A0A3Q0KBS6_SCHMA Loading...

Signal peptidase complex subunit 1

Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Dispensable for SPC enzymatic activity.

AlphaFold DB , UniProt , Accession A0A3Q0KBS6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 95 aa.

						>A0A3Q0KBS6_SCHMA|A0A3Q0KBS6
MISMRDVRVWAEKHNIYMDFVGQKNAERCMNLLVIGFLIIALTVGYYKQQLSDSVLILLFGCLFAAFVALPPWPCYHKNPVDWYHEETKSSKKTD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	85.1	Confident	87.4	Confident	241 Å²	241	124.4 Å²	124.4	100%	1.187	60%	0.595	S	S	*	*				0	113.2	0	-169.9	169.4	108.7	0	0	106.7	S3	M1-S3 PolarHBondContact O-N 2.74Å
2	I	84.6	Confident	86.9	Confident	146 Å²	146	122.9 Å²	122.9	75%	0.749	59%	0.587	S	S	*	*			trans	-64.9	124.3	178.9	-73.2	159.1	0	0	0	107.8	V7	I2-V7 HydrophobicContact CG2-CG2 3.45Å; I2-V7 VanDerWaalsContact CG2-CG2 3.45Å
3	S	92.6	Very high	86.7	Confident	54 Å²	54	126.8 Å²	126.8	38%	0.378	60%	0.6	S	S	.	*			trans	-77.1	137.1	178.9	-175.1	0	0	0	0	109.7	M1 R5 D6 V7	M1-S3 PolarHBondContact O-N 2.74Å; S3-R5 PolarHBondContact O-N 3.12Å; S3-R5 VanDerWaalsContact O-N 3.1Å; S3-R5 PolarHBondContact OG-N 2.85Å; S3-D6 VanDerWaalsContact CB-OD2 3.3Å; S3-D6 WeakPolarHBondContact CB-OD2 2.95Å; S3-D6 PolarHBondContact O-N 2.95Å; S3-V7 PolarHBondContact O-N 3.49Å
4	M	89.2	Confident	86.2	Confident	164 Å²	164	125.1 Å²	125.1	81%	0.808	59%	0.591	S	S	*	*	H	α-helix	trans	-55.6	-27.7	173.3	-73.2	-67	-163.8	0	0	112.2	R8	M4-R8 WeakPolarHBondContact O-CB 3.44Å; M4-R8 PolarHBondContact O-N 3.41Å
5	R	89.5	Confident	85.4	Confident	192 Å²	192	121.7 Å²	121.7	73%	0.725	58%	0.578	S	S	*	*	H	α-helix	trans	-65.6	-43.1	175.5	-169	-177.9	-67	-178.8	-1	111.5	S3 V7 R8 V9	S3-R5 PolarHBondContact O-N 3.12Å; S3-R5 VanDerWaalsContact O-N 3.1Å; S3-R5 PolarHBondContact OG-N 2.85Å; R5-V7 VanDerWaalsContact C-N 3.33Å; R5-V7 PolarHBondContact O-N 3.34Å; R5-R8 PolarHBondContact O-N 3.1Å; R5-V9 HydrophobicContact CG-CG2 4.45Å; R5-V9 VanDerWaalsContact O-CG2 3.3Å; R5-V9 WeakPolarHBondContact O-CG2 3.49Å; R5-V9 PolarHBondContact O-N 3.45Å
6	D	91	Very high	85	Confident	99 Å²	99	118.7 Å²	118.7	53%	0.529	57%	0.565	S	S	.	*	H	α-helix	trans	-65.8	-40.7	-179.6	-56.2	-31.7	0	0	0	110.6	S3 V9 W10	S3-D6 VanDerWaalsContact CB-OD2 3.3Å; S3-D6 WeakPolarHBondContact CB-OD2 2.95Å; S3-D6 PolarHBondContact O-N 2.95Å; D6-V9 PolarHBondContact O-N 2.89Å; D6-W10 VanDerWaalsContact O-CB 3.24Å; D6-W10 WeakPolarHBondContact O-CB 3.32Å; D6-W10 PolarHBondContact O-N 3.33Å
7	V	85.8	Confident	84.7	Confident	73 Å²	73	117.6 Å²	117.6	44%	0.442	56%	0.555	S	S	.	*	H	α-helix	trans	-62.5	-44.2	175.6	-179.7	0	0	0	0	111.2	I2 S3 R5 W10 A11	I2-V7 HydrophobicContact CG2-CG2 3.45Å; I2-V7 VanDerWaalsContact CG2-CG2 3.45Å; S3-V7 PolarHBondContact O-N 3.49Å; R5-V7 VanDerWaalsContact C-N 3.33Å; R5-V7 PolarHBondContact O-N 3.34Å; V7-W10 PolarHBondContact O-N 3.44Å; V7-A11 VanDerWaalsContact O-CB 3.28Å; V7-A11 WeakPolarHBondContact O-CB 3.3Å; V7-A11 PolarHBondContact O-N 3.49Å
8	R	85.6	Confident	84.7	Confident	164 Å²	164	114.6 Å²	114.6	62%	0.619	54%	0.542	S	S	*	.	H	α-helix	trans	-64.2	-47.7	178	-175.5	-174.9	-67.9	-179.5	-3.9	111.7	M4 R5 W10 A11 E12	M4-R8 WeakPolarHBondContact O-CB 3.44Å; M4-R8 PolarHBondContact O-N 3.41Å; R5-R8 PolarHBondContact O-N 3.1Å; R8-W10 VanDerWaalsContact C-N 3.29Å; R8-W10 PolarHBondContact O-N 3.35Å; R8-A11 WeakPolarHBondContact O-CB 3.35Å; R8-A11 PolarHBondContact O-N 3.37Å; R8-A11 VanDerWaalsContact O-N 3.17Å; R8-E12 WeakPolarHBondContact CD-OE1 3.24Å; R8-E12 HydrophobicContact CG-CG 4.44Å; R8-E12 VanDerWaalsContact CG-OE1 3.31Å; R8-E12 WeakPolarHBondContact CG-OE1 3.47Å; R8-E12 WeakPolarHBondContact O-CG 3.45Å; R8-E12 PolarHBondContact O-N 3.01Å
9	V	86.9	Confident	84.9	Confident	81 Å²	81	109.3 Å²	109.3	49%	0.491	52%	0.517	S	S	.	.	H	α-helix	trans	-63.5	-38.9	179.5	172.6	0	0	0	0	111	R5 D6 K13	R5-V9 HydrophobicContact CG-CG2 4.45Å; R5-V9 VanDerWaalsContact O-CG2 3.3Å; R5-V9 WeakPolarHBondContact O-CG2 3.49Å; R5-V9 PolarHBondContact O-N 3.45Å; D6-V9 PolarHBondContact O-N 2.89Å; V9-K13 WeakPolarHBondContact O-CB 2.94Å; V9-K13 PolarHBondContact O-N 2.73Å
10	W	88.8	Confident	85	Confident	147 Å²	147	111.6 Å²	111.6	56%	0.557	53%	0.525	S	S	*	.	H	α-helix	trans	-62.8	-44.7	173.7	-179.8	86.9	0	0	0	111.8	D6 V7 R8 K13 H14 I16	D6-W10 VanDerWaalsContact O-CB 3.24Å; D6-W10 WeakPolarHBondContact O-CB 3.32Å; D6-W10 PolarHBondContact O-N 3.33Å; V7-W10 PolarHBondContact O-N 3.44Å; R8-W10 VanDerWaalsContact C-N 3.29Å; R8-W10 PolarHBondContact O-N 3.35Å; W10-K13 PolarHBondContact O-N 2.95Å; W10-H14 AromaticContact CD1-CD2 3.73Å; W10-H14 AromaticContact CD1-NE2 3.86Å; W10-H14 AromaticContact CD2-CD2 3.77Å; W10-H14 AromaticContact CE2-CD2 3.31Å; W10-H14 AromaticContact CE2-NE2 3.69Å; W10-H14 AromaticContact CZ2-CD2 3.69Å; W10-H14 AromaticContact NE1-CD2 3.29Å; W10-H14 PolarHBondContact NE1-CD2 3.19Å; W10-H14 VanDerWaalsContact NE1-CD2 3.29Å; W10-H14 AromaticContact NE1-NE2 3.24Å; W10-H14 PolarHBondContact NE1-NE2 3.37Å; W10-H14 PolarHBondContact O-CD2 2.79Å; W10-H14 VanDerWaalsContact O-CD2 3.25Å; W10-H14 PolarHBondContact O-N 3.43Å; W10-I16 HydrophobicContact CZ3-CD1 4.3Å
11	A	83	Confident	85.3	Confident	7 Å²	7	109.1 Å²	109.1	6%	0.058	52%	0.517	C	S	.	.	H	α-helix	trans	-59.8	-47.1	176.4	0	0	0	0	0	112.8	V7 R8 H14 N15 I16 Y17	V7-A11 VanDerWaalsContact O-CB 3.28Å; V7-A11 WeakPolarHBondContact O-CB 3.3Å; V7-A11 PolarHBondContact O-N 3.49Å; R8-A11 WeakPolarHBondContact O-CB 3.35Å; R8-A11 PolarHBondContact O-N 3.37Å; R8-A11 VanDerWaalsContact O-N 3.17Å; A11-H14 CarbonylContact O-C 3.54Å; A11-H14 PolarHBondContact O-N 2.89Å; A11-N15 PolarHBondContact O-N 3.03Å; A11-I16 HydrophobicContact CB-CD1 3.22Å; A11-I16 HydrophobicContact CB-CG1 3.51Å; A11-I16 PolarHBondContact O-N 3.25Å; A11-Y17 HydrophobicContact CB-CE2 4.44Å
12	E	80.9	Confident	85.5	Confident	107 Å²	107	97.7 Å²	97.7	50%	0.5	46%	0.461	S	S	.	.	H	α-helix	trans	-59.6	-45	175.2	-71	169.3	-175.8	0	0	111.7	R8 H14 N15 Y17	R8-E12 WeakPolarHBondContact CD-OE1 3.24Å; R8-E12 HydrophobicContact CG-CG 4.44Å; R8-E12 VanDerWaalsContact CG-OE1 3.31Å; R8-E12 WeakPolarHBondContact CG-OE1 3.47Å; R8-E12 WeakPolarHBondContact O-CG 3.45Å; R8-E12 PolarHBondContact O-N 3.01Å; E12-H14 VanDerWaalsContact C-N 3.27Å; E12-H14 PolarHBondContact O-N 2.89Å; E12-N15 PolarHBondContact O-N 3.5Å; E12-N15 VanDerWaalsContact O-N 3.11Å; E12-Y17 HydrophobicContact CB-CE2 4.27Å; E12-Y17 HydrophobicContact CG-CE2 3.65Å; E12-Y17 WeakPolarHBondContact CG-OH 3.38Å
13	K	83.8	Confident	85.8	Confident	173 Å²	173	95.1 Å²	95.1	75%	0.752	45%	0.446	S	S	*	.	H	α-helix	trans	-60.8	-36.5	177	-173	-178.3	179.9	-171.7	0	112.7	V9 W10 N15	V9-K13 WeakPolarHBondContact O-CB 2.94Å; V9-K13 PolarHBondContact O-N 2.73Å; W10-K13 PolarHBondContact O-N 2.95Å; K13-N15 VanDerWaalsContact C-N 3.33Å
14	H	79.6	Confident	85.8	Confident	104 Å²	104	99.2 Å²	99.2	48%	0.481	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.7	3.2	179.4	-75.5	-69.7	0	0	0	113.9	W10 A11 E12 I16	W10-H14 AromaticContact CD1-CD2 3.73Å; W10-H14 AromaticContact CD1-NE2 3.86Å; W10-H14 AromaticContact CD2-CD2 3.77Å; W10-H14 AromaticContact CE2-CD2 3.31Å; W10-H14 AromaticContact CE2-NE2 3.69Å; W10-H14 AromaticContact CZ2-CD2 3.69Å; W10-H14 AromaticContact NE1-CD2 3.29Å; W10-H14 PolarHBondContact NE1-CD2 3.19Å; W10-H14 VanDerWaalsContact NE1-CD2 3.29Å; W10-H14 AromaticContact NE1-NE2 3.24Å; W10-H14 PolarHBondContact NE1-NE2 3.37Å; W10-H14 PolarHBondContact O-CD2 2.79Å; W10-H14 VanDerWaalsContact O-CD2 3.25Å; W10-H14 PolarHBondContact O-N 3.43Å; A11-H14 CarbonylContact O-C 3.54Å; A11-H14 PolarHBondContact O-N 2.89Å; E12-H14 VanDerWaalsContact C-N 3.27Å; E12-H14 PolarHBondContact O-N 2.89Å; H14-I16 HydrophobicContact CB-CG2 3.8Å; H14-I16 PolarHBondContact O-N 3.33Å
15	N	74.1	Confident	85.9	Confident	73 Å²	73	95.3 Å²	95.3	39%	0.39	44%	0.44	S	S	.	.	T	Hydrogen-bonded Turn	trans	42.8	50.2	-174.9	-161.5	0.4	0	0	0	112.4	A11 E12 K13 Y17 H77	A11-N15 PolarHBondContact O-N 3.03Å; E12-N15 PolarHBondContact O-N 3.5Å; E12-N15 VanDerWaalsContact O-N 3.11Å; K13-N15 VanDerWaalsContact C-N 3.33Å; N15-Y17 PolarHBondContact O-N 3.42Å; N15-H77 PolarHBondContact ND2-CE1 3.46Å; N15-H77 PolarHBondContact OD1-CE1 3.16Å; N15-H77 PolarHBondContact OD1-ND1 3.36Å
16	I	79.1	Confident	86.1	Confident	74 Å²	74	86.4 Å²	86.4	38%	0.379	41%	0.407	S	S	.	.			trans	-75.6	14.5	178.9	68.1	174.7	0	0	0	112.8	W10 A11 H14 P72	W10-I16 HydrophobicContact CZ3-CD1 4.3Å; A11-I16 HydrophobicContact CB-CD1 3.22Å; A11-I16 HydrophobicContact CB-CG1 3.51Å; A11-I16 PolarHBondContact O-N 3.25Å; H14-I16 HydrophobicContact CB-CG2 3.8Å; H14-I16 PolarHBondContact O-N 3.33Å; I16-P72 HydrophobicContact CB-CG 4.05Å
17	Y	79.7	Confident	86.3	Confident	100 Å²	100	86.1 Å²	86.1	39%	0.392	40%	0.403	S	S	.	.	P	Polyproline II helix	trans	-91.5	128.4	-178.8	-62.2	-80.2	0	0	0	109.6	A11 E12 N15 H77	A11-Y17 HydrophobicContact CB-CE2 4.44Å; E12-Y17 HydrophobicContact CB-CE2 4.27Å; E12-Y17 HydrophobicContact CG-CE2 3.65Å; E12-Y17 WeakPolarHBondContact CG-OH 3.38Å; N15-Y17 PolarHBondContact O-N 3.42Å; Y17-H77 PolarHBondContact O-ND1 3.34Å
18	M	85	Confident	86.7	Confident	64 Å²	64	91.1 Å²	91.1	32%	0.315	41%	0.414	S	S	.	.	P	Polyproline II helix	trans	-96.6	132.5	174.1	-166.9	176.7	-163.2	0	0	109.1	G22 Q23 A26 Y76	M18-G22 WeakPolarHBondContact CE-O 3.37Å; M18-Q23 VanDerWaalsContact CE-CA 3.49Å; M18-Q23 HydrophobicContact SD-CB 4.17Å; M18-A26 HydrophobicContact CE-CB 3.25Å; M18-Y76 HydrophobicContact CE-CD1 3.97Å; M18-Y76 HydrophobicContact CE-CD2 3.64Å; M18-Y76 HydrophobicContact CE-CE1 4.49Å; M18-Y76 HydrophobicContact CE-CE2 4.16Å; M18-Y76 HydrophobicContact CE-CG 3.54Å
19	D	88.6	Confident	87.1	Confident	14 Å²	14	85.1 Å²	85.1	8%	0.075	40%	0.396	C	S	.	.	P	Polyproline II helix	trans	-76.7	159.9	175.3	78.2	43.5	0	0	0	110.7	V21 G22 Q23 Y76 H77 K78 N79	D19-V21 VanDerWaalsContact C-N 3.27Å; D19-V21 PolarHBondContact O-N 3.02Å; D19-V21 WeakPolarHBondContact OD1-CA 3.47Å; D19-V21 WeakPolarHBondContact OD1-CB 3.35Å; D19-V21 PolarHBondContact OD1-N 2.91Å; D19-G22 PolarHBondContact O-N 2.93Å; D19-G22 WeakPolarHBondContact OD1-CA 3.44Å; D19-G22 PolarHBondContact OD1-N 3.39Å; D19-Q23 PolarHBondContact O-N 2.74Å; D19-Y76 PolarHBondContact N-O 3.43Å; D19-Y76 VanDerWaalsContact OD2-O 3.05Å; D19-H77 VanDerWaalsContact OD2-CA 3.25Å; D19-H77 WeakPolarHBondContact OD2-CA 3.31Å; D19-K78 PolarHBondContact OD2-N 3.1Å; D19-N79 PolarHBondContact OD2-N 2.99Å
20	F	88.1	Confident	87.5	Confident	154 Å²	154	84.7 Å²	84.7	68%	0.675	39%	0.39	S	S	*	.	H	α-helix	trans	-62.4	-34.5	-176.5	179.3	-100.8	0	0	0	112.8	Q23 K24	F20-Q23 PolarHBondContact O-N 3.49Å; F20-K24 PolarHBondContact O-N 3.4Å; F20-K24 VanDerWaalsContact O-N 3.15Å
21	V	89.5	Confident	87.9	Confident	60 Å²	60	81.9 Å²	81.9	36%	0.364	39%	0.386	S	S	.	.	H	α-helix	trans	-70.5	-39.7	178.2	-179.8	0	0	0	0	110.3	D19 K24 N25 N79	D19-V21 VanDerWaalsContact C-N 3.27Å; D19-V21 PolarHBondContact O-N 3.02Å; D19-V21 WeakPolarHBondContact OD1-CA 3.47Å; D19-V21 WeakPolarHBondContact OD1-CB 3.35Å; D19-V21 PolarHBondContact OD1-N 2.91Å; V21-K24 PolarHBondContact O-N 2.83Å; V21-N25 WeakPolarHBondContact O-CB 3.43Å; V21-N25 VanDerWaalsContact O-CG 3.26Å; V21-N25 PolarHBondContact O-N 3.41Å; V21-N25 PolarHBondContact O-ND2 2.86Å; V21-N79 HydrophobicContact CB-CB 4.15Å; V21-N79 HydrophobicContact CG2-CB 3.92Å
22	G	89.7	Confident	88.6	Confident	1 Å²	1	87 Å²	87	1%	0.01	41%	0.411	C	S	.	.	H	α-helix	trans	-61.6	-46.2	173.9	0	0	0	0	0	110.6	M18 D19 K24 N25 A26 Y76	M18-G22 WeakPolarHBondContact CE-O 3.37Å; D19-G22 PolarHBondContact O-N 2.93Å; D19-G22 WeakPolarHBondContact OD1-CA 3.44Å; D19-G22 PolarHBondContact OD1-N 3.39Å; G22-K24 PolarHBondContact O-N 3.37Å; G22-N25 CarbonylContact O-C 3.58Å; G22-N25 WeakPolarHBondContact O-CB 3.26Å; G22-N25 PolarHBondContact O-N 2.87Å; G22-N25 VanDerWaalsContact O-N 3.11Å; G22-A26 PolarHBondContact O-N 2.91Å; G22-Y76 WeakPolarHBondContact CA-O 3.47Å; G22-Y76 WeakPolarHBondContact O-CD1 3.44Å
23	Q	91.6	Very high	89.3	Confident	92 Å²	92	83.9 Å²	83.9	43%	0.43	40%	0.398	S	S	.	.	H	α-helix	trans	-54.7	-52	174.7	-170.1	-174.8	-28.6	0	0	111.1	M18 D19 F20 N25 A26 E27	M18-Q23 VanDerWaalsContact CE-CA 3.49Å; M18-Q23 HydrophobicContact SD-CB 4.17Å; D19-Q23 PolarHBondContact O-N 2.74Å; F20-Q23 PolarHBondContact O-N 3.49Å; Q23-N25 VanDerWaalsContact C-N 3.27Å; Q23-N25 PolarHBondContact O-N 3.2Å; Q23-A26 PolarHBondContact O-N 3.37Å; Q23-A26 VanDerWaalsContact O-N 3.17Å; Q23-E27 PolarHBondContact NE2-OE1 3.05Å; Q23-E27 WeakPolarHBondContact O-CG 3.35Å; Q23-E27 PolarHBondContact O-N 3.33Å
24	K	92.9	Very high	89.9	Confident	141 Å²	141	77.8 Å²	77.8	61%	0.613	38%	0.375	S	S	*	.	H	α-helix	trans	-58.6	-39.7	176.6	-175.3	176.7	-177.9	176.7	0	112.5	F20 V21 G22 R28	F20-K24 PolarHBondContact O-N 3.4Å; F20-K24 VanDerWaalsContact O-N 3.15Å; V21-K24 PolarHBondContact O-N 2.83Å; G22-K24 PolarHBondContact O-N 3.37Å; K24-R28 PolarHBondContact O-N 2.87Å; K24-R28 VanDerWaalsContact O-N 3.07Å
25	N	91.9	Very high	90.8	Very high	81 Å²	81	77.3 Å²	77.3	43%	0.433	38%	0.375	S	S	.	.	H	α-helix	trans	-68.4	-39.2	177.8	-73.8	-16.4	0	0	0	112.4	V21 G22 Q23 R28 C29 Y76	V21-N25 WeakPolarHBondContact O-CB 3.43Å; V21-N25 VanDerWaalsContact O-CG 3.26Å; V21-N25 PolarHBondContact O-N 3.41Å; V21-N25 PolarHBondContact O-ND2 2.86Å; G22-N25 CarbonylContact O-C 3.58Å; G22-N25 WeakPolarHBondContact O-CB 3.26Å; G22-N25 PolarHBondContact O-N 2.87Å; G22-N25 VanDerWaalsContact O-N 3.11Å; Q23-N25 VanDerWaalsContact C-N 3.27Å; Q23-N25 PolarHBondContact O-N 3.2Å; N25-R28 PolarHBondContact O-N 3.31Å; N25-C29 WeakPolarHBondContact O-CB 3.32Å; N25-C29 PolarHBondContact O-N 3.44Å; N25-Y76 HydrophobicContact CB-CD1 4.23Å; N25-Y76 HydrophobicContact CB-CE1 4.06Å
26	A	93.5	Very high	91.9	Very high	5 Å²	5	75.2 Å²	75.2	4%	0.041	37%	0.371	C	S	.	.	H	α-helix	trans	-67.3	-41.9	175.6	0	0	0	0	0	111.8	M18 G22 Q23 R28 C29 M30 A69 Y76	M18-A26 HydrophobicContact CE-CB 3.25Å; G22-A26 PolarHBondContact O-N 2.91Å; Q23-A26 PolarHBondContact O-N 3.37Å; Q23-A26 VanDerWaalsContact O-N 3.17Å; A26-R28 VanDerWaalsContact C-N 3.31Å; A26-R28 PolarHBondContact O-N 2.89Å; A26-C29 PolarHBondContact O-N 3.44Å; A26-M30 VanDerWaalsContact O-CB 3.3Å; A26-M30 WeakPolarHBondContact O-CB 3.43Å; A26-M30 PolarHBondContact O-N 3.46Å; A26-A69 HydrophobicContact CB-CB 4.2Å; A26-Y76 HydrophobicContact CB-CD1 4.42Å; A26-Y76 HydrophobicContact CB-CE1 3.88Å; A26-Y76 HydrophobicContact CB-CE2 3.99Å
27	E	94	Very high	92.8	Very high	93 Å²	93	73.7 Å²	73.7	44%	0.435	36%	0.362	S	S	.	.	H	α-helix	trans	-58.1	-45.4	174.2	-73.5	174.2	-161.5	0	0	111.1	Q23 C29 M30 N31	Q23-E27 PolarHBondContact NE2-OE1 3.05Å; Q23-E27 WeakPolarHBondContact O-CG 3.35Å; Q23-E27 PolarHBondContact O-N 3.33Å; E27-C29 PolarHBondContact O-N 3.41Å; E27-M30 PolarHBondContact O-N 3.36Å; E27-N31 WeakPolarHBondContact O-CB 3.19Å; E27-N31 VanDerWaalsContact O-CG 3.25Å; E27-N31 PolarHBondContact O-N 3.43Å; E27-N31 PolarHBondContact O-ND2 3.43Å
28	R	94.6	Very high	93.7	Very high	179 Å²	179	72.4 Å²	72.4	68%	0.675	36%	0.361	S	S	*	.	H	α-helix	trans	-62.7	-43.6	175.7	-172.8	175.9	-177.8	175.6	1	111.9	K24 N25 A26 N31 L32	K24-R28 PolarHBondContact O-N 2.87Å; K24-R28 VanDerWaalsContact O-N 3.07Å; N25-R28 PolarHBondContact O-N 3.31Å; A26-R28 VanDerWaalsContact C-N 3.31Å; A26-R28 PolarHBondContact O-N 2.89Å; R28-N31 PolarHBondContact O-N 3.26Å; R28-L32 HydrophobicContact CG-CD1 4.22Å; R28-L32 VanDerWaalsContact O-CG 3.27Å; R28-L32 WeakPolarHBondContact O-CG 3.41Å; R28-L32 PolarHBondContact O-N 2.89Å
29	C	94.1	Very high	94.3	Very high	38 Å²	38	74.2 Å²	74.2	26%	0.257	37%	0.371	S	S	.	.	H	α-helix	trans	-63.7	-46.9	178.6	-172.5	0	0	0	0	111.5	N25 A26 E27 N31 L32 L33	N25-C29 WeakPolarHBondContact O-CB 3.32Å; N25-C29 PolarHBondContact O-N 3.44Å; A26-C29 PolarHBondContact O-N 3.44Å; E27-C29 PolarHBondContact O-N 3.41Å; C29-N31 PolarHBondContact O-N 2.94Å; C29-L32 PolarHBondContact O-N 3.27Å; C29-L33 WeakPolarHBondContact O-CB 3.43Å; C29-L33 WeakPolarHBondContact O-CG 3.39Å; C29-L33 PolarHBondContact O-N 2.94Å
30	M	95.5	Very high	94.7	Very high	72 Å²	72	77.9 Å²	77.9	36%	0.355	39%	0.39	S	S	.	.	H	α-helix	trans	-55.5	-50.5	175.2	-178.5	-175.3	69.8	0	0	111	A26 E27 L32 L33 V34 A65 A69	A26-M30 VanDerWaalsContact O-CB 3.3Å; A26-M30 WeakPolarHBondContact O-CB 3.43Å; A26-M30 PolarHBondContact O-N 3.46Å; E27-M30 PolarHBondContact O-N 3.36Å; M30-L32 PolarHBondContact O-N 2.83Å; M30-L33 PolarHBondContact O-N 3.2Å; M30-V34 HydrophobicContact CG-CG2 4.4Å; M30-V34 WeakPolarHBondContact O-CG2 3.29Å; M30-V34 PolarHBondContact O-N 3.45Å; M30-A65 HydrophobicContact CG-CB 4.28Å; M30-A69 HydrophobicContact CB-CB 4Å; M30-A69 HydrophobicContact CG-CB 4.5Å
31	N	96.2	Very high	95.1	Very high	88 Å²	88	70.6 Å²	70.6	47%	0.471	36%	0.358	S	S	.	.	H	α-helix	trans	-59.6	-45.6	179.3	-73.5	-16.1	0	0	0	111.8	E27 R28 C29 I35	E27-N31 WeakPolarHBondContact O-CB 3.19Å; E27-N31 VanDerWaalsContact O-CG 3.25Å; E27-N31 PolarHBondContact O-N 3.43Å; E27-N31 PolarHBondContact O-ND2 3.43Å; R28-N31 PolarHBondContact O-N 3.26Å; C29-N31 PolarHBondContact O-N 2.94Å; N31-I35 WeakPolarHBondContact O-CB 3.21Å; N31-I35 WeakPolarHBondContact O-CD1 3.45Å; N31-I35 WeakPolarHBondContact O-CG1 3.29Å; N31-I35 PolarHBondContact O-N 3.3Å
32	L	97.3	Very high	95.4	Very high	113 Å²	113	72.9 Å²	72.9	59%	0.592	37%	0.368	S	S	*	.	H	α-helix	trans	-62.7	-43	177.7	-71.5	172.5	0	0	0	112.3	R28 C29 M30 G36	R28-L32 HydrophobicContact CG-CD1 4.22Å; R28-L32 VanDerWaalsContact O-CG 3.27Å; R28-L32 WeakPolarHBondContact O-CG 3.41Å; R28-L32 PolarHBondContact O-N 2.89Å; C29-L32 PolarHBondContact O-N 3.27Å; M30-L32 PolarHBondContact O-N 2.83Å; L32-G36 PolarHBondContact O-N 2.83Å
33	L	97	Very high	95.7	Very high	42 Å²	42	77.1 Å²	77.1	22%	0.22	39%	0.393	C	S	.	.	H	α-helix	trans	-63.3	-52.1	177.6	-72.9	174.4	0	0	0	110.9	C29 M30 I35 G36 F37 F64 A65 V68	C29-L33 WeakPolarHBondContact O-CB 3.43Å; C29-L33 WeakPolarHBondContact O-CG 3.39Å; C29-L33 PolarHBondContact O-N 2.94Å; M30-L33 PolarHBondContact O-N 3.2Å; L33-I35 VanDerWaalsContact C-N 3.34Å; L33-I35 PolarHBondContact O-N 2.87Å; L33-G36 PolarHBondContact O-N 3.49Å; L33-G36 VanDerWaalsContact O-N 3.14Å; L33-F37 WeakPolarHBondContact O-CD2 3.38Å; L33-F37 PolarHBondContact O-N 2.89Å; L33-F64 HydrophobicContact CD1-CD1 4.3Å; L33-F64 HydrophobicContact CD1-CE1 4.29Å; L33-F64 HydrophobicContact CD2-CD1 4.45Å; L33-F64 HydrophobicContact CD2-CE1 4.18Å; L33-A65 HydrophobicContact CB-CB 3.96Å; L33-A65 HydrophobicContact CD1-CB 4.25Å; L33-V68 HydrophobicContact CD1-CB 4.02Å; L33-V68 HydrophobicContact CD1-CG1 4.11Å; L33-V68 HydrophobicContact CD1-CG2 4.17Å
34	V	96.9	Very high	95.9	Very high	46 Å²	46	75 Å²	75	28%	0.279	39%	0.387	S	S	.	.	H	α-helix	trans	-60.3	-43.8	-179.1	173.4	0	0	0	0	111.1	M30 F37 L38 A65	M30-V34 HydrophobicContact CG-CG2 4.4Å; M30-V34 WeakPolarHBondContact O-CG2 3.29Å; M30-V34 PolarHBondContact O-N 3.45Å; V34-F37 PolarHBondContact O-N 3.14Å; V34-L38 VanDerWaalsContact O-CB 3.3Å; V34-L38 WeakPolarHBondContact O-CB 3.35Å; V34-L38 PolarHBondContact O-N 2.89Å; V34-A65 HydrophobicContact CG2-CB 3.82Å
35	I	97.7	Very high	96	Very high	94 Å²	94	68.7 Å²	68.7	48%	0.482	36%	0.361	S	S	.	.	H	α-helix	trans	-62.3	-44.1	175.7	-70.5	163.1	0	0	0	111	N31 L33 L38 I39	N31-I35 WeakPolarHBondContact O-CB 3.21Å; N31-I35 WeakPolarHBondContact O-CD1 3.45Å; N31-I35 WeakPolarHBondContact O-CG1 3.29Å; N31-I35 PolarHBondContact O-N 3.3Å; L33-I35 VanDerWaalsContact C-N 3.34Å; L33-I35 PolarHBondContact O-N 2.87Å; I35-L38 WeakPolarHBondContact O-CB 3.33Å; I35-L38 PolarHBondContact O-N 2.94Å; I35-I39 HydrophobicContact CG2-CD1 4.1Å; I35-I39 WeakPolarHBondContact O-CG1 3.3Å; I35-I39 PolarHBondContact O-N 3.01Å
36	G	97.8	Very high	96.1	Very high	29 Å²	29	74.2 Å²	74.2	30%	0.299	38%	0.378	S	S	.	.	H	α-helix	trans	-59.7	-48.7	177.5	0	0	0	0	0	112.3	L32 L33 L38 I39 I40	L32-G36 PolarHBondContact O-N 2.83Å; L33-G36 PolarHBondContact O-N 3.49Å; L33-G36 VanDerWaalsContact O-N 3.14Å; G36-L38 VanDerWaalsContact C-N 3.31Å; G36-L38 PolarHBondContact O-N 3.4Å; G36-I39 PolarHBondContact O-N 2.96Å; G36-I40 WeakPolarHBondContact O-CG1 3.45Å; G36-I40 PolarHBondContact O-N 3.32Å; G36-I40 VanDerWaalsContact O-N 3.16Å
37	F	97.5	Very high	96.2	Very high	42 Å²	42	83.7 Å²	83.7	18%	0.184	41%	0.414	C	S	.	.	H	α-helix	trans	-64.3	-34.9	176	-80.9	-74.2	0	0	0	112.7	L33 V34 I40 A41 I57 F60 F64	L33-F37 WeakPolarHBondContact O-CD2 3.38Å; L33-F37 PolarHBondContact O-N 2.89Å; V34-F37 PolarHBondContact O-N 3.14Å; F37-I40 PolarHBondContact O-N 3.38Å; F37-A41 WeakPolarHBondContact O-CB 3.27Å; F37-A41 PolarHBondContact O-N 2.87Å; F37-I57 HydrophobicContact CD1-CG2 4.4Å; F37-F60 HydrophobicContact CE1-CD1 4.1Å; F37-F60 HydrophobicContact CE1-CE1 4.37Å; F37-F60 HydrophobicContact CZ-CD1 4.47Å; F37-F60 HydrophobicContact CZ-CE1 4.45Å; F37-F64 AromaticContact CE2-CD1 3.87Å; F37-F64 HydrophobicContact CE2-CD1 3.87Å; F37-F64 HydrophobicContact CZ-CD1 4.2Å
38	L	97.6	Very high	96.3	Very high	72 Å²	72	84.5 Å²	84.5	38%	0.377	42%	0.416	S	S	.	.	H	α-helix	trans	-61.9	-46.6	175.4	179.6	64	0	0	0	111.6	V34 I35 G36 I40 A41 L42 L58	V34-L38 VanDerWaalsContact O-CB 3.3Å; V34-L38 WeakPolarHBondContact O-CB 3.35Å; V34-L38 PolarHBondContact O-N 2.89Å; I35-L38 WeakPolarHBondContact O-CB 3.33Å; I35-L38 PolarHBondContact O-N 2.94Å; G36-L38 VanDerWaalsContact C-N 3.31Å; G36-L38 PolarHBondContact O-N 3.4Å; L38-I40 VanDerWaalsContact C-N 3.3Å; L38-I40 PolarHBondContact O-N 2.86Å; L38-A41 PolarHBondContact O-N 2.78Å; L38-L42 HydrophobicContact CD1-CD1 4.26Å; L38-L42 HydrophobicContact CD1-CG 4.26Å; L38-L42 HydrophobicContact CG-CD1 4.21Å; L38-L42 WeakPolarHBondContact O-CB 3.48Å; L38-L42 VanDerWaalsContact O-CG 3.29Å; L38-L42 WeakPolarHBondContact O-CG 3.34Å; L38-L42 PolarHBondContact O-N 3.47Å; L38-L58 HydrophobicContact CB-CD1 4.28Å; L38-L58 HydrophobicContact CD1-CD1 4.22Å; L38-L58 HydrophobicContact CD1-CD2 4.46Å
39	I	98	Very high	96.3	Very high	103 Å²	103	84.5 Å²	84.5	53%	0.528	42%	0.423	S	S	.	.	H	α-helix	trans	-60.6	-43.1	177.5	-65.8	167	0	0	0	110.6	I35 G36 T43	I35-I39 HydrophobicContact CG2-CD1 4.1Å; I35-I39 WeakPolarHBondContact O-CG1 3.3Å; I35-I39 PolarHBondContact O-N 3.01Å; G36-I39 PolarHBondContact O-N 2.96Å; I39-T43 WeakPolarHBondContact O-CB 3.37Å; I39-T43 PolarHBondContact O-N 3.41Å; I39-T43 PolarHBondContact O-OG1 3.18Å
40	I	97	Very high	96.1	Very high	90 Å²	90	88 Å²	88	46%	0.462	44%	0.436	S	S	.	.	H	α-helix	trans	-65.4	-48.2	178.1	-64.4	166.4	0	0	0	110.5	G36 F37 L38 L42 T43 V44 I57	G36-I40 WeakPolarHBondContact O-CG1 3.45Å; G36-I40 PolarHBondContact O-N 3.32Å; G36-I40 VanDerWaalsContact O-N 3.16Å; F37-I40 PolarHBondContact O-N 3.38Å; L38-I40 VanDerWaalsContact C-N 3.3Å; L38-I40 PolarHBondContact O-N 2.86Å; I40-L42 VanDerWaalsContact C-N 3.31Å; I40-L42 PolarHBondContact O-N 3.39Å; I40-T43 PolarHBondContact O-N 3.26Å; I40-V44 HydrophobicContact CG2-CG2 4.2Å; I40-V44 WeakPolarHBondContact O-CB 3.22Å; I40-V44 WeakPolarHBondContact O-CG2 3.34Å; I40-V44 PolarHBondContact O-N 3.43Å; I40-I57 HydrophobicContact CG2-CG2 4.31Å
41	A	96.8	Very high	96	Very high	2 Å²	2	91 Å²	91	2%	0.017	45%	0.453	C	S	.	.	H	α-helix	trans	-59	-41.3	180	0	0	0	0	0	112.1	F37 L38 G45 S54 I57 L58	F37-A41 WeakPolarHBondContact O-CB 3.27Å; F37-A41 PolarHBondContact O-N 2.87Å; L38-A41 PolarHBondContact O-N 2.78Å; A41-G45 WeakPolarHBondContact O-CA 2.9Å; A41-G45 PolarHBondContact O-N 2.91Å; A41-S54 WeakPolarHBondContact CB-O 3.43Å; A41-S54 WeakPolarHBondContact O-CB 3.33Å; A41-S54 PolarHBondContact O-OG 3.42Å; A41-I57 HydrophobicContact CB-CB 4.07Å; A41-I57 HydrophobicContact CB-CG2 3.9Å; A41-L58 HydrophobicContact CB-CB 4.27Å
42	L	95.8	Very high	96	Very high	107 Å²	107	90.9 Å²	90.9	56%	0.56	46%	0.459	S	S	*	.	H	α-helix	trans	-67.1	-44	175.9	-71.1	176.4	0	0	0	111.8	L38 I40 G45 Y46	L38-L42 HydrophobicContact CD1-CD1 4.26Å; L38-L42 HydrophobicContact CD1-CG 4.26Å; L38-L42 HydrophobicContact CG-CD1 4.21Å; L38-L42 WeakPolarHBondContact O-CB 3.48Å; L38-L42 VanDerWaalsContact O-CG 3.29Å; L38-L42 WeakPolarHBondContact O-CG 3.34Å; L38-L42 PolarHBondContact O-N 3.47Å; I40-L42 VanDerWaalsContact C-N 3.31Å; I40-L42 PolarHBondContact O-N 3.39Å; L42-G45 PolarHBondContact O-N 3.26Å; L42-Y46 WeakPolarHBondContact O-CB 3.24Å; L42-Y46 PolarHBondContact O-N 3.04Å
43	T	96.6	Very high	95.8	Very high	90 Å²	90	87.2 Å²	87.2	55%	0.552	44%	0.44	S	S	*	.	H	α-helix	trans	-63.2	-48.2	179.7	-54.4	0	0	0	0	111.5	I39 I40 Y46 Y47	I39-T43 WeakPolarHBondContact O-CB 3.37Å; I39-T43 PolarHBondContact O-N 3.41Å; I39-T43 PolarHBondContact O-OG1 3.18Å; I40-T43 PolarHBondContact O-N 3.26Å; T43-Y46 PolarHBondContact O-N 3.48Å; T43-Y47 PolarHBondContact O-N 2.97Å; T43-Y47 VanDerWaalsContact O-N 3.1Å
44	V	95.3	Very high	95.7	Very high	48 Å²	48	86 Å²	86	29%	0.291	44%	0.435	S	S	.	.	H	α-helix	trans	-66.9	-40.9	178.5	175.1	0	0	0	0	111	I40 Y46 Y47 K48 I57	I40-V44 HydrophobicContact CG2-CG2 4.2Å; I40-V44 WeakPolarHBondContact O-CB 3.22Å; I40-V44 WeakPolarHBondContact O-CG2 3.34Å; I40-V44 PolarHBondContact O-N 3.43Å; V44-Y46 PolarHBondContact O-N 3.27Å; V44-Y47 PolarHBondContact O-N 3.44Å; V44-K48 HydrophobicContact CG1-CD 4.39Å; V44-K48 PolarHBondContact O-N 2.73Å; V44-I57 HydrophobicContact CB-CD1 3.84Å; V44-I57 HydrophobicContact CG1-CD1 3.67Å; V44-I57 HydrophobicContact CG2-CD1 4.18Å
45	G	95.3	Very high	95.7	Very high	8 Å²	8	87.8 Å²	87.8	8%	0.082	45%	0.446	C	S	.	.	H	α-helix	trans	-57.7	-46.7	175	0	0	0	0	0	113.7	A41 L42 Q49 Q50 S54	A41-G45 WeakPolarHBondContact O-CA 2.9Å; A41-G45 PolarHBondContact O-N 2.91Å; L42-G45 PolarHBondContact O-N 3.26Å; G45-Q49 VanDerWaalsContact O-CA 3.3Å; G45-Q49 WeakPolarHBondContact O-CA 3.15Å; G45-Q49 PolarHBondContact O-N 3.45Å; G45-Q50 PolarHBondContact O-N 3.5Å; G45-S54 WeakPolarHBondContact CA-OG 3.38Å
46	Y	93.8	Very high	95.7	Very high	198 Å²	198	88.9 Å²	88.9	78%	0.776	45%	0.452	S	S	*	.	H	α-helix	trans	-63	-45.5	178.2	-176.9	-100.4	0	0	0	111.2	L42 T43 V44 Q49	L42-Y46 WeakPolarHBondContact O-CB 3.24Å; L42-Y46 PolarHBondContact O-N 3.04Å; T43-Y46 PolarHBondContact O-N 3.48Å; V44-Y46 PolarHBondContact O-N 3.27Å; Y46-Q49 PolarHBondContact O-N 3.34Å
47	Y	95.9	Very high	95.6	Very high	204 Å²	204	89.5 Å²	89.5	80%	0.8	45%	0.448	S	S	*	.	H	α-helix	trans	-64.4	-42.8	180	-173.5	-98.5	0	0	0	112.7	T43 V44	T43-Y47 PolarHBondContact O-N 2.97Å; T43-Y47 VanDerWaalsContact O-N 3.1Å; V44-Y47 PolarHBondContact O-N 3.44Å
48	K	94.7	Very high	95.6	Very high	110 Å²	110	90.1 Å²	90.1	48%	0.478	45%	0.453	S	S	.	.	H	α-helix	trans	-84.2	-11.9	-179.9	-72.9	-167.5	174.6	-169.8	0	114.3	V44 Q50 D53	V44-K48 HydrophobicContact CG1-CD 4.39Å; V44-K48 PolarHBondContact O-N 2.73Å; K48-Q50 PolarHBondContact O-N 2.88Å; K48-Q50 VanDerWaalsContact O-N 3.12Å; K48-D53 HydrophobicContact CD-CB 4.5Å; K48-D53 WeakPolarHBondContact CD-OD2 3.27Å; K48-D53 WeakPolarHBondContact CE-OD2 3.3Å; K48-D53 IonicContact NZ-OD2 2.74Å; K48-D53 PolarHBondContact NZ-OD2 3.07Å
49	Q	94.4	Very high	95.6	Very high	178 Å²	178	91.5 Å²	91.5	83%	0.832	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.6	28.4	-172.1	-56.7	-167.2	-57.4	0	0	114	G45 Y46	G45-Q49 VanDerWaalsContact O-CA 3.3Å; G45-Q49 WeakPolarHBondContact O-CA 3.15Å; G45-Q49 PolarHBondContact O-N 3.45Å; Y46-Q49 PolarHBondContact O-N 3.34Å
50	Q	91.7	Very high	95.5	Very high	111 Å²	111	92.6 Å²	92.6	52%	0.519	46%	0.461	S	S	.	.			trans	-122.8	115.3	-180	-71.8	-177.4	33.7	0	0	110.2	G45 K48 S52 D53	G45-Q50 PolarHBondContact O-N 3.5Å; K48-Q50 PolarHBondContact O-N 2.88Å; K48-Q50 VanDerWaalsContact O-N 3.12Å; Q50-S52 VanDerWaalsContact C-N 3.27Å; Q50-S52 PolarHBondContact O-N 2.81Å; Q50-D53 PolarHBondContact O-N 3.11Å
51	L	93.1	Very high	95.6	Very high	137 Å²	137	88.3 Å²	88.3	72%	0.717	44%	0.439	S	S	*	.	H	α-helix	trans	-64.3	-32.9	179.4	-176.6	62.8	0	0	0	112.3	D53 S54 V55	L51-D53 VanDerWaalsContact C-N 3.3Å; L51-D53 PolarHBondContact O-N 2.97Å; L51-S54 PolarHBondContact O-N 3.33Å; L51-V55 HydrophobicContact CD1-CG2 4.3Å; L51-V55 HydrophobicContact CG-CG2 4.17Å; L51-V55 WeakPolarHBondContact O-CG2 3.17Å; L51-V55 PolarHBondContact O-N 2.84Å
52	S	95	Very high	95.6	Very high	85 Å²	85	90.8 Å²	90.8	59%	0.594	46%	0.456	S	S	*	.	H	α-helix	trans	-56.4	-42.9	-179.8	-174.4	0	0	0	0	112.3	Q50 V55 L56	Q50-S52 VanDerWaalsContact C-N 3.27Å; Q50-S52 PolarHBondContact O-N 2.81Å; S52-V55 PolarHBondContact O-N 3.17Å; S52-L56 WeakPolarHBondContact O-CB 3.1Å; S52-L56 PolarHBondContact O-N 3.48Å
53	D	93.7	Very high	95.6	Very high	36 Å²	36	91.1 Å²	91.1	19%	0.193	46%	0.458	C	S	.	.	H	α-helix	trans	-67	-41.4	-179.1	-79.9	9.4	0	0	0	111.6	K48 Q50 L51 V55 L56 I57	K48-D53 HydrophobicContact CD-CB 4.5Å; K48-D53 WeakPolarHBondContact CD-OD2 3.27Å; K48-D53 WeakPolarHBondContact CE-OD2 3.3Å; K48-D53 IonicContact NZ-OD2 2.74Å; K48-D53 PolarHBondContact NZ-OD2 3.07Å; Q50-D53 PolarHBondContact O-N 3.11Å; L51-D53 VanDerWaalsContact C-N 3.3Å; L51-D53 PolarHBondContact O-N 2.97Å; D53-V55 PolarHBondContact O-N 3.31Å; D53-L56 PolarHBondContact O-N 3.29Å; D53-I57 WeakPolarHBondContact O-CD1 3.48Å; D53-I57 VanDerWaalsContact O-CG1 3.24Å; D53-I57 WeakPolarHBondContact O-CG1 3.44Å; D53-I57 PolarHBondContact O-N 3.46Å
54	S	95.8	Very high	95.6	Very high	16 Å²	16	91 Å²	91	11%	0.112	45%	0.45	C	S	.	.	H	α-helix	trans	-60.2	-46.2	173.8	-62.6	0	0	0	0	112.3	A41 G45 L51 L56 I57 L58	A41-S54 WeakPolarHBondContact CB-O 3.43Å; A41-S54 WeakPolarHBondContact O-CB 3.33Å; A41-S54 PolarHBondContact O-OG 3.42Å; G45-S54 WeakPolarHBondContact CA-OG 3.38Å; L51-S54 PolarHBondContact O-N 3.33Å; S54-L56 VanDerWaalsContact C-N 3.33Å; S54-L56 PolarHBondContact O-N 3.25Å; S54-I57 PolarHBondContact O-N 3.24Å; S54-L58 WeakPolarHBondContact O-CB 3.49Å; S54-L58 PolarHBondContact O-N 3.07Å
55	V	96.6	Very high	95.7	Very high	84 Å²	84	88.8 Å²	88.8	51%	0.509	44%	0.436	S	S	.	.	H	α-helix	trans	-64.7	-40.7	-179	174	0	0	0	0	110.4	L51 S52 D53 L58 L59	L51-V55 HydrophobicContact CD1-CG2 4.3Å; L51-V55 HydrophobicContact CG-CG2 4.17Å; L51-V55 WeakPolarHBondContact O-CG2 3.17Å; L51-V55 PolarHBondContact O-N 2.84Å; S52-V55 PolarHBondContact O-N 3.17Å; D53-V55 PolarHBondContact O-N 3.31Å; V55-L58 PolarHBondContact O-N 2.93Å; V55-L59 VanDerWaalsContact O-CB 3.26Å; V55-L59 WeakPolarHBondContact O-CB 3.44Å; V55-L59 PolarHBondContact O-N 3.24Å
56	L	96.5	Very high	95.7	Very high	117 Å²	117	90 Å²	90	61%	0.613	45%	0.446	S	S	*	.	H	α-helix	trans	-63.4	-45	177	-167.1	96.9	0	0	0	111.8	S52 D53 S54 L59 F60	S52-L56 WeakPolarHBondContact O-CB 3.1Å; S52-L56 PolarHBondContact O-N 3.48Å; D53-L56 PolarHBondContact O-N 3.29Å; S54-L56 VanDerWaalsContact C-N 3.33Å; S54-L56 PolarHBondContact O-N 3.25Å; L56-L59 PolarHBondContact O-N 3.22Å; L56-F60 WeakPolarHBondContact O-CB 3.34Å; L56-F60 PolarHBondContact O-N 3.33Å
57	I	96.7	Very high	95.7	Very high	42 Å²	42	86.5 Å²	86.5	22%	0.215	44%	0.435	C	S	.	.	H	α-helix	trans	-63.4	-44.4	177.6	-67.5	165.3	0	0	0	110.4	F37 I40 A41 V44 D53 S54 F60 G61	F37-I57 HydrophobicContact CD1-CG2 4.4Å; I40-I57 HydrophobicContact CG2-CG2 4.31Å; A41-I57 HydrophobicContact CB-CB 4.07Å; A41-I57 HydrophobicContact CB-CG2 3.9Å; V44-I57 HydrophobicContact CB-CD1 3.84Å; V44-I57 HydrophobicContact CG1-CD1 3.67Å; V44-I57 HydrophobicContact CG2-CD1 4.18Å; D53-I57 WeakPolarHBondContact O-CD1 3.48Å; D53-I57 VanDerWaalsContact O-CG1 3.24Å; D53-I57 WeakPolarHBondContact O-CG1 3.44Å; D53-I57 PolarHBondContact O-N 3.46Å; S54-I57 PolarHBondContact O-N 3.24Å; I57-F60 PolarHBondContact O-N 3.03Å; I57-G61 PolarHBondContact O-N 2.83Å
58	L	97	Very high	95.5	Very high	55 Å²	55	78.3 Å²	78.3	29%	0.288	41%	0.406	S	S	.	.	H	α-helix	trans	-63.7	-43.2	177.7	-176.4	63.8	0	0	0	111.2	L38 A41 S54 V55 G61 C62	L38-L58 HydrophobicContact CB-CD1 4.28Å; L38-L58 HydrophobicContact CD1-CD1 4.22Å; L38-L58 HydrophobicContact CD1-CD2 4.46Å; A41-L58 HydrophobicContact CB-CB 4.27Å; S54-L58 WeakPolarHBondContact O-CB 3.49Å; S54-L58 PolarHBondContact O-N 3.07Å; V55-L58 PolarHBondContact O-N 2.93Å; L58-G61 PolarHBondContact O-N 3.43Å; L58-C62 PolarHBondContact O-N 2.83Å; L58-C62 PolarHBondContact O-SG 3.32Å
59	L	97.5	Very high	95.4	Very high	100 Å²	100	73.7 Å²	73.7	52%	0.524	39%	0.388	S	S	.	.	H	α-helix	trans	-60	-47.2	176.5	-178.7	67.3	0	0	0	111.2	V55 L56 G61 C62 L63	V55-L59 VanDerWaalsContact O-CB 3.26Å; V55-L59 WeakPolarHBondContact O-CB 3.44Å; V55-L59 PolarHBondContact O-N 3.24Å; L56-L59 PolarHBondContact O-N 3.22Å; L59-G61 VanDerWaalsContact C-N 3.32Å; L59-G61 PolarHBondContact O-N 3.32Å; L59-C62 PolarHBondContact O-N 3.18Å; L59-L63 HydrophobicContact CG-CD1 4.42Å; L59-L63 WeakPolarHBondContact O-CG 3.43Å; L59-L63 PolarHBondContact O-N 3.04Å
60	F	97.4	Very high	95.1	Very high	126 Å²	126	71.7 Å²	71.7	55%	0.553	38%	0.383	S	S	*	.	H	α-helix	trans	-58.7	-45.4	174.7	179	-95.9	0	0	0	111.3	F37 L56 I57 C62 L63 F64	F37-F60 HydrophobicContact CE1-CD1 4.1Å; F37-F60 HydrophobicContact CE1-CE1 4.37Å; F37-F60 HydrophobicContact CZ-CD1 4.47Å; F37-F60 HydrophobicContact CZ-CE1 4.45Å; L56-F60 WeakPolarHBondContact O-CB 3.34Å; L56-F60 PolarHBondContact O-N 3.33Å; I57-F60 PolarHBondContact O-N 3.03Å; F60-C62 VanDerWaalsContact C-N 3.35Å; F60-C62 PolarHBondContact O-N 3.21Å; F60-L63 PolarHBondContact O-N 3.02Å; F60-F64 VanDerWaalsContact O-CB 3.32Å; F60-F64 WeakPolarHBondContact O-CB 3.25Å; F60-F64 PolarHBondContact O-N 3.48Å
61	G	97.3	Very high	94.9	Very high	0 Å²	0	68.2 Å²	68.2	0%	0	37%	0.37	C	S	.	.	H	α-helix	trans	-59.8	-41.4	176.1	0	0	0	0	0	113.4	I57 L58 L59 F64 A65	I57-G61 PolarHBondContact O-N 2.83Å; L58-G61 PolarHBondContact O-N 3.43Å; L59-G61 VanDerWaalsContact C-N 3.32Å; L59-G61 PolarHBondContact O-N 3.32Å; G61-F64 PolarHBondContact O-N 2.8Å; G61-A65 VanDerWaalsContact O-CB 3.29Å; G61-A65 WeakPolarHBondContact O-CB 3.28Å; G61-A65 PolarHBondContact O-N 3.47Å
62	C	96.8	Very high	94.5	Very high	55 Å²	55	64.1 Å²	64.1	37%	0.372	35%	0.351	S	S	.	.	H	α-helix	trans	-65.5	-45.2	175.7	-72.4	0	0	0	0	112.1	L58 L59 F60 F64 A65 A66	L58-C62 PolarHBondContact O-N 2.83Å; L58-C62 PolarHBondContact O-SG 3.32Å; L59-C62 PolarHBondContact O-N 3.18Å; F60-C62 VanDerWaalsContact C-N 3.35Å; F60-C62 PolarHBondContact O-N 3.21Å; C62-F64 VanDerWaalsContact C-N 3.32Å; C62-F64 PolarHBondContact O-N 2.62Å; C62-A65 PolarHBondContact O-N 3.47Å; C62-A66 WeakPolarHBondContact O-CB 3.44Å; C62-A66 PolarHBondContact O-N 3.21Å
63	L	97.2	Very high	94	Very high	113 Å²	113	64.7 Å²	64.7	59%	0.592	34%	0.34	S	S	*	.	H	α-helix	trans	-62.8	-41.4	176.1	-70.6	174.8	0	0	0	111.3	L59 F60 A66 F67	L59-L63 HydrophobicContact CG-CD1 4.42Å; L59-L63 WeakPolarHBondContact O-CG 3.43Å; L59-L63 PolarHBondContact O-N 3.04Å; F60-L63 PolarHBondContact O-N 3.02Å; L63-A66 PolarHBondContact O-N 3.04Å; L63-F67 WeakPolarHBondContact O-CB 3.43Å; L63-F67 PolarHBondContact O-N 2.79Å
64	F	96.8	Very high	93.4	Very high	88 Å²	88	68.2 Å²	68.2	39%	0.386	37%	0.365	S	S	.	.	H	α-helix	trans	-64.4	-46	176	-175.1	-100.1	0	0	0	111.6	L33 F37 F60 G61 C62 A66 F67 V68	L33-F64 HydrophobicContact CD1-CD1 4.3Å; L33-F64 HydrophobicContact CD1-CE1 4.29Å; L33-F64 HydrophobicContact CD2-CD1 4.45Å; L33-F64 HydrophobicContact CD2-CE1 4.18Å; F37-F64 AromaticContact CE2-CD1 3.87Å; F37-F64 HydrophobicContact CE2-CD1 3.87Å; F37-F64 HydrophobicContact CZ-CD1 4.2Å; F60-F64 VanDerWaalsContact O-CB 3.32Å; F60-F64 WeakPolarHBondContact O-CB 3.25Å; F60-F64 PolarHBondContact O-N 3.48Å; G61-F64 PolarHBondContact O-N 2.8Å; C62-F64 VanDerWaalsContact C-N 3.32Å; C62-F64 PolarHBondContact O-N 2.62Å; F64-A66 VanDerWaalsContact C-N 3.33Å; F64-A66 PolarHBondContact O-N 3Å; F64-F67 PolarHBondContact O-N 3.4Å; F64-V68 HydrophobicContact CD1-CG2 4.29Å; F64-V68 HydrophobicContact CE1-CG2 3.91Å; F64-V68 HydrophobicContact CE2-CG2 4.49Å; F64-V68 HydrophobicContact CZ-CG2 4.02Å; F64-V68 WeakPolarHBondContact O-CG2 3.24Å; F64-V68 PolarHBondContact O-N 3.15Å
65	A	96.5	Very high	92.7	Very high	1 Å²	1	71.6 Å²	71.6	1%	0.008	39%	0.388	C	S	.	.	H	α-helix	trans	-61.1	-41.3	176	0	0	0	0	0	111.8	M30 L33 V34 G61 C62 V68 A69	M30-A65 HydrophobicContact CG-CB 4.28Å; L33-A65 HydrophobicContact CB-CB 3.96Å; L33-A65 HydrophobicContact CD1-CB 4.25Å; V34-A65 HydrophobicContact CG2-CB 3.82Å; G61-A65 VanDerWaalsContact O-CB 3.29Å; G61-A65 WeakPolarHBondContact O-CB 3.28Å; G61-A65 PolarHBondContact O-N 3.47Å; C62-A65 PolarHBondContact O-N 3.47Å; A65-V68 PolarHBondContact O-N 3.4Å; A65-A69 VanDerWaalsContact O-CB 3.27Å; A65-A69 WeakPolarHBondContact O-CB 3.36Å; A65-A69 PolarHBondContact O-N 2.93Å
66	A	94.7	Very high	92	Very high	34 Å²	34	68.9 Å²	68.9	28%	0.281	37%	0.369	S	S	.	.	H	α-helix	trans	-62.9	-43.1	174.3	0	0	0	0	0	111.6	C62 L63 F64 V68 A69 L70	C62-A66 WeakPolarHBondContact O-CB 3.44Å; C62-A66 PolarHBondContact O-N 3.21Å; L63-A66 PolarHBondContact O-N 3.04Å; F64-A66 VanDerWaalsContact C-N 3.33Å; F64-A66 PolarHBondContact O-N 3Å; A66-V68 VanDerWaalsContact C-N 3.28Å; A66-V68 PolarHBondContact O-N 3.48Å; A66-A69 PolarHBondContact O-N 2.92Å; A66-L70 HydrophobicContact CB-CD1 3.99Å; A66-L70 HydrophobicContact CB-CG 4.47Å; A66-L70 WeakPolarHBondContact O-CB 3.49Å; A66-L70 VanDerWaalsContact O-CG 3.24Å; A66-L70 WeakPolarHBondContact O-CG 3.36Å; A66-L70 PolarHBondContact O-N 2.92Å
67	F	94.2	Very high	91.3	Very high	124 Å²	124	66.4 Å²	66.4	54%	0.544	35%	0.354	S	S	.	.	H	α-helix	trans	-63.5	-32.8	175.5	-178.6	-98.1	0	0	0	112.8	L63 F64 P71 W73	L63-F67 WeakPolarHBondContact O-CB 3.43Å; L63-F67 PolarHBondContact O-N 2.79Å; F64-F67 PolarHBondContact O-N 3.4Å; F67-P71 WeakPolarHBondContact O-CD 3.3Å; F67-P71 WeakPolarHBondContact O-CG 3.3Å; F67-W73 HydrophobicContact CD1-CZ2 4.33Å; F67-W73 HydrophobicContact CE1-CH2 4.14Å; F67-W73 AromaticContact CE1-CZ2 3.75Å; F67-W73 HydrophobicContact CE1-CZ2 3.75Å; F67-W73 HydrophobicContact CE2-CZ2 4.4Å; F67-W73 AromaticContact CZ-CH2 3.86Å; F67-W73 HydrophobicContact CZ-CH2 3.86Å; F67-W73 AromaticContact CZ-CZ2 3.79Å; F67-W73 HydrophobicContact CZ-CZ2 3.79Å; F67-W73 PolarHBondContact O-NE1 3.04Å
68	V	92.9	Very high	90.6	Very high	32 Å²	32	71.6 Å²	71.6	19%	0.194	38%	0.375	C	S	.	.	H	α-helix	trans	-78.1	-39.9	176.5	174	0	0	0	0	111.5	L33 F64 A65 A66 W73	L33-V68 HydrophobicContact CD1-CB 4.02Å; L33-V68 HydrophobicContact CD1-CG1 4.11Å; L33-V68 HydrophobicContact CD1-CG2 4.17Å; F64-V68 HydrophobicContact CD1-CG2 4.29Å; F64-V68 HydrophobicContact CE1-CG2 3.91Å; F64-V68 HydrophobicContact CE2-CG2 4.49Å; F64-V68 HydrophobicContact CZ-CG2 4.02Å; F64-V68 WeakPolarHBondContact O-CG2 3.24Å; F64-V68 PolarHBondContact O-N 3.15Å; A65-V68 PolarHBondContact O-N 3.4Å; A66-V68 VanDerWaalsContact C-N 3.28Å; A66-V68 PolarHBondContact O-N 3.48Å; V68-W73 PolarHBondContact O-NE1 3.3Å
69	A	92	Very high	89.8	Confident	13 Å²	13	72.9 Å²	72.9	11%	0.107	38%	0.382	C	S	.	.	H	α-helix	trans	-90	-29.2	-171.2	0	0	0	0	0	114.8	A26 M30 A65 A66	A26-A69 HydrophobicContact CB-CB 4.2Å; M30-A69 HydrophobicContact CB-CB 4Å; M30-A69 HydrophobicContact CG-CB 4.5Å; A65-A69 VanDerWaalsContact O-CB 3.27Å; A65-A69 WeakPolarHBondContact O-CB 3.36Å; A65-A69 PolarHBondContact O-N 2.93Å; A66-A69 PolarHBondContact O-N 2.92Å
70	L	88.8	Confident	88.9	Confident	137 Å²	137	72.8 Å²	72.8	72%	0.717	39%	0.387	S	S	*	.	S	Bend	trans	-81.3	-45.6	-174	-67.3	175	0	0	0	114.3	A66	A66-L70 HydrophobicContact CB-CD1 3.99Å; A66-L70 HydrophobicContact CB-CG 4.47Å; A66-L70 WeakPolarHBondContact O-CB 3.49Å; A66-L70 VanDerWaalsContact O-CG 3.24Å; A66-L70 WeakPolarHBondContact O-CG 3.36Å; A66-L70 PolarHBondContact O-N 2.92Å
71	P	86.6	Confident	88	Confident	38 Å²	38	70.7 Å²	70.7	25%	0.247	39%	0.385	C	S	.	.	S	Bend	trans	-63.7	134.4	177.6	-20	34.1	0	0	0	108.9	F67 W73	F67-P71 WeakPolarHBondContact O-CD 3.3Å; F67-P71 WeakPolarHBondContact O-CG 3.3Å; P71-W73 HydrophobicContact CB-CD2 4.06Å; P71-W73 HydrophobicContact CB-CG 4.43Å; P71-W73 HydrophobicContact CB-CH2 4.44Å; P71-W73 HydrophobicContact CB-CZ2 3.82Å; P71-W73 HydrophobicContact CG-CZ2 3.72Å; P71-W73 PolarHBondContact O-N 3.49Å
72	P	83.9	Confident	87	Confident	50 Å²	50	78.1 Å²	78.1	33%	0.325	42%	0.424	S	S	.	.			trans	-73.1	71.3	174.4	30.1	-33.1	0	0	0	108.6	I16	I16-P72 HydrophobicContact CB-CG 4.05Å
73	W	85.5	Confident	86.2	Confident	98 Å²	98	84.8 Å²	84.8	37%	0.371	44%	0.442	S	S	.	.			trans	-57.6	143.3	178.2	-62.1	109.1	0	0	0	108.9	F67 V68 P71 C75 Y76	F67-W73 HydrophobicContact CD1-CZ2 4.33Å; F67-W73 HydrophobicContact CE1-CH2 4.14Å; F67-W73 AromaticContact CE1-CZ2 3.75Å; F67-W73 HydrophobicContact CE1-CZ2 3.75Å; F67-W73 HydrophobicContact CE2-CZ2 4.4Å; F67-W73 AromaticContact CZ-CH2 3.86Å; F67-W73 HydrophobicContact CZ-CH2 3.86Å; F67-W73 AromaticContact CZ-CZ2 3.79Å; F67-W73 HydrophobicContact CZ-CZ2 3.79Å; F67-W73 PolarHBondContact O-NE1 3.04Å; V68-W73 PolarHBondContact O-NE1 3.3Å; P71-W73 HydrophobicContact CB-CD2 4.06Å; P71-W73 HydrophobicContact CB-CG 4.43Å; P71-W73 HydrophobicContact CB-CH2 4.44Å; P71-W73 HydrophobicContact CB-CZ2 3.82Å; P71-W73 HydrophobicContact CG-CZ2 3.72Å; P71-W73 PolarHBondContact O-N 3.49Å; W73-C75 PolarHBondContact O-N 2.9Å; W73-Y76 HydrophobicContact CB-CD2 4.05Å; W73-Y76 HydrophobicContact CB-CE2 4.36Å; W73-Y76 AromaticContact CD1-CE2 3.82Å; W73-Y76 PolarHBondContact O-N 3.17Å
74	P	80.2	Confident	85.2	Confident	109 Å²	109	88.3 Å²	88.3	71%	0.708	45%	0.449	S	S	*	.	G	3₁₀ helix	trans	-52.9	-24.2	-179.7	-27.6	34	0	0	0	114	Y76 H77	P74-Y76 PolarHBondContact O-N 2.97Å; P74-H77 PolarHBondContact O-N 3.11Å
75	C	80.9	Confident	83.9	Confident	88 Å²	88	90.9 Å²	90.9	60%	0.595	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-62.2	-26.4	174.8	-65.6	0	0	0	0	114.5	W73	W73-C75 PolarHBondContact O-N 2.9Å
76	Y	83.3	Confident	82.4	Confident	26 Å²	26	97.5 Å²	97.5	10%	0.102	49%	0.492	C	S	.	.	G	3₁₀ helix	trans	-93.4	4.4	-178.9	-63.7	-50.8	0	0	0	113.9	M18 D19 G22 N25 A26 W73 P74	M18-Y76 HydrophobicContact CE-CD1 3.97Å; M18-Y76 HydrophobicContact CE-CD2 3.64Å; M18-Y76 HydrophobicContact CE-CE1 4.49Å; M18-Y76 HydrophobicContact CE-CE2 4.16Å; M18-Y76 HydrophobicContact CE-CG 3.54Å; D19-Y76 PolarHBondContact N-O 3.43Å; D19-Y76 VanDerWaalsContact OD2-O 3.05Å; G22-Y76 WeakPolarHBondContact CA-O 3.47Å; G22-Y76 WeakPolarHBondContact O-CD1 3.44Å; N25-Y76 HydrophobicContact CB-CD1 4.23Å; N25-Y76 HydrophobicContact CB-CE1 4.06Å; A26-Y76 HydrophobicContact CB-CD1 4.42Å; A26-Y76 HydrophobicContact CB-CE1 3.88Å; A26-Y76 HydrophobicContact CB-CE2 3.99Å; W73-Y76 HydrophobicContact CB-CD2 4.05Å; W73-Y76 HydrophobicContact CB-CE2 4.36Å; W73-Y76 AromaticContact CD1-CE2 3.82Å; W73-Y76 PolarHBondContact O-N 3.17Å; P74-Y76 PolarHBondContact O-N 2.97Å
77	H	81.4	Confident	80.7	Confident	66 Å²	66	104.1 Å²	104.1	31%	0.306	52%	0.518	S	S	.	.			trans	-120.9	59.9	178.5	-162.7	115.7	0	0	0	109.6	N15 Y17 D19 P74	N15-H77 PolarHBondContact ND2-CE1 3.46Å; N15-H77 PolarHBondContact OD1-CE1 3.16Å; N15-H77 PolarHBondContact OD1-ND1 3.36Å; Y17-H77 PolarHBondContact O-ND1 3.34Å; D19-H77 VanDerWaalsContact OD2-CA 3.25Å; D19-H77 WeakPolarHBondContact OD2-CA 3.31Å; P74-H77 PolarHBondContact O-N 3.11Å
78	K	81	Confident	79	Confident	150 Å²	150	102.5 Å²	102.5	65%	0.652	52%	0.518	S	S	*	.	S	Bend	trans	-111.2	-11.8	-178.2	-69.3	-172.2	179.1	-176.9	0	113.3	D19	D19-K78 PolarHBondContact OD2-N 3.1Å
79	N	81.3	Confident	77.2	Confident	83 Å²	83	108.6 Å²	108.6	44%	0.444	54%	0.542	S	S	.	.			trans	-130.9	70.5	-174.6	-55.6	-82.9	0	0	0	110.1	D19 V21 V81	D19-N79 PolarHBondContact OD2-N 2.99Å; V21-N79 HydrophobicContact CB-CB 4.15Å; V21-N79 HydrophobicContact CG2-CB 3.92Å; N79-V81 PolarHBondContact O-N 3.29Å
80	P	78.7	Confident	75.4	Confident	97 Å²	97	113.4 Å²	113.4	63%	0.63	58%	0.575	S	S	*	*			trans	-61.6	134.5	172.4	27.1	-33	0	0	0	109.9
81	V	78.5	Confident	73.8	Confident	82 Å²	82	111.6 Å²	111.6	50%	0.497	57%	0.573	S	S	.	*			trans	-77.9	124.2	177.4	176.7	0	0	0	0	108.8	N79 W83	N79-V81 PolarHBondContact O-N 3.29Å; V81-W83 HydrophobicContact CG1-CD2 4.13Å; V81-W83 HydrophobicContact CG1-CG 4.44Å; V81-W83 HydrophobicContact CG1-CZ2 4.11Å; V81-W83 VanDerWaalsContact O-CD1 3.3Å; V81-W83 PolarHBondContact O-N 3.38Å
82	D	75.7	Confident	72.3	Confident	156 Å²	156	119 Å²	119	83%	0.834	60%	0.602	S	S	*	*			trans	-85.2	107.1	173	-166.6	11.2	0	0	0	109.6	Y84	D82-Y84 PolarHBondContact O-N 3.46Å
83	W	80.4	Confident	71	Confident	196 Å²	196	125.7 Å²	125.7	74%	0.742	63%	0.626	S	S	*	*			trans	-84.9	106.2	-178.8	-61.2	89.7	0	0	0	109.1	V81 H85	V81-W83 HydrophobicContact CG1-CD2 4.13Å; V81-W83 HydrophobicContact CG1-CG 4.44Å; V81-W83 HydrophobicContact CG1-CZ2 4.11Å; V81-W83 VanDerWaalsContact O-CD1 3.3Å; V81-W83 PolarHBondContact O-N 3.38Å; W83-H85 PolarHBondContact O-N 2.91Å; W83-H85 VanDerWaalsContact O-N 3.15Å; W83-H85 PolarHBondContact O-ND1 3.15Å
84	Y	75.1	Confident	69.5	Low	186 Å²	186	126.3 Å²	126.3	73%	0.729	64%	0.64	S	S	*	*			trans	-59.8	119.4	175.3	-162.1	-91.2	0	0	0	110.3	D82 E86	D82-Y84 PolarHBondContact O-N 3.46Å; Y84-E86 PolarHBondContact O-N 3.49Å
85	H	69.8	Low	68	Low	142 Å²	142	132.2 Å²	132.2	66%	0.657	67%	0.666	S	S	*	*			trans	-76.1	125.6	176.6	-71	23.6	0	0	0	108.8	W83 E87	W83-H85 PolarHBondContact O-N 2.91Å; W83-H85 VanDerWaalsContact O-N 3.15Å; W83-H85 PolarHBondContact O-ND1 3.15Å; H85-E87 PolarHBondContact O-N 3.26Å
86	E	64.7	Low	67.3	Low	141 Å²	141	134.5 Å²	134.5	66%	0.659	67%	0.67	S	S	*	*			trans	-73.3	49.5	-176.9	-51.1	-169.7	-129.9	0	0	112.6	Y84 T88 K89	Y84-E86 PolarHBondContact O-N 3.49Å; E86-T88 PolarHBondContact O-N 2.81Å; E86-K89 IonicContact OE2-NZ 3.79Å
87	E	60.6	Low	66.5	Low	173 Å²	173	140.2 Å²	140.2	81%	0.808	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-5.8	175.6	-65.1	-164.8	-179.3	0	0	112.6	H85	H85-E87 PolarHBondContact O-N 3.26Å
88	T	57.8	Low	65.6	Low	89 Å²	89	144.3 Å²	144.3	55%	0.546	72%	0.721	S	S	.	*	T	Hydrogen-bonded Turn	trans	-120.9	7.9	-171.5	50.4	0	0	0	0	116.7	E86	E86-T88 PolarHBondContact O-N 2.81Å
89	K	54.6	Low	64.7	Low	161 Å²	161	143.9 Å²	143.9	70%	0.7	73%	0.725	S	S	*	*	S	Bend	trans	-84.3	-16.3	172.7	-83.9	-171.7	-174.6	165.7	0	114.9	E86 S91	E86-K89 IonicContact OE2-NZ 3.79Å; K89-S91 PolarHBondContact O-N 3.5Å
90	S	54.8	Low	63.7	Low	114 Å²	114	147.8 Å²	147.8	80%	0.797	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-13	178.9	-164	0	0	0	0	114.3
91	S	54.8	Low	62.7	Low	98 Å²	98	151.1 Å²	151.1	69%	0.685	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.9	5.6	-174.9	-163.6	0	0	0	0	115	K89	K89-S91 PolarHBondContact O-N 3.5Å
92	K	55.8	Low	61.6	Low	195 Å²	195	156.1 Å²	156.1	85%	0.848	77%	0.769	S	S	*	*	S	Bend	trans	-118.2	20.2	177.4	-80.3	-162	177.7	-176	0	114.6
93	K	56.5	Low	60.5	Low	190 Å²	190	156.1 Å²	156.1	83%	0.826	76%	0.764	S	S	*	*	S	Bend	trans	-115.8	18.3	171.7	-129.3	-174.7	-173.5	-174.2	0	114.2
94	T	54.4	Low	58.8	Low	111 Å²	111	152.8 Å²	152.8	68%	0.681	77%	0.765	S	S	*	*			trans	-135.6	71	170.2	48.6	0	0	0	0	108.5
95	D	47.1	Very low	57.4	Low	233 Å²	233	149.7 Å²	149.7	100%	1.246	77%	0.769	S	S	*	*			trans	-150.3	0	147	-81.1	-36.4	0	0	0	105.9

Retrieved 95 of 95 residues in 92.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).