A0A3Q0KDC8_SCHMA Loading...

Zf-CHCC domain-containing protein

AlphaFold DB , UniProt , Accession A0A3Q0KDC8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 87 aa.

						>A0A3Q0KDC8_SCHMA|A0A3Q0KDC8
MMDGTSDTTNISHPPAVKAGKMRIVKHVKHDATVEVRCEEDSPHELLTKEELEYHDRCIKAYHDKPMPTVTKPHNDNTKRIIQQPLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.9	Very low	56.3	Low	244 Å²	244	139.4 Å²	139.4	100%	1.202	80%	0.796	S	S	*	*				0	132.3	0	-61.2	-163.1	-158	0	0	106.9
2	M	47.3	Very low	57.6	Low	177 Å²	177	137 Å²	137	87%	0.872	80%	0.795	S	S	*	*			trans	-49.8	159.8	173.8	-59.1	86.7	132.4	0	0	111
3	D	48.1	Very low	59.1	Low	162 Å²	162	138.7 Å²	138.7	87%	0.866	79%	0.79	S	S	*	*			cis	-175.2	161	34.1	-138.6	-8.7	0	0	0	103.3
4	G	53.1	Low	60.3	Low	61 Å²	61	136.8 Å²	136.8	63%	0.629	79%	0.786	S	S	*	*			cis	-179.3	138.5	31.1	0	0	0	0	0	108.4	S6	G4-S6 PolarHBondContact O-N 3.35Å
5	T	51.2	Low	61.6	Low	122 Å²	122	135.1 Å²	135.1	75%	0.748	78%	0.781	S	S	*	*			trans	-69.4	108.4	177.4	43.8	0	0	0	0	110.2	D7	T5-D7 VanDerWaalsContact C-N 3.27Å; T5-D7 PolarHBondContact O-N 3.14Å; T5-D7 VanDerWaalsContact O-N 3.14Å
6	S	57.6	Low	62.8	Low	110 Å²	110	133.4 Å²	133.4	77%	0.769	79%	0.789	S	S	*	*			trans	-81.6	80.6	162.8	59.8	0	0	0	0	108.5	G4 T8	G4-S6 PolarHBondContact O-N 3.35Å; S6-T8 VanDerWaalsContact C-N 3.34Å; S6-T8 PolarHBondContact O-N 2.94Å
7	D	58.6	Low	63.7	Low	133 Å²	133	133.4 Å²	133.4	71%	0.711	79%	0.79	S	S	*	*			trans	-62.7	98	167.2	-79.3	-53.5	0	0	0	108.4	T5 T9	T5-D7 VanDerWaalsContact C-N 3.27Å; T5-D7 PolarHBondContact O-N 3.14Å; T5-D7 VanDerWaalsContact O-N 3.14Å; D7-T9 PolarHBondContact O-N 3.08Å
8	T	60.8	Low	64.8	Low	120 Å²	120	136.4 Å²	136.4	74%	0.736	79%	0.791	S	S	*	*			trans	-61.9	97.3	168.4	37.7	0	0	0	0	108.5	S6 N10	S6-T8 VanDerWaalsContact C-N 3.34Å; S6-T8 PolarHBondContact O-N 2.94Å; T8-N10 PolarHBondContact O-N 3.36Å; T8-N10 PolarHBondContact O-ND2 3.21Å
9	T	63.1	Low	65.6	Low	120 Å²	120	133.8 Å²	133.8	74%	0.736	79%	0.788	S	S	*	*			trans	-62.5	105.2	169.6	32.5	0	0	0	0	108.6	D7 I11	D7-T9 PolarHBondContact O-N 3.08Å; T9-I11 PolarHBondContact O-N 3.02Å
10	N	62.5	Low	66.3	Low	156 Å²	156	131.1 Å²	131.1	83%	0.834	79%	0.789	S	S	*	*			trans	-69.1	92.7	173.2	-77.6	-81	0	0	0	108.7	T8 S12	T8-N10 PolarHBondContact O-N 3.36Å; T8-N10 PolarHBondContact O-ND2 3.21Å; N10-S12 PolarHBondContact O-N 3.49Å
11	I	69.1	Low	67	Low	128 Å²	128	134.1 Å²	134.1	66%	0.656	79%	0.791	S	S	*	*			trans	-75.1	103.3	173.7	-57	171	0	0	0	107.2	T9 H13	T9-I11 PolarHBondContact O-N 3.02Å; I11-H13 PolarHBondContact O-N 3.01Å
12	S	71.9	Confident	68.5	Low	111 Å²	111	131 Å²	131	78%	0.776	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-70.8	116.1	173.1	68.3	0	0	0	0	109.6	N10	N10-S12 PolarHBondContact O-N 3.49Å
13	H	76.9	Confident	70.2	Confident	159 Å²	159	133.4 Å²	133.4	74%	0.736	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-83.5	121.7	172	-63.2	-27.9	0	0	0	109.8	I11	I11-H13 PolarHBondContact O-N 3.01Å
14	P	76.9	Confident	71.7	Confident	112 Å²	112	133.1 Å²	133.1	73%	0.727	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-65.3	148.2	174.3	27.8	-33	0	0	0	110.1
15	P	79.3	Confident	72.9	Confident	111 Å²	111	135 Å²	135	72%	0.721	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-63.5	140.7	-179.7	26.5	-33.7	0	0	0	110.7	V17	P15-V17 PolarHBondContact O-N 3.46Å; P15-V17 VanDerWaalsContact O-N 3.15Å
16	A	81.4	Confident	74.4	Confident	109 Å²	109	137.7 Å²	137.7	90%	0.901	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-60.3	118.9	174	0	0	0	0	0	110
17	V	77.3	Confident	75	Confident	133 Å²	133	140.4 Å²	140.4	81%	0.806	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-102.7	128.4	172.6	-77.6	0	0	0	0	109.3	P15 A19	P15-V17 PolarHBondContact O-N 3.46Å; P15-V17 VanDerWaalsContact O-N 3.15Å; V17-A19 PolarHBondContact O-N 3.31Å; V17-A19 VanDerWaalsContact O-N 3.11Å
18	K	83.3	Confident	75.4	Confident	187 Å²	187	140.6 Å²	140.6	81%	0.813	78%	0.779	S	S	*	*			trans	-69.8	107.4	177.3	-173.3	173.1	-174.8	170.1	0	109.4	G20	K18-G20 PolarHBondContact O-N 2.98Å
19	A	79.6	Confident	75.1	Confident	88 Å²	88	144 Å²	144	73%	0.727	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-60.9	126.8	166.9	0	0	0	0	0	108.9	V17	V17-A19 PolarHBondContact O-N 3.31Å; V17-A19 VanDerWaalsContact O-N 3.11Å
20	G	80.6	Confident	74.4	Confident	78 Å²	78	146.6 Å²	146.6	80%	0.804	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-58	137.8	-178.1	0	0	0	0	0	111.8	K18	K18-G20 PolarHBondContact O-N 2.98Å
21	K	79.9	Confident	73.7	Confident	195 Å²	195	146.4 Å²	146.4	85%	0.848	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-78.8	139.2	175.5	-68.9	-174.9	176.2	-174.3	0	110.2
22	M	81	Confident	72.6	Confident	180 Å²	180	144.2 Å²	144.2	89%	0.887	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-82.9	130.8	175.1	-171.7	155.6	60.4	0	0	110.2
23	R	82	Confident	71.3	Confident	226 Å²	226	145.3 Å²	145.3	85%	0.853	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-90.3	128.3	177.4	-170.6	177.2	-174.8	171.3	1.8	109.8	V25	R23-V25 HydrophobicContact CG-CG2 4.49Å
24	I	80.6	Confident	70.2	Confident	156 Å²	156	142.9 Å²	142.9	80%	0.8	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-99.4	131	171.2	-56.2	174.3	0	0	0	108.1
25	V	77.3	Confident	69	Low	102 Å²	102	145.5 Å²	145.5	62%	0.618	79%	0.788	S	S	*	*			trans	-115.7	123.9	173.7	179.8	0	0	0	0	108.3	R23	R23-V25 HydrophobicContact CG-CG2 4.49Å
26	K	82.3	Confident	67.7	Low	177 Å²	177	145.3 Å²	145.3	77%	0.77	78%	0.784	S	S	*	*			trans	-107.9	123.8	173.2	-171.9	177.4	179.4	-177.7	0	108.8	V28	K26-V28 PolarHBondContact O-N 3.36Å
27	H	70.7	Confident	66.3	Low	168 Å²	168	149.6 Å²	149.6	78%	0.778	78%	0.777	S	S	*	*			trans	-72.8	121.4	169.8	-67	88.3	0	0	0	108.5	K29	H27-K29 PolarHBondContact O-N 3.43Å
28	V	66.7	Low	64.8	Low	136 Å²	136	148.2 Å²	148.2	82%	0.824	77%	0.772	S	S	*	*			trans	-74.2	107.1	177	-180	0	0	0	0	108	K26	K26-V28 PolarHBondContact O-N 3.36Å
29	K	54.8	Low	63.5	Low	192 Å²	192	145.5 Å²	145.5	84%	0.835	76%	0.762	S	S	*	*			trans	-78.9	128.7	155.4	-70.3	-173.1	178.8	-177.5	0	106.4	H27 D31	H27-K29 PolarHBondContact O-N 3.43Å; K29-D31 PolarHBondContact O-N 3.48Å
30	H	49.1	Very low	62.2	Low	174 Å²	174	150.2 Å²	150.2	81%	0.806	77%	0.769	S	S	*	*	S	Bend	trans	-69.1	76.6	-173.5	-171.3	-73.1	0	0	0	110.2
31	D	46.3	Very low	60.9	Low	153 Å²	153	152.2 Å²	152.2	82%	0.818	76%	0.762	S	S	*	*			trans	-173.6	140.8	160.6	-88.4	-37.5	0	0	0	110.1	K29	K29-D31 PolarHBondContact O-N 3.48Å
32	A	46.1	Very low	60	Low	82 Å²	82	145.5 Å²	145.5	68%	0.678	74%	0.739	S	S	*	*	S	Bend	trans	84.9	103.1	177.8	0	0	0	0	0	117.3	V34	A32-V34 PolarHBondContact O-N 3.45Å; A32-V34 VanDerWaalsContact O-N 3.16Å
33	T	45.5	Very low	59.2	Low	134 Å²	134	141.6 Å²	141.6	82%	0.822	73%	0.727	S	S	*	*			trans	-13.6	101.1	151.6	50.7	0	0	0	0	114.8
34	V	52.6	Low	58.4	Low	108 Å²	108	135.7 Å²	135.7	66%	0.655	71%	0.709	S	S	*	*			trans	-95	96.8	164.9	-175.9	0	0	0	0	106.8	A32 V36	A32-V34 PolarHBondContact O-N 3.45Å; A32-V34 VanDerWaalsContact O-N 3.16Å; V34-V36 HydrophobicContact CB-CG2 4.45Å; V34-V36 HydrophobicContact CG1-CG2 3.63Å; V34-V36 PolarHBondContact O-N 2.93Å
35	E	52.2	Low	57.8	Low	167 Å²	167	135.3 Å²	135.3	78%	0.78	70%	0.704	S	S	*	*			trans	-63.3	86.6	163.2	-65.1	-87.3	137.6	0	0	107.3	R37	E35-R37 VanDerWaalsContact C-N 3.29Å; E35-R37 PolarHBondContact O-N 3.47Å
36	V	52.4	Low	57.9	Low	106 Å²	106	137.8 Å²	137.8	64%	0.642	71%	0.713	S	S	*	*			trans	-75.7	90.7	167.9	-175.9	0	0	0	0	106	V34 C38	V34-V36 HydrophobicContact CB-CG2 4.45Å; V34-V36 HydrophobicContact CG1-CG2 3.63Å; V34-V36 PolarHBondContact O-N 2.93Å; V36-C38 VanDerWaalsContact C-N 3.25Å; V36-C38 PolarHBondContact O-N 3.26Å
37	R	52.5	Low	57.9	Low	199 Å²	199	132.8 Å²	132.8	75%	0.751	69%	0.694	S	S	*	*			trans	-66.6	95.8	158.3	-74.2	-173.5	169.9	-169.7	-3.9	106.9	E35 E39	E35-R37 VanDerWaalsContact C-N 3.29Å; E35-R37 PolarHBondContact O-N 3.47Å; R37-E39 PolarHBondContact O-N 3.4Å
38	C	45.8	Very low	58.7	Low	105 Å²	105	128.4 Å²	128.4	71%	0.709	68%	0.68	S	S	*	*			trans	-69.4	85.4	154.5	-63.4	0	0	0	0	105.3	V36 E40	V36-C38 VanDerWaalsContact C-N 3.25Å; V36-C38 PolarHBondContact O-N 3.26Å; C38-E40 PolarHBondContact O-N 3.04Å
39	E	55.2	Low	59.7	Low	129 Å²	129	129.4 Å²	129.4	60%	0.603	67%	0.673	S	S	*	*			trans	-57.5	114	155.3	-56	-66.4	154.1	0	0	103.7	R37 D41	R37-E39 PolarHBondContact O-N 3.4Å; E39-D41 PolarHBondContact O-N 3.09Å
40	E	53.2	Low	61.4	Low	188 Å²	188	127 Å²	127	88%	0.879	67%	0.665	S	S	*	*			trans	-65.8	79.6	169.5	-73.1	-176	126.3	0	0	106.1	C38 S42	C38-E40 PolarHBondContact O-N 3.04Å; E40-S42 PolarHBondContact O-N 2.93Å
41	D	53.2	Low	63.3	Low	120 Å²	120	123.1 Å²	123.1	64%	0.642	65%	0.647	S	S	*	*			trans	-55.7	98.3	163.6	-80.9	-31	0	0	0	104.6	E39 P43	E39-D41 PolarHBondContact O-N 3.09Å; D41-P43 VanDerWaalsContact O-N 3.1Å
42	S	60.1	Low	65.3	Low	53 Å²	53	118.3 Å²	118.3	37%	0.371	62%	0.621	S	S	.	*			trans	-52.1	124.7	176.1	173.6	0	0	0	0	105.5	E40 H44 E45	E40-S42 PolarHBondContact O-N 2.93Å; S42-H44 PolarHBondContact O-N 3.11Å; S42-E45 WeakPolarHBondContact O-CB 2.84Å; S42-E45 PolarHBondContact O-N 2.9Å
43	P	64.2	Low	67.5	Low	99 Å²	99	118.4 Å²	118.4	64%	0.643	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.1	-11.1	-176.3	22.2	-32.2	0	0	0	112.4	D41 L47	D41-P43 VanDerWaalsContact O-N 3.1Å; P43-L47 WeakPolarHBondContact O-CD1 3.38Å; P43-L47 WeakPolarHBondContact O-CG 3.34Å
44	H	66.3	Low	69.7	Low	101 Å²	101	119 Å²	119	47%	0.468	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81	-20.5	174.4	-57.4	-66.7	0	0	0	114.8	S42 L46 L47 L52	S42-H44 PolarHBondContact O-N 3.11Å; H44-L46 VanDerWaalsContact C-N 3.29Å; H44-L46 PolarHBondContact O-N 3.07Å; H44-L47 PolarHBondContact O-N 3.42Å; H44-L52 HydrophobicContact CB-CD2 4.13Å; H44-L52 WeakPolarHBondContact ND1-CD2 3.34Å
45	E	68	Low	71.5	Confident	149 Å²	149	118.9 Å²	118.9	70%	0.696	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.1	-22.2	-173	-158	164.4	-159.8	0	0	112.9	S42	S42-E45 WeakPolarHBondContact O-CB 2.84Å; S42-E45 PolarHBondContact O-N 2.9Å
46	L	79.2	Confident	73.3	Confident	154 Å²	154	115.5 Å²	115.5	81%	0.806	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94	-2.1	173.9	-62.3	177.3	0	0	0	113.6	H44	H44-L46 VanDerWaalsContact C-N 3.29Å; H44-L46 PolarHBondContact O-N 3.07Å
47	L	82.6	Confident	75.1	Confident	71 Å²	71	117 Å²	117	37%	0.372	57%	0.569	S	S	.	*	S	Bend	trans	-100.9	135.9	-175.7	-64.8	176.5	0	0	0	110.7	P43 H44 E51 L52	P43-L47 WeakPolarHBondContact O-CD1 3.38Å; P43-L47 WeakPolarHBondContact O-CG 3.34Å; H44-L47 PolarHBondContact O-N 3.42Å; L47-E51 HydrophobicContact CB-CB 4.25Å; L47-E51 HydrophobicContact CD2-CB 4.18Å; L47-L52 HydrophobicContact CB-CD2 4.01Å; L47-L52 HydrophobicContact CB-CG 4.08Å; L47-L52 HydrophobicContact CD1-CD2 3.78Å
48	T	86.6	Confident	76.9	Confident	77 Å²	77	109.9 Å²	109.9	47%	0.472	55%	0.549	S	S	.	.			trans	-64.8	154.4	167.9	62.3	0	0	0	0	110.2	E50 E51 L52	T48-E50 PolarHBondContact O-N 3.1Å; T48-E51 WeakPolarHBondContact CB-OE2 3.38Å; T48-E51 PolarHBondContact N-OE2 3.2Å; T48-E51 PolarHBondContact O-N 3.48Å; T48-E51 VanDerWaalsContact OG1-CG 3.28Å; T48-E51 WeakPolarHBondContact OG1-CG 3.31Å; T48-E51 PolarHBondContact OG1-N 3.05Å; T48-E51 PolarHBondContact OG1-OE2 2.95Å; T48-L52 PolarHBondContact O-N 3.36Å
49	K	88.4	Confident	79	Confident	156 Å²	156	108.4 Å²	108.4	68%	0.678	53%	0.533	S	S	*	.	H	α-helix	trans	-52.9	-37.5	173.3	178.1	177.7	168.2	-178.8	0	112	L52 E53	K49-L52 PolarHBondContact O-N 2.9Å; K49-E53 WeakPolarHBondContact CE-OE1 3.49Å; K49-E53 IonicContact NZ-OE1 3.81Å; K49-E53 WeakPolarHBondContact O-CG 3.36Å; K49-E53 PolarHBondContact O-N 3.44Å
50	E	89.7	Confident	80.7	Confident	143 Å²	143	108.9 Å²	108.9	67%	0.668	53%	0.533	S	S	*	.	H	α-helix	trans	-63.5	-42.1	177.7	-176.9	177.5	-176.7	0	0	112.5	T48 L52 E53 Y54	T48-E50 PolarHBondContact O-N 3.1Å; E50-L52 VanDerWaalsContact C-N 3.34Å; E50-E53 PolarHBondContact O-N 2.87Å; E50-Y54 WeakPolarHBondContact O-CB 3.3Å; E50-Y54 PolarHBondContact O-N 3.01Å
51	E	89	Confident	82.5	Confident	92 Å²	92	102.7 Å²	102.7	43%	0.43	51%	0.514	S	S	.	.	H	α-helix	trans	-65.4	-38.5	177.6	-74	166.7	123.8	0	0	112	L47 T48 Y54 H55	L47-E51 HydrophobicContact CB-CB 4.25Å; L47-E51 HydrophobicContact CD2-CB 4.18Å; T48-E51 WeakPolarHBondContact CB-OE2 3.38Å; T48-E51 PolarHBondContact N-OE2 3.2Å; T48-E51 PolarHBondContact O-N 3.48Å; T48-E51 VanDerWaalsContact OG1-CG 3.28Å; T48-E51 WeakPolarHBondContact OG1-CG 3.31Å; T48-E51 PolarHBondContact OG1-N 3.05Å; T48-E51 PolarHBondContact OG1-OE2 2.95Å; E51-Y54 PolarHBondContact O-N 3.4Å; E51-H55 PolarHBondContact O-N 3.06Å
52	L	88.5	Confident	84.2	Confident	51 Å²	51	104.1 Å²	104.1	27%	0.267	51%	0.512	S	S	.	.	H	α-helix	trans	-64	-48.5	175	-65.1	174.3	0	0	0	111.4	H44 L47 T48 K49 E50 Y54 H55 D56	H44-L52 HydrophobicContact CB-CD2 4.13Å; H44-L52 WeakPolarHBondContact ND1-CD2 3.34Å; L47-L52 HydrophobicContact CB-CD2 4.01Å; L47-L52 HydrophobicContact CB-CG 4.08Å; L47-L52 HydrophobicContact CD1-CD2 3.78Å; T48-L52 PolarHBondContact O-N 3.36Å; K49-L52 PolarHBondContact O-N 2.9Å; E50-L52 VanDerWaalsContact C-N 3.34Å; L52-Y54 VanDerWaalsContact C-N 3.31Å; L52-Y54 PolarHBondContact O-N 3.4Å; L52-H55 WeakPolarHBondContact O-CB 3.46Å; L52-H55 PolarHBondContact O-N 3.18Å; L52-D56 PolarHBondContact O-N 3.36Å
53	E	91.8	Very high	85.6	Confident	84 Å²	84	108 Å²	108	39%	0.393	52%	0.524	S	S	.	.	H	α-helix	trans	-63.4	-37.5	177.1	-72.2	177.5	-178.2	0	0	112.1	K49 E50 D56 R57	K49-E53 WeakPolarHBondContact CE-OE1 3.49Å; K49-E53 IonicContact NZ-OE1 3.81Å; K49-E53 WeakPolarHBondContact O-CG 3.36Å; K49-E53 PolarHBondContact O-N 3.44Å; E50-E53 PolarHBondContact O-N 2.87Å; E53-D56 PolarHBondContact O-N 3.41Å; E53-R57 WeakPolarHBondContact O-CG 3.42Å; E53-R57 PolarHBondContact O-N 3.19Å
54	Y	91.7	Very high	86.8	Confident	148 Å²	148	109.6 Å²	109.6	58%	0.58	53%	0.527	S	S	*	.	H	α-helix	trans	-63.4	-43.3	174.4	-179.9	-97.2	0	0	0	111.7	E50 E51 L52 D56 R57 C58	E50-Y54 WeakPolarHBondContact O-CB 3.3Å; E50-Y54 PolarHBondContact O-N 3.01Å; E51-Y54 PolarHBondContact O-N 3.4Å; L52-Y54 VanDerWaalsContact C-N 3.31Å; L52-Y54 PolarHBondContact O-N 3.4Å; Y54-D56 PolarHBondContact O-N 3.39Å; Y54-R57 PolarHBondContact O-N 2.95Å; Y54-C58 WeakPolarHBondContact CE1-SG 3.4Å; Y54-C58 WeakPolarHBondContact O-CB 3.39Å; Y54-C58 PolarHBondContact O-N 3.17Å; Y54-C58 PolarHBondContact O-SG 3.29Å; Y54-C58 VanDerWaalsContact O-SG 3.36Å
55	H	91.1	Very high	87.8	Confident	105 Å²	105	111 Å²	111	49%	0.486	53%	0.531	S	S	.	.	H	α-helix	trans	-56.2	-51	174.3	178.8	75.6	0	0	0	111.1	E51 L52 R57 C58 I59	E51-H55 PolarHBondContact O-N 3.06Å; L52-H55 WeakPolarHBondContact O-CB 3.46Å; L52-H55 PolarHBondContact O-N 3.18Å; H55-R57 VanDerWaalsContact C-N 3.32Å; H55-R57 PolarHBondContact O-N 3.19Å; H55-C58 WeakPolarHBondContact O-CB 3.32Å; H55-C58 PolarHBondContact O-N 2.89Å; H55-C58 VanDerWaalsContact O-N 3.1Å; H55-I59 WeakPolarHBondContact O-CG1 2.97Å; H55-I59 PolarHBondContact O-N 3.39Å
56	D	90	Very high	88.8	Confident	95 Å²	95	109.3 Å²	109.3	51%	0.508	53%	0.534	S	S	.	.	H	α-helix	trans	-60.1	-41.8	180	-73.7	-8	0	0	0	112.2	L52 E53 Y54 I59 K60	L52-D56 PolarHBondContact O-N 3.36Å; E53-D56 PolarHBondContact O-N 3.41Å; Y54-D56 PolarHBondContact O-N 3.39Å; D56-I59 PolarHBondContact O-N 3.28Å; D56-K60 WeakPolarHBondContact O-CG 3.05Å; D56-K60 PolarHBondContact O-N 3.33Å
57	R	90.2	Very high	89.1	Confident	137 Å²	137	110.2 Å²	110.2	52%	0.517	54%	0.536	S	S	.	.	H	α-helix	trans	-62.2	-43.8	174.2	-73.8	-170.4	-59.8	-123.6	1.8	111.9	E53 Y54 H55 K60 A61	E53-R57 WeakPolarHBondContact O-CG 3.42Å; E53-R57 PolarHBondContact O-N 3.19Å; Y54-R57 PolarHBondContact O-N 2.95Å; H55-R57 VanDerWaalsContact C-N 3.32Å; H55-R57 PolarHBondContact O-N 3.19Å; R57-K60 PolarHBondContact O-N 3.18Å; R57-A61 VanDerWaalsContact O-CB 3.31Å; R57-A61 WeakPolarHBondContact O-CB 3.33Å; R57-A61 PolarHBondContact O-N 3.18Å
58	C	90.8	Very high	89.2	Confident	51 Å²	51	112 Å²	112	35%	0.345	55%	0.552	S	S	.	*	H	α-helix	trans	-65.3	-39.6	178.7	-75.4	0	0	0	0	112.6	Y54 H55 A61 Y62	Y54-C58 WeakPolarHBondContact CE1-SG 3.4Å; Y54-C58 WeakPolarHBondContact O-CB 3.39Å; Y54-C58 PolarHBondContact O-N 3.17Å; Y54-C58 PolarHBondContact O-SG 3.29Å; Y54-C58 VanDerWaalsContact O-SG 3.36Å; H55-C58 WeakPolarHBondContact O-CB 3.32Å; H55-C58 PolarHBondContact O-N 2.89Å; H55-C58 VanDerWaalsContact O-N 3.1Å; C58-A61 PolarHBondContact O-N 3.49Å; C58-Y62 WeakPolarHBondContact O-CB 3.28Å; C58-Y62 PolarHBondContact O-N 2.76Å
59	I	89.5	Confident	89.1	Confident	73 Å²	73	114.4 Å²	114.4	37%	0.374	57%	0.567	S	S	.	*	H	α-helix	trans	-66	-47.7	177	-66.3	-61.4	0	0	0	110.4	H55 D56 A61 Y62 H63	H55-I59 WeakPolarHBondContact O-CG1 2.97Å; H55-I59 PolarHBondContact O-N 3.39Å; D56-I59 PolarHBondContact O-N 3.28Å; I59-A61 VanDerWaalsContact C-N 3.35Å; I59-A61 PolarHBondContact O-N 2.8Å; I59-Y62 WeakPolarHBondContact O-CB 3.39Å; I59-Y62 PolarHBondContact O-N 2.77Å; I59-Y62 VanDerWaalsContact O-N 3.07Å; I59-H63 PolarHBondContact O-CD2 3.11Å; I59-H63 PolarHBondContact O-N 3.07Å; I59-H63 VanDerWaalsContact O-N 3.11Å
60	K	91.2	Very high	88.9	Confident	139 Å²	139	112.2 Å²	112.2	60%	0.604	57%	0.566	S	S	*	*	H	α-helix	trans	-55	-50.6	173.4	-73.1	169	-177.8	-79.7	0	111.3	D56 R57 Y62 H63 D64	D56-K60 WeakPolarHBondContact O-CG 3.05Å; D56-K60 PolarHBondContact O-N 3.33Å; R57-K60 PolarHBondContact O-N 3.18Å; K60-Y62 PolarHBondContact O-N 2.84Å; K60-H63 PolarHBondContact O-N 2.8Å; K60-H63 VanDerWaalsContact O-N 3.08Å; K60-D64 PolarHBondContact O-N 3.15Å
61	A	90.4	Very high	88.5	Confident	58 Å²	58	111.3 Å²	111.3	48%	0.479	57%	0.57	S	S	.	*	H	α-helix	trans	-62.7	-26.6	178.1	0	0	0	0	0	113.7	R57 C58 I59 K65	R57-A61 VanDerWaalsContact O-CB 3.31Å; R57-A61 WeakPolarHBondContact O-CB 3.33Å; R57-A61 PolarHBondContact O-N 3.18Å; C58-A61 PolarHBondContact O-N 3.49Å; I59-A61 VanDerWaalsContact C-N 3.35Å; I59-A61 PolarHBondContact O-N 2.8Å; A61-K65 VanDerWaalsContact O-CG 3.3Å; A61-K65 WeakPolarHBondContact O-CG 3.37Å
62	Y	89.5	Confident	88.3	Confident	151 Å²	151	114.8 Å²	114.8	59%	0.592	58%	0.584	S	S	*	*	H	α-helix	trans	-70.6	-41.4	174	-177.6	-88.7	0	0	0	111.8	C58 I59 K60 K65	C58-Y62 WeakPolarHBondContact O-CB 3.28Å; C58-Y62 PolarHBondContact O-N 2.76Å; I59-Y62 WeakPolarHBondContact O-CB 3.39Å; I59-Y62 PolarHBondContact O-N 2.77Å; I59-Y62 VanDerWaalsContact O-N 3.07Å; K60-Y62 PolarHBondContact O-N 2.84Å; Y62-K65 HydrophobicContact CD2-CD 4.34Å; Y62-K65 WeakPolarHBondContact O-CG 3.47Å; Y62-K65 PolarHBondContact O-N 3.34Å
63	H	89	Confident	87.9	Confident	135 Å²	135	118.3 Å²	118.3	63%	0.625	61%	0.61	S	S	*	*	H	α-helix	trans	-72	-30.3	178.3	-69.7	-61.7	0	0	0	113.1	I59 K60 K65	I59-H63 PolarHBondContact O-CD2 3.11Å; I59-H63 PolarHBondContact O-N 3.07Å; I59-H63 VanDerWaalsContact O-N 3.11Å; K60-H63 PolarHBondContact O-N 2.8Å; K60-H63 VanDerWaalsContact O-N 3.08Å; H63-K65 PolarHBondContact O-N 2.75Å
64	D	90.1	Very high	87.3	Confident	132 Å²	132	122.1 Å²	122.1	71%	0.706	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	1.5	178.2	-62.6	-30.1	0	0	0	113.3	K60	K60-D64 PolarHBondContact O-N 3.15Å
65	K	87.3	Confident	86.7	Confident	129 Å²	129	119.5 Å²	119.5	56%	0.561	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-64.1	130	179.6	-70.3	178.7	-178.3	170.5	0	110	A61 Y62 H63 M67	A61-K65 VanDerWaalsContact O-CG 3.3Å; A61-K65 WeakPolarHBondContact O-CG 3.37Å; Y62-K65 HydrophobicContact CD2-CD 4.34Å; Y62-K65 WeakPolarHBondContact O-CG 3.47Å; Y62-K65 PolarHBondContact O-N 3.34Å; H63-K65 PolarHBondContact O-N 2.75Å; K65-M67 PolarHBondContact O-N 3.08Å
66	P	89	Confident	86	Confident	115 Å²	115	117 Å²	117	75%	0.747	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-61.1	143.5	173.8	27.4	-34.1	0	0	0	109.5
67	M	84.3	Confident	85.2	Confident	172 Å²	172	117.8 Å²	117.8	85%	0.847	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-57.1	126.5	174.9	-172.2	156.6	62.4	0	0	109.2	K65 T69	K65-M67 PolarHBondContact O-N 3.08Å; M67-T69 PolarHBondContact O-N 3.3Å
68	P	85.1	Confident	84.3	Confident	109 Å²	109	116.7 Å²	116.7	71%	0.708	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-62.7	128.3	-176.3	23.8	-32.9	0	0	0	110.1	V70	P68-V70 PolarHBondContact O-N 3.18Å
69	T	85.6	Confident	83.2	Confident	128 Å²	128	122.1 Å²	122.1	79%	0.785	64%	0.644	S	S	*	*			trans	-83.8	106.3	174.1	-56.4	0	0	0	0	109	M67 T71	M67-T69 PolarHBondContact O-N 3.3Å; T69-T71 HydrophobicContact CG2-CG2 4.32Å; T69-T71 PolarHBondContact O-N 2.61Å
70	V	83.1	Confident	82	Confident	110 Å²	110	126.4 Å²	126.4	67%	0.667	66%	0.656	S	S	*	*			trans	-86.3	101.6	175.7	177.6	0	0	0	0	108.8	P68 K72	P68-V70 PolarHBondContact O-N 3.18Å; V70-K72 WeakPolarHBondContact CG1-O 3.45Å
71	T	82.5	Confident	81.1	Confident	123 Å²	123	127 Å²	127	76%	0.755	66%	0.664	S	S	*	*			trans	-79.7	-18.6	-179.8	55.1	0	0	0	0	113.7	T69	T69-T71 HydrophobicContact CG2-CG2 4.32Å; T69-T71 PolarHBondContact O-N 2.61Å
72	K	83.8	Confident	80.3	Confident	166 Å²	166	131.1 Å²	131.1	72%	0.722	68%	0.677	S	S	*	*	S	Bend	trans	-120.6	131.9	-179.8	-63.9	-178.3	-177.7	178.8	0	109.6	V70 H74	V70-K72 WeakPolarHBondContact CG1-O 3.45Å; K72-H74 PolarHBondContact O-N 3.12Å
73	P	79.9	Confident	79.7	Confident	125 Å²	125	132.1 Å²	132.1	81%	0.812	69%	0.686	S	S	*	*			trans	-56	134.8	175.8	23.2	-31.8	0	0	0	110.1	N75	P73-N75 PolarHBondContact O-N 3.02Å
74	H	79.8	Confident	79.4	Confident	164 Å²	164	133.3 Å²	133.3	76%	0.759	69%	0.693	S	S	*	*			trans	-59.5	119.6	173.9	178.6	72.7	0	0	0	108.9	K72 D76	K72-H74 PolarHBondContact O-N 3.12Å; H74-D76 PolarHBondContact O-N 2.99Å
75	N	78.5	Confident	78.9	Confident	92 Å²	92	132.9 Å²	132.9	49%	0.492	70%	0.697	S	S	.	*			trans	-78.8	101.5	173.1	-164.4	-25.9	0	0	0	107.8	P73 N77 R80	P73-N75 PolarHBondContact O-N 3.02Å; N75-N77 PolarHBondContact O-N 3.15Å; N75-N77 VanDerWaalsContact O-N 3.07Å; N75-R80 PolarHBondContact ND2-NH2 3.07Å
76	D	75.8	Confident	78.5	Confident	54 Å²	54	134.6 Å²	134.6	29%	0.289	71%	0.711	S	S	.	*			trans	-68	102.5	173.9	-177.2	-3.7	0	0	0	109.5	H74 T78 K79	H74-D76 PolarHBondContact O-N 2.99Å; D76-T78 PolarHBondContact O-N 3.02Å; D76-T78 VanDerWaalsContact O-N 3.12Å; D76-T78 WeakPolarHBondContact OD1-CB 3.45Å; D76-T78 WeakPolarHBondContact OD1-CG2 3.41Å; D76-T78 PolarHBondContact OD1-N 2.97Å; D76-T78 PolarHBondContact OD1-OG1 3.12Å; D76-T78 PolarHBondContact OD2-OG1 3Å; D76-K79 HydrophobicContact CB-CD 4.18Å; D76-K79 HydrophobicContact CB-CG 4.19Å; D76-K79 WeakPolarHBondContact O-CB 3.32Å; D76-K79 PolarHBondContact O-N 3.05Å; D76-K79 VanDerWaalsContact O-N 3.08Å
77	N	74.6	Confident	77.8	Confident	111 Å²	111	142.4 Å²	142.4	59%	0.594	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-61.7	-19.1	-179.4	-70	-49.7	0	0	0	112.8	N75 K79 R80	N75-N77 PolarHBondContact O-N 3.15Å; N75-N77 VanDerWaalsContact O-N 3.07Å; N77-K79 PolarHBondContact O-N 2.87Å; N77-R80 WeakPolarHBondContact O-CB 3.48Å; N77-R80 PolarHBondContact O-N 3.49Å; N77-R80 VanDerWaalsContact O-N 3.15Å
78	T	71.4	Confident	77.5	Confident	114 Å²	114	141 Å²	141	70%	0.699	73%	0.728	S	S	*	*	G	3₁₀ helix	trans	-68.6	-19.8	176.8	71	0	0	0	0	112.5	D76 R80	D76-T78 PolarHBondContact O-N 3.02Å; D76-T78 VanDerWaalsContact O-N 3.12Å; D76-T78 WeakPolarHBondContact OD1-CB 3.45Å; D76-T78 WeakPolarHBondContact OD1-CG2 3.41Å; D76-T78 PolarHBondContact OD1-N 2.97Å; D76-T78 PolarHBondContact OD1-OG1 3.12Å; D76-T78 PolarHBondContact OD2-OG1 3Å; T78-R80 VanDerWaalsContact C-N 3.27Å; T78-R80 PolarHBondContact O-N 3.46Å
79	K	66.1	Low	77.1	Confident	164 Å²	164	142.6 Å²	142.6	71%	0.713	73%	0.729	S	S	*	*	G	3₁₀ helix	trans	-77.1	-12.5	174.8	-61.6	-176.5	-177.8	179.7	0	113.2	D76 N77 I81	D76-K79 HydrophobicContact CB-CD 4.18Å; D76-K79 HydrophobicContact CB-CG 4.19Å; D76-K79 WeakPolarHBondContact O-CB 3.32Å; D76-K79 PolarHBondContact O-N 3.05Å; D76-K79 VanDerWaalsContact O-N 3.08Å; N77-K79 PolarHBondContact O-N 2.87Å; K79-I81 PolarHBondContact O-N 3.28Å
80	R	65.4	Low	76.7	Confident	164 Å²	164	143.4 Å²	143.4	62%	0.619	73%	0.726	S	S	*	*			trans	-81.9	70.5	174.1	-63.3	-177.1	175.8	-152.4	-0.6	109.2	N75 N77 T78 I82	N75-R80 PolarHBondContact ND2-NH2 3.07Å; N77-R80 WeakPolarHBondContact O-CB 3.48Å; N77-R80 PolarHBondContact O-N 3.49Å; N77-R80 VanDerWaalsContact O-N 3.15Å; T78-R80 VanDerWaalsContact C-N 3.27Å; T78-R80 PolarHBondContact O-N 3.46Å; R80-I82 PolarHBondContact O-N 3.16Å
81	I	71.2	Confident	76.3	Confident	150 Å²	150	145.4 Å²	145.4	77%	0.769	73%	0.729	S	S	*	*			trans	-67.4	101.7	164.1	-59.5	175.7	0	0	0	106.1	K79 Q83	K79-I81 PolarHBondContact O-N 3.28Å; I81-Q83 PolarHBondContact O-N 2.83Å; I81-Q83 VanDerWaalsContact O-N 3.12Å
82	I	74.5	Confident	75.9	Confident	146 Å²	146	146.8 Å²	146.8	75%	0.749	73%	0.728	S	S	*	*			trans	-73.2	101.9	171.1	-58.9	173.3	0	0	0	106.2	R80 Q84	R80-I82 PolarHBondContact O-N 3.16Å; I82-Q84 PolarHBondContact O-N 3.19Å
83	Q	77.3	Confident	75.4	Confident	171 Å²	171	145.5 Å²	145.5	80%	0.799	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-71.4	116.5	174	-164.6	152.4	31.8	0	0	108.7	I81	I81-Q83 PolarHBondContact O-N 2.83Å; I81-Q83 VanDerWaalsContact O-N 3.12Å
84	Q	81.6	Confident	75	Confident	161 Å²	161	147 Å²	147	75%	0.752	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-73.1	142	172	-61.1	-132.3	-41.6	0	0	109.3	I82 L86	I82-Q84 PolarHBondContact O-N 3.19Å; Q84-L86 PolarHBondContact O-N 3.44Å
85	P	80.1	Confident	74.7	Confident	122 Å²	122	145.7 Å²	145.7	79%	0.792	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-62.6	136.8	173.6	24.4	-30.7	0	0	0	110.1
86	L	78.3	Confident	74.4	Confident	165 Å²	165	150.2 Å²	150.2	86%	0.864	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-68.7	135.9	168.6	-73.7	98.8	0	0	0	109	Q84	Q84-L86 PolarHBondContact O-N 3.44Å
87	K	76	Confident	74.2	Confident	280 Å²	280	158.9 Å²	158.9	100%	1.217	78%	0.779	S	S	*	*			trans	-74	0	172	-74.7	-178.6	178	175.7	0	111.3

Retrieved 87 of 87 residues in 126.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).