 Å²	79	65%	0.649	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	81	-2.5	-176.9	0	0	0	0	0	114.8	V44	V44-G46 PolarHBondContact O-N 2.77Å
47	V	91.3	Very high	94.7	Very high	43 Å²	43	71 Å²	71	26%	0.261	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	123.9	174	-176	0	0	0	0	109.2	E43 V44 G45 F49 F59	E43-V47 WeakPolarHBondContact CA-O 3.47Å; V44-V47 PolarHBondContact N-O 2.75Å; V44-V47 PolarHBondContact O-N 3.17Å; G45-V47 VanDerWaalsContact C-N 3.26Å; G45-V47 PolarHBondContact O-N 3.35Å; V47-F49 HydrophobicContact CB-CE2 3.77Å; V47-F49 HydrophobicContact CB-CZ 3.98Å; V47-F49 HydrophobicContact CG1-CD2 4.27Å; V47-F49 HydrophobicContact CG1-CE1 4.04Å; V47-F49 HydrophobicContact CG1-CE2 3.62Å; V47-F49 HydrophobicContact CG1-CZ 3.48Å; V47-F49 VanDerWaalsContact CG1-CZ 3.48Å; V47-F49 WeakPolarHBondContact O-CD2 3.25Å; V47-F49 WeakPolarHBondContact O-CE2 3.41Å; V47-F59 HydrophobicContact CG1-CB 4.3Å; V47-F59 HydrophobicContact CG1-CD2 4.47Å
48	K	94	Very high	94.7	Very high	120 Å²	120	65 Å²	65	52%	0.522	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	121.7	176.9	-173.5	175	-66.1	177.2	0	110.2	V41 F59	V41-K48 HydrophobicContact CG1-CD 3.92Å; V41-K48 HydrophobicContact CG1-CG 3.7Å; K48-F59 WeakPolarHBondContact O-CA 3.1Å
49	F	96.4	Very high	94.8	Very high	60 Å²	60	65.1 Å²	65.1	26%	0.263	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	140.3	173.3	-55.9	-93.3	0	0	0	109.2	V41 I42 V44 V47 L57 K58 F59	V41-F49 VanDerWaalsContact CA-O 3.32Å; V41-F49 WeakPolarHBondContact CA-O 3.25Å; I42-F49 HydrophobicContact CG2-CB 3.74Å; I42-F49 HydrophobicContact CG2-CD2 4.38Å; I42-F49 HydrophobicContact CG2-CG 4.45Å; I42-F49 PolarHBondContact N-O 2.83Å; I42-F49 PolarHBondContact O-N 2.85Å; V44-F49 HydrophobicContact CB-CE2 4.32Å; V47-F49 HydrophobicContact CB-CE2 3.77Å; V47-F49 HydrophobicContact CB-CZ 3.98Å; V47-F49 HydrophobicContact CG1-CD2 4.27Å; V47-F49 HydrophobicContact CG1-CE1 4.04Å; V47-F49 HydrophobicContact CG1-CE2 3.62Å; V47-F49 HydrophobicContact CG1-CZ 3.48Å; V47-F49 VanDerWaalsContact CG1-CZ 3.48Å; V47-F49 WeakPolarHBondContact O-CD2 3.25Å; V47-F49 WeakPolarHBondContact O-CE2 3.41Å; F49-L57 HydrophobicContact CB-CD1 4.2Å; F49-L57 HydrophobicContact CD1-CD1 4.47Å; F49-K58 CarbonylContact C-O 3.48Å; F49-K58 WeakPolarHBondContact CA-O 3.42Å; F49-F59 HydrophobicContact CD1-CB 3.6Å; F49-F59 HydrophobicContact CD1-CD1 4.36Å; F49-F59 HydrophobicContact CD1-CG 4.1Å; F49-F59 HydrophobicContact CE1-CB 3.89Å; F49-F59 HydrophobicContact CE1-CD1 4.39Å; F49-F59 HydrophobicContact CE1-CD2 4.47Å; F49-F59 HydrophobicContact CE1-CG 4.01Å; F49-F59 HydrophobicContact CG-CB 4.31Å
50	S	97.1	Very high	94.6	Very high	26 Å²	26	68 Å²	68	18%	0.182	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	134.3	174.3	60.5	0	0	0	0	110.6	M40 L57 K58	M40-S50 CarbonylContact O-C 3.54Å; M40-S50 VanDerWaalsContact O-CA 3.25Å; M40-S50 WeakPolarHBondContact O-CA 3.34Å; S50-L57 CarbonylContact O-C 3.53Å; S50-L57 WeakPolarHBondContact O-CA 3.23Å; S50-K58 PolarHBondContact N-O 3.42Å; S50-K58 PolarHBondContact O-N 3.03Å; S50-K58 WeakPolarHBondContact OG-CB 3.24Å; S50-K58 PolarHBondContact OG-O 2.82Å
51	L	97.5	Very high	94	Very high	66 Å²	66	68.3 Å²	68.3	35%	0.346	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	119.5	177.2	-176.3	69	0	0	0	108.7	D39 M40 L57	D39-L51 WeakPolarHBondContact CA-O 3.3Å; M40-L51 PolarHBondContact N-O 2.97Å; M40-L51 PolarHBondContact O-N 3.11Å; L51-L57 HydrophobicContact CD1-CB 4.23Å
52	N	95.7	Very high	93.5	Very high	32 Å²	32	71.3 Å²	71.3	17%	0.171	42%	0.42	C	S	.	.			trans	-90.1	175	-179.6	72.7	15.2	0	0	0	112.8	D39 K54 Q55 V56	D39-N52 VanDerWaalsContact OD1-CA 3.32Å; D39-N52 WeakPolarHBondContact OD1-CA 3.36Å; D39-N52 WeakPolarHBondContact OD1-CB 3.29Å; N52-K54 PolarHBondContact O-N 2.8Å; N52-K54 VanDerWaalsContact O-N 3.13Å; N52-K54 WeakPolarHBondContact OD1-CA 3.5Å; N52-K54 WeakPolarHBondContact OD1-CB 3.38Å; N52-K54 PolarHBondContact OD1-N 2.8Å; N52-Q55 PolarHBondContact O-N 2.9Å; N52-Q55 PolarHBondContact OD1-N 3.06Å; N52-Q55 VanDerWaalsContact OD1-N 3.16Å; N52-V56 PolarHBondContact N-O 2.99Å; N52-V56 PolarHBondContact OD1-N 2.82Å
53	S	93.7	Very high	93	Very high	114 Å²	114	76.4 Å²	76.4	80%	0.797	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.1	-18	178	58.8	0	0	0	0	114.8	Q55	S53-Q55 VanDerWaalsContact C-N 3.31Å
54	K	94.6	Very high	92.8	Very high	163 Å²	163	71.4 Å²	71.4	71%	0.709	42%	0.42	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.9	7.6	174	-60.8	-176.9	-180	-179.4	0	112.7	N52 V56	N52-K54 PolarHBondContact O-N 2.8Å; N52-K54 VanDerWaalsContact O-N 3.13Å; N52-K54 WeakPolarHBondContact OD1-CA 3.5Å; N52-K54 WeakPolarHBondContact OD1-CB 3.38Å; N52-K54 PolarHBondContact OD1-N 2.8Å; K54-V56 HydrophobicContact CB-CG2 4.34Å; K54-V56 PolarHBondContact O-N 2.85Å
55	Q	95.4	Very high	92.9	Very high	90 Å²	90	72.4 Å²	72.4	42%	0.421	42%	0.418	S	S	.	.			trans	61.3	29.5	-177	-53.3	179.3	52.4	0	0	113.3	N52 S53 F70	N52-Q55 PolarHBondContact O-N 2.9Å; N52-Q55 PolarHBondContact OD1-N 3.06Å; N52-Q55 VanDerWaalsContact OD1-N 3.16Å; S53-Q55 VanDerWaalsContact C-N 3.31Å; Q55-F70 HydrophobicContact CB-CB 4.39Å; Q55-F70 WeakPolarHBondContact O-CA 3.37Å; Q55-F70 VanDerWaalsContact O-CB 3.29Å; Q55-F70 WeakPolarHBondContact O-CB 3.33Å; Q55-F70 PolarHBondContact O-N 2.86Å; Q55-F70 PolarHBondContact OE1-O 2.85Å
56	V	97	Very high	93.3	Very high	24 Å²	24	68.5 Å²	68.5	15%	0.145	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	114.5	170	-178.1	0	0	0	0	108.5	N52 K54 K58 E67 I68	N52-V56 PolarHBondContact N-O 2.99Å; N52-V56 PolarHBondContact OD1-N 2.82Å; K54-V56 HydrophobicContact CB-CG2 4.34Å; K54-V56 PolarHBondContact O-N 2.85Å; V56-K58 HydrophobicContact CG1-CG 4.27Å; V56-E67 HydrophobicContact CG1-CB 4.06Å; V56-I68 CarbonylContact C-O 3.59Å; V56-I68 WeakPolarHBondContact CA-O 3.43Å
57	L	97.2	Very high	93.8	Very high	39 Å²	39	67 Å²	67	20%	0.204	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.6	131.4	172.3	180	68.2	0	0	0	109.1	F49 S50 L51 E67 I68 F70	F49-L57 HydrophobicContact CB-CD1 4.2Å; F49-L57 HydrophobicContact CD1-CD1 4.47Å; S50-L57 CarbonylContact O-C 3.53Å; S50-L57 WeakPolarHBondContact O-CA 3.23Å; L51-L57 HydrophobicContact CD1-CB 4.23Å; L57-E67 CarbonylContact O-C 3.49Å; L57-E67 WeakPolarHBondContact O-CA 3.37Å; L57-I68 PolarHBondContact N-O 2.91Å; L57-I68 PolarHBondContact O-N 3.11Å; L57-F70 HydrophobicContact CB-CD2 3.72Å; L57-F70 HydrophobicContact CB-CE2 3.88Å; L57-F70 HydrophobicContact CD2-CD2 4.35Å; L57-F70 HydrophobicContact CD2-CE2 3.71Å; L57-F70 HydrophobicContact CG-CE2 4.45Å
58	K	97	Very high	94.1	Very high	51 Å²	51	66.4 Å²	66.4	22%	0.222	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	136.3	174.8	-35.8	-175.1	171.7	-150.1	0	110.6	F49 S50 V56 T66 E67	F49-K58 CarbonylContact C-O 3.48Å; F49-K58 WeakPolarHBondContact CA-O 3.42Å; S50-K58 PolarHBondContact N-O 3.42Å; S50-K58 PolarHBondContact O-N 3.03Å; S50-K58 WeakPolarHBondContact OG-CB 3.24Å; S50-K58 PolarHBondContact OG-O 2.82Å; V56-K58 HydrophobicContact CG1-CG 4.27Å; K58-T66 VanDerWaalsContact CA-O 3.23Å; K58-T66 WeakPolarHBondContact CA-O 3.36Å; K58-E67 HydrophobicContact CB-CG 4.21Å; K58-E67 HydrophobicContact CD-CG 3.98Å; K58-E67 WeakPolarHBondContact CD-OE1 3.5Å; K58-E67 VanDerWaalsContact CE-CD 3.49Å; K58-E67 WeakPolarHBondContact CE-OE1 3.5Å; K58-E67 WeakPolarHBondContact CE-OE2 3.4Å; K58-E67 HydrophobicContact CG-CG 3.87Å; K58-E67 IonicContact NZ-OE1 2.77Å; K58-E67 PolarHBondContact NZ-OE1 2.98Å; K58-E67 IonicContact NZ-OE2 3.06Å; K58-E67 PolarHBondContact NZ-OE2 2.86Å
59	F	95.9	Very high	94.2	Very high	47 Å²	47	63.2 Å²	63.2	21%	0.206	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.6	166.2	171.4	66.7	-83.4	0	0	0	110.3	V47 K48 F49 D61 K65 T66 I68	V47-F59 HydrophobicContact CG1-CB 4.3Å; V47-F59 HydrophobicContact CG1-CD2 4.47Å; K48-F59 WeakPolarHBondContact O-CA 3.1Å; F49-F59 HydrophobicContact CD1-CB 3.6Å; F49-F59 HydrophobicContact CD1-CD1 4.36Å; F49-F59 HydrophobicContact CD1-CG 4.1Å; F49-F59 HydrophobicContact CE1-CB 3.89Å; F49-F59 HydrophobicContact CE1-CD1 4.39Å; F49-F59 HydrophobicContact CE1-CD2 4.47Å; F49-F59 HydrophobicContact CE1-CG 4.01Å; F49-F59 HydrophobicContact CG-CB 4.31Å; F59-D61 HydrophobicContact CD2-CB 4.48Å; F59-D61 HydrophobicContact CE2-CB 4.3Å; F59-K65 WeakPolarHBondContact O-CA 3.44Å; F59-T66 HydrophobicContact CE1-CG2 3.76Å; F59-T66 HydrophobicContact CZ-CG2 3.85Å; F59-T66 PolarHBondContact N-O 2.95Å; F59-T66 PolarHBondContact O-N 2.88Å; F59-I68 HydrophobicContact CE1-CD1 4.09Å
60	N	92.1	Very high	94	Very high	90 Å²	90	65.5 Å²	65.5	48%	0.481	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	123	173.2	-177.5	-28.7	0	0	0	107.3	G62 S64	N60-G62 WeakPolarHBondContact OD1-CA 3.32Å; N60-G62 PolarHBondContact OD1-N 2.95Å; N60-S64 WeakPolarHBondContact CA-O 3.24Å; N60-S64 PolarHBondContact OD1-O 3.23Å
61	D	85.8	Confident	93.8	Very high	85 Å²	85	65.1 Å²	65.1	46%	0.455	35%	0.348	S	S	.	.			trans	-93.9	1.7	-178.2	59.7	12.4	0	0	0	113.6	F59 E63 S64	F59-D61 HydrophobicContact CD2-CB 4.48Å; F59-D61 HydrophobicContact CE2-CB 4.3Å; D61-E63 PolarHBondContact OD1-N 3.01Å; D61-S64 PolarHBondContact N-O 3.24Å; D61-S64 PolarHBondContact OD1-N 2.79Å
62	G	85.8	Confident	93.6	Very high	69 Å²	69	65.3 Å²	65.3	71%	0.711	36%	0.359	S	S	*	.	S	Bend	trans	102	-23.9	-176.7	0	0	0	0	0	113.3	N60	N60-G62 WeakPolarHBondContact OD1-CA 3.32Å; N60-G62 PolarHBondContact OD1-N 2.95Å
63	E	86.8	Confident	93.6	Very high	162 Å²	162	67.2 Å²	67.2	76%	0.757	37%	0.373	S	S	*	.	S	Bend	trans	-104.4	-37.1	179.8	-62.6	-174.6	174	0	0	111.3	D61	D61-E63 PolarHBondContact OD1-N 3.01Å
64	S	89.2	Confident	93.6	Very high	5 Å²	5	65 Å²	65	4%	0.035	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	155.5	-177.1	74	0	0	0	0	111.8	N60 D61 T66 Y90	N60-S64 WeakPolarHBondContact CA-O 3.24Å; N60-S64 PolarHBondContact OD1-O 3.23Å; D61-S64 PolarHBondContact N-O 3.24Å; D61-S64 PolarHBondContact OD1-N 2.79Å; S64-T66 PolarHBondContact OG-OG1 3.18Å; S64-Y90 WeakPolarHBondContact CA-O 3.47Å
65	K	94	Very high	93.8	Very high	86 Å²	86	62.4 Å²	62.4	37%	0.374	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	125.3	162.9	178.7	-173	167.1	-151.6	0	108	F59 E67 E89 Y90	F59-K65 WeakPolarHBondContact O-CA 3.44Å; K65-E67 VanDerWaalsContact CE-OE1 3.24Å; K65-E67 WeakPolarHBondContact CE-OE1 3.39Å; K65-E67 IonicContact NZ-OE1 3.42Å; K65-E67 PolarHBondContact NZ-OE1 3.28Å; K65-E89 WeakPolarHBondContact O-CA 3.4Å; K65-Y90 HydrophobicContact CB-CD2 4.43Å; K65-Y90 HydrophobicContact CD-CD2 4.43Å; K65-Y90 HydrophobicContact CG-CD2 4.42Å; K65-Y90 PolarHBondContact N-O 3.14Å; K65-Y90 WeakPolarHBondContact O-CD2 3.44Å; K65-Y90 PolarHBondContact O-N 3.43Å
66	T	96.3	Very high	93.8	Very high	4 Å²	4	64.5 Å²	64.5	3%	0.025	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	135.3	-178.9	-57.9	0	0	0	0	110.5	K58 F59 S64 I68 I87 E89	K58-T66 VanDerWaalsContact CA-O 3.23Å; K58-T66 WeakPolarHBondContact CA-O 3.36Å; F59-T66 HydrophobicContact CE1-CG2 3.76Å; F59-T66 HydrophobicContact CZ-CG2 3.85Å; F59-T66 PolarHBondContact N-O 2.95Å; F59-T66 PolarHBondContact O-N 2.88Å; S64-T66 PolarHBondContact OG-OG1 3.18Å; T66-I68 HydrophobicContact CG2-CD1 4.47Å; T66-I68 HydrophobicContact CG2-CG1 4.04Å; T66-I87 HydrophobicContact CG2-CG2 3.88Å; T66-E89 HydrophobicContact CG2-CG 4.13Å
67	E	97.3	Very high	93.9	Very high	31 Å²	31	65.1 Å²	65.1	15%	0.145	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	127.3	171.7	-58.6	-166.7	177.9	0	0	110	V56 L57 K58 K65 I87 T88 Y90	V56-E67 HydrophobicContact CG1-CB 4.06Å; L57-E67 CarbonylContact O-C 3.49Å; L57-E67 WeakPolarHBondContact O-CA 3.37Å; K58-E67 HydrophobicContact CB-CG 4.21Å; K58-E67 HydrophobicContact CD-CG 3.98Å; K58-E67 WeakPolarHBondContact CD-OE1 3.5Å; K58-E67 VanDerWaalsContact CE-CD 3.49Å; K58-E67 WeakPolarHBondContact CE-OE1 3.5Å; K58-E67 WeakPolarHBondContact CE-OE2 3.4Å; K58-E67 HydrophobicContact CG-CG 3.87Å; K58-E67 IonicContact NZ-OE1 2.77Å; K58-E67 PolarHBondContact NZ-OE1 2.98Å; K58-E67 IonicContact NZ-OE2 3.06Å; K58-E67 PolarHBondContact NZ-OE2 2.86Å; K65-E67 VanDerWaalsContact CE-OE1 3.24Å; K65-E67 WeakPolarHBondContact CE-OE1 3.39Å; K65-E67 IonicContact NZ-OE1 3.42Å; K65-E67 PolarHBondContact NZ-OE1 3.28Å; E67-I87 CarbonylContact O-C 3.6Å; E67-I87 WeakPolarHBondContact O-CA 3.37Å; E67-T88 PolarHBondContact N-O 3.23Å; E67-T88 PolarHBondContact O-N 3.26Å; E67-Y90 HydrophobicContact CG-CE2 3.94Å
68	I	96.8	Very high	93.9	Very high	31 Å²	31	68.7 Å²	68.7	16%	0.159	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	127	179.3	-51.4	179.2	0	0	0	108.9	V56 L57 F59 T66 F70 I87	V56-I68 CarbonylContact C-O 3.59Å; V56-I68 WeakPolarHBondContact CA-O 3.43Å; L57-I68 PolarHBondContact N-O 2.91Å; L57-I68 PolarHBondContact O-N 3.11Å; F59-I68 HydrophobicContact CE1-CD1 4.09Å; T66-I68 HydrophobicContact CG2-CD1 4.47Å; T66-I68 HydrophobicContact CG2-CG1 4.04Å; I68-F70 HydrophobicContact CB-CD2 4.09Å; I68-F70 HydrophobicContact CB-CE2 3.72Å; I68-F70 HydrophobicContact CD1-CE2 4.32Å; I68-F70 HydrophobicContact CG2-CD2 3.79Å; I68-F70 HydrophobicContact CG2-CE2 3.39Å; I68-F70 HydrophobicContact CG2-CZ 3.99Å; I68-F70 PolarHBondContact O-N 2.85Å; I68-I87 HydrophobicContact CG1-CG1 4.3Å; I68-I87 HydrophobicContact CG1-CG2 4.43Å; I68-I87 HydrophobicContact CG2-CG1 4.36Å
69	D	95.8	Very high	93.9	Very high	53 Å²	53	73.9 Å²	73.9	28%	0.283	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.6	116	172	-167.9	-16.5	0	0	0	110.4	G71 R85 R86	D69-G71 WeakPolarHBondContact OD1-CA 3.45Å; D69-G71 PolarHBondContact OD1-N 2.85Å; D69-R85 WeakPolarHBondContact O-CB 3.38Å; D69-R85 WeakPolarHBondContact O-CD 3.39Å; D69-R85 VanDerWaalsContact O-CG 3.24Å; D69-R85 WeakPolarHBondContact O-CG 3.32Å; D69-R86 PolarHBondContact N-O 3.26Å
70	F	94.1	Very high	93.9	Very high	107 Å²	107	75.1 Å²	75.1	47%	0.469	42%	0.418	S	S	.	.			trans	-108.9	24.2	172.3	-79.7	-85.5	0	0	0	112.2	Q55 L57 I68 A72	Q55-F70 HydrophobicContact CB-CB 4.39Å; Q55-F70 WeakPolarHBondContact O-CA 3.37Å; Q55-F70 VanDerWaalsContact O-CB 3.29Å; Q55-F70 WeakPolarHBondContact O-CB 3.33Å; Q55-F70 PolarHBondContact O-N 2.86Å; Q55-F70 PolarHBondContact OE1-O 2.85Å; L57-F70 HydrophobicContact CB-CD2 3.72Å; L57-F70 HydrophobicContact CB-CE2 3.88Å; L57-F70 HydrophobicContact CD2-CD2 4.35Å; L57-F70 HydrophobicContact CD2-CE2 3.71Å; L57-F70 HydrophobicContact CG-CE2 4.45Å; I68-F70 HydrophobicContact CB-CD2 4.09Å; I68-F70 HydrophobicContact CB-CE2 3.72Å; I68-F70 HydrophobicContact CD1-CE2 4.32Å; I68-F70 HydrophobicContact CG2-CD2 3.79Å; I68-F70 HydrophobicContact CG2-CE2 3.39Å; I68-F70 HydrophobicContact CG2-CZ 3.99Å; I68-F70 PolarHBondContact O-N 2.85Å; F70-A72 PolarHBondContact O-N 2.85Å
71	G	92.9	Very high	94.1	Very high	19 Å²	19	80 Å²	80	20%	0.196	44%	0.435	C	S	.	.	P	Polyproline II helix	trans	-46.7	142.8	172.3	0	0	0	0	0	112.2	D69 R85	D69-G71 WeakPolarHBondContact OD1-CA 3.45Å; D69-G71 PolarHBondContact OD1-N 2.85Å; G71-R85 PolarHBondContact O-NE 3.17Å; G71-R85 PolarHBondContact O-NH2 3.38Å
72	A	92.5	Very high	94.5	Very high	69 Å²	69	82.2 Å²	82.2	57%	0.57	44%	0.443	S	S	*	.	P	Polyproline II helix	trans	-50.1	139.1	-179.2	0	0	0	0	0	110.9	F70	F70-A72 PolarHBondContact O-N 2.85Å
73	P	94.9	Very high	94.9	Very high	72 Å²	72	81.1 Å²	81.1	47%	0.468	43%	0.432	S	S	.	.	P	Polyproline II helix	trans	-54.6	142.3	178.1	-27.3	35.7	0	0	0	113.2	E77 L78	P73-E77 WeakPolarHBondContact CA-OE2 3.42Å; P73-E77 HydrophobicContact CB-CB 4.27Å; P73-L78 HydrophobicContact CB-CD2 3.74Å; P73-L78 HydrophobicContact CB-CG 3.81Å; P73-L78 HydrophobicContact CG-CD2 4.17Å
74	T	95.2	Very high	95.3	Very high	67 Å²	67	79.4 Å²	79.4	41%	0.411	43%	0.432	S	S	.	.	P	Polyproline II helix	trans	-72.3	161.3	169.1	73.9	0	0	0	0	110.4	E76 E77 L78	T74-E76 VanDerWaalsContact C-N 3.25Å; T74-E76 PolarHBondContact O-N 2.69Å; T74-E77 PolarHBondContact N-OE2 3.04Å; T74-E77 PolarHBondContact O-N 2.9Å; T74-E77 VanDerWaalsContact O-N 3.14Å; T74-E77 VanDerWaalsContact OG1-CG 3.3Å; T74-E77 WeakPolarHBondContact OG1-CG 3.33Å; T74-E77 PolarHBondContact OG1-N 3.18Å; T74-L78 WeakPolarHBondContact O-CG 3.39Å; T74-L78 PolarHBondContact O-N 3.39Å
75	P	97.4	Very high	95.5	Very high	110 Å²	110	83 Å²	83	71%	0.714	45%	0.445	S	S	*	.	H	α-helix	trans	-55.5	-39.4	175.4	-27.5	36.4	0	0	0	113.6	L78 E79	P75-L78 PolarHBondContact O-N 3.5Å; P75-E79 PolarHBondContact O-N 3.26Å
76	E	97	Very high	95.5	Very high	133 Å²	133	87.2 Å²	87.2	62%	0.621	46%	0.459	S	S	*	.	H	α-helix	trans	-65	-41.3	177.2	-178.6	176.7	-174.6	0	0	111.5	T74 L78 E79 N80	T74-E76 VanDerWaalsContact C-N 3.25Å; T74-E76 PolarHBondContact O-N 2.69Å; E76-L78 VanDerWaalsContact C-N 3.32Å; E76-L78 PolarHBondContact O-N 3.08Å; E76-E79 PolarHBondContact O-N 3.3Å; E76-N80 WeakPolarHBondContact CG-ND2 2.8Å; E76-N80 WeakPolarHBondContact O-CB 3.24Å; E76-N80 PolarHBondContact O-N 3.45Å; E76-N80 PolarHBondContact O-ND2 3.31Å
77	E	97.5	Very high	95.5	Very high	37 Å²	37	91.7 Å²	91.7	17%	0.173	48%	0.481	C	S	.	.	H	α-helix	trans	-65.2	-36.5	176.1	-69.2	174.9	152.1	0	0	112.4	P73 T74 K81 H82 R85	P73-E77 WeakPolarHBondContact CA-OE2 3.42Å; P73-E77 HydrophobicContact CB-CB 4.27Å; T74-E77 PolarHBondContact N-OE2 3.04Å; T74-E77 PolarHBondContact O-N 2.9Å; T74-E77 VanDerWaalsContact O-N 3.14Å; T74-E77 VanDerWaalsContact OG1-CG 3.3Å; T74-E77 WeakPolarHBondContact OG1-CG 3.33Å; T74-E77 PolarHBondContact OG1-N 3.18Å; E77-K81 WeakPolarHBondContact O-CA 3.42Å; E77-K81 PolarHBondContact O-N 3.42Å; E77-H82 WeakPolarHBondContact CA-O 3.38Å; E77-H82 PolarHBondContact O-N 3.28Å; E77-R85 IonicContact OE1-CZ 2.86Å; E77-R85 IonicContact OE1-NH1 2.82Å; E77-R85 PolarHBondContact OE1-NH1 3.34Å; E77-R85 IonicContact OE1-NH2 3.07Å; E77-R85 IonicContact OE2-CZ 3.73Å; E77-R85 IonicContact OE2-NH1 2.66Å; E77-R85 PolarHBondContact OE2-NH1 3.24Å; E77-R85 IonicContact OE2-NH2 3.93Å; E77-R85 PolarHBondContact OE2-NH2 3.49Å
78	L	97	Very high	95.4	Very high	115 Å²	115	92.4 Å²	92.4	60%	0.602	49%	0.488	S	S	*	.	H	α-helix	trans	-66	-43.2	174.9	-69.6	171.4	0	0	0	111.6	P73 T74 P75 E76	P73-L78 HydrophobicContact CB-CD2 3.74Å; P73-L78 HydrophobicContact CB-CG 3.81Å; P73-L78 HydrophobicContact CG-CD2 4.17Å; T74-L78 WeakPolarHBondContact O-CG 3.39Å; T74-L78 PolarHBondContact O-N 3.39Å; P75-L78 PolarHBondContact O-N 3.5Å; E76-L78 VanDerWaalsContact C-N 3.32Å; E76-L78 PolarHBondContact O-N 3.08Å
79	E	97.5	Very high	95.3	Very high	159 Å²	159	96 Å²	96	74%	0.743	50%	0.504	S	S	*	.	H	α-helix	trans	-62.8	-47.9	176.6	-178.3	174.1	-173.8	0	0	111.2	P75 E76 K81	P75-E79 PolarHBondContact O-N 3.26Å; E76-E79 PolarHBondContact O-N 3.3Å; E79-K81 VanDerWaalsContact C-N 3.3Å; E79-K81 PolarHBondContact O-N 3.26Å
80	N	96.6	Very high	95.2	Very high	73 Å²	73	98.8 Å²	98.8	39%	0.39	51%	0.511	S	S	.	.	H	α-helix	trans	-77.2	-14	-176.8	-75.2	-28.1	0	0	0	113.8	E76 H82	E76-N80 WeakPolarHBondContact CG-ND2 2.8Å; E76-N80 WeakPolarHBondContact O-CB 3.24Å; E76-N80 PolarHBondContact O-N 3.45Å; E76-N80 PolarHBondContact O-ND2 3.31Å; N80-H82 PolarHBondContact O-N 3.01Å; N80-H82 VanDerWaalsContact O-N 3.11Å; N80-H82 PolarHBondContact O-ND1 3.24Å
81	K	95.3	Very high	95.1	Very high	192 Å²	192	99.4 Å²	99.4	84%	0.835	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.3	22.4	-174.6	-54.8	-179.6	-178.8	176	0	113.8	E77 E79	E77-K81 WeakPolarHBondContact O-CA 3.42Å; E77-K81 PolarHBondContact O-N 3.42Å; E79-K81 VanDerWaalsContact C-N 3.3Å; E79-K81 PolarHBondContact O-N 3.26Å
82	H	95.4	Very high	94.1	Very high	132 Å²	132	105.9 Å²	105.9	61%	0.611	54%	0.544	S	S	*	.			trans	-153.4	160.4	176.8	70.7	-88.4	0	0	0	109.8	E77 N80	E77-H82 WeakPolarHBondContact CA-O 3.38Å; E77-H82 PolarHBondContact O-N 3.28Å; N80-H82 PolarHBondContact O-N 3.01Å; N80-H82 VanDerWaalsContact O-N 3.11Å; N80-H82 PolarHBondContact O-ND1 3.24Å
83	G	93.4	Very high	92.6	Very high	47 Å²	47	111.4 Å²	111.4	49%	0.485	56%	0.558	S	S	.	*			trans	-171.3	-179	179.8	0	0	0	0	0	110
84	T	94.3	Very high	90.8	Very high	125 Å²	125	113 Å²	113	77%	0.767	57%	0.571	S	S	*	*			trans	-122.3	145.5	174.6	-57.9	0	0	0	0	109
85	R	94	Very high	88.6	Confident	80 Å²	80	117.3 Å²	117.3	30%	0.302	59%	0.586	S	S	.	*			trans	-119.7	146.9	171.6	-68.4	-62.1	-178.9	-100.9	8	109.5	D69 G71 E77	D69-R85 WeakPolarHBondContact O-CB 3.38Å; D69-R85 WeakPolarHBondContact O-CD 3.39Å; D69-R85 VanDerWaalsContact O-CG 3.24Å; D69-R85 WeakPolarHBondContact O-CG 3.32Å; G71-R85 PolarHBondContact O-NE 3.17Å; G71-R85 PolarHBondContact O-NH2 3.38Å; E77-R85 IonicContact OE1-CZ 2.86Å; E77-R85 IonicContact OE1-NH1 2.82Å; E77-R85 PolarHBondContact OE1-NH1 3.34Å; E77-R85 IonicContact OE1-NH2 3.07Å; E77-R85 IonicContact OE2-CZ 3.73Å; E77-R85 IonicContact OE2-NH1 2.66Å; E77-R85 PolarHBondContact OE2-NH1 3.24Å; E77-R85 IonicContact OE2-NH2 3.93Å; E77-R85 PolarHBondContact OE2-NH2 3.49Å
86	R	94	Very high	86.1	Confident	176 Å²	176	121.6 Å²	121.6	66%	0.664	60%	0.597	S	S	*	*			trans	-77.5	127.8	174.6	-175.1	175.8	62.3	-163.9	-4.5	108.7	D69	D69-R86 PolarHBondContact N-O 3.26Å
87	I	95.6	Very high	83.3	Confident	98 Å²	98	122.5 Å²	122.5	50%	0.503	60%	0.601	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.4	137.5	167	-57.3	177.7	0	0	0	106.7	T66 E67 I68 E89	T66-I87 HydrophobicContact CG2-CG2 3.88Å; E67-I87 CarbonylContact O-C 3.6Å; E67-I87 WeakPolarHBondContact O-CA 3.37Å; I68-I87 HydrophobicContact CG1-CG1 4.3Å; I68-I87 HydrophobicContact CG1-CG2 4.43Å; I68-I87 HydrophobicContact CG2-CG1 4.36Å; I87-E89 HydrophobicContact CG2-CG 4.22Å
88	T	96	Very high	80.3	Confident	46 Å²	46	133.7 Å²	133.7	28%	0.282	65%	0.653	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-132.2	119.6	173.7	-54.6	0	0	0	0	108.6	E67 Y90	E67-T88 PolarHBondContact N-O 3.23Å; E67-T88 PolarHBondContact O-N 3.26Å; T88-Y90 HydrophobicContact CG2-CE1 4.14Å; T88-Y90 HydrophobicContact CG2-CE2 3.8Å
89	E	95.1	Very high	79.5	Confident	106 Å²	106	134.6 Å²	134.6	50%	0.495	66%	0.656	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.7	130.2	179.1	-64.8	177.3	162	0	0	108.6	K65 T66 I87 F91	K65-E89 WeakPolarHBondContact O-CA 3.4Å; T66-E89 HydrophobicContact CG2-CG 4.13Å; I87-E89 HydrophobicContact CG2-CG 4.22Å; E89-F91 HydrophobicContact CB-CD2 4.32Å; E89-F91 HydrophobicContact CB-CE2 3.56Å; E89-F91 HydrophobicContact CB-CZ 3.88Å; E89-F91 WeakPolarHBondContact OE2-CZ 3.47Å
90	Y	93	Very high	78.6	Confident	111 Å²	111	133.3 Å²	133.3	44%	0.435	65%	0.651	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.8	104.7	174.1	-53.7	-91.7	0	0	0	106.9	S64 K65 E67 T88	S64-Y90 WeakPolarHBondContact CA-O 3.47Å; K65-Y90 HydrophobicContact CB-CD2 4.43Å; K65-Y90 HydrophobicContact CD-CD2 4.43Å; K65-Y90 HydrophobicContact CG-CD2 4.42Å; K65-Y90 PolarHBondContact N-O 3.14Å; K65-Y90 WeakPolarHBondContact O-CD2 3.44Å; K65-Y90 PolarHBondContact O-N 3.43Å; E67-Y90 HydrophobicContact CG-CE2 3.94Å; T88-Y90 HydrophobicContact CG2-CE1 4.14Å; T88-Y90 HydrophobicContact CG2-CE2 3.8Å
91	F	91.5	Very high	77.5	Confident	121 Å²	121	136.7 Å²	136.7	53%	0.531	67%	0.666	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-85.1	130.9	169.5	-59.1	-83.8	0	0	0	107.3	E89 E93	E89-F91 HydrophobicContact CB-CD2 4.32Å; E89-F91 HydrophobicContact CB-CE2 3.56Å; E89-F91 HydrophobicContact CB-CZ 3.88Å; E89-F91 WeakPolarHBondContact OE2-CZ 3.47Å; F91-E93 VanDerWaalsContact C-N 3.31Å; F91-E93 PolarHBondContact O-N 3.42Å
92	N	73.6	Confident	76.5	Confident	154 Å²	154	133.4 Å²	133.4	82%	0.824	66%	0.656	S	S	*	*			trans	-69	102.1	161.7	-73.6	-14.5	0	0	0	105.2	S94	N92-S94 VanDerWaalsContact C-N 3.29Å; N92-S94 PolarHBondContact O-N 3.27Å
93	E	60.8	Low	75.3	Confident	185 Å²	185	133.5 Å²	133.5	86%	0.864	66%	0.659	S	S	*	*			trans	-55	108.7	157.3	-71.5	178.4	-178.3	0	0	104.5	F91 E95	F91-E93 VanDerWaalsContact C-N 3.31Å; F91-E93 PolarHBondContact O-N 3.42Å; E93-E95 PolarHBondContact O-N 3.5Å; E93-E95 VanDerWaalsContact O-N 3.11Å
94	S	56.3	Low	74.1	Confident	105 Å²	105	139.3 Å²	139.3	73%	0.734	67%	0.67	S	S	*	*			trans	-41.4	124.1	172	44.8	0	0	0	0	107.7	N92 E96	N92-S94 VanDerWaalsContact C-N 3.29Å; N92-S94 PolarHBondContact O-N 3.27Å; S94-E96 PolarHBondContact O-N 3.28Å
95	E	49.1	Very low	72.7	Confident	158 Å²	158	140.3 Å²	140.3	74%	0.738	66%	0.663	S	S	*	*			trans	-30.6	101.2	170.6	-68.1	166.5	152.3	0	0	110.3	E93 Q97	E93-E95 PolarHBondContact O-N 3.5Å; E93-E95 VanDerWaalsContact O-N 3.11Å; E95-Q97 HydrophobicContact CB-CB 4.46Å; E95-Q97 HydrophobicContact CB-CG 4.13Å; E95-Q97 PolarHBondContact O-N 3.39Å
96	E	44.2	Very low	71	Confident	200 Å²	200	144.9 Å²	144.9	94%	0.935	69%	0.691	S	S	*	*			trans	-67.7	78.4	154.1	-79.9	-173.9	165.8	0	0	105.5	S94	S94-E96 PolarHBondContact O-N 3.28Å
97	Q	39.5	Very low	69.1	Low	152 Å²	152	142.3 Å²	142.3	71%	0.71	69%	0.694	S	S	*	*			trans	-107	110.5	164.9	-75.7	-177.5	14.7	0	0	107.1	E95	E95-Q97 HydrophobicContact CB-CB 4.46Å; E95-Q97 HydrophobicContact CB-CG 4.13Å; E95-Q97 PolarHBondContact O-N 3.39Å
98	E	34.8	Very low	66.7	Low	272 Å²	272	146.4 Å²	146.4	100%	1.271	71%	0.711	S	S	*	*			trans	-37.7	0	175.1	-63.8	174	135.1	0	0	116

Retrieved 98 of 98 residues in 268.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).