A0A3Q0KEJ7_SCHMA Loading...

Leydig cell tumor 10 kDa protein homolog

AlphaFold DB , UniProt , Accession A0A3Q0KEJ7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 86 aa.

						>A0A3Q0KEJ7_SCHMA|A0A3Q0KEJ7
MAQGKLKVKTKLPKGVKSGKSERSLQKQSIKPMRKGTRVIKPKKERLKEAHEMKKHMEKLLKKSVEKQAIEKVSSCEPRSLKIVKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.9	Very low	65.5	Low	231 Å²	231	161.9 Å²	161.9	100%	1.138	84%	0.842	S	S	*	*				0	113.6	0	-62.5	-161	-70.4	0	0	108.7
2	A	64.1	Low	65.5	Low	108 Å²	108	158.7 Å²	158.7	89%	0.893	83%	0.825	S	S	*	*			trans	-109.1	78.6	174.8	0	0	0	0	0	109.2	G4	A2-G4 PolarHBondContact O-N 3.17Å
3	Q	66.2	Low	66.1	Low	196 Å²	196	153.3 Å²	153.3	92%	0.916	81%	0.806	S	S	*	*			trans	-89.1	83	-178	-158.2	175.2	16.8	0	0	109.3
4	G	71.8	Confident	66.4	Low	60 Å²	60	158.3 Å²	158.3	62%	0.619	82%	0.818	S	S	*	*	S	Bend	trans	-166.2	113.5	172.5	0	0	0	0	0	109.7	A2 L6	A2-G4 PolarHBondContact O-N 3.17Å; G4-L6 PolarHBondContact O-N 3.4Å
5	K	69.3	Low	66.8	Low	217 Å²	217	152.8 Å²	152.8	94%	0.943	82%	0.816	S	S	*	*			trans	-57.5	102.4	174.9	-67.8	179	179.4	178.7	0	108.3	K7	K5-K7 PolarHBondContact O-N 2.86Å
6	L	65.2	Low	66.9	Low	156 Å²	156	148.4 Å²	148.4	82%	0.817	80%	0.796	S	S	*	*			trans	-61.9	108.7	174.6	-122.1	155	0	0	0	107.3	G4 V8	G4-L6 PolarHBondContact O-N 3.4Å; L6-V8 PolarHBondContact O-N 3.32Å
7	K	68.6	Low	67	Low	201 Å²	201	151.1 Å²	151.1	87%	0.874	80%	0.799	S	S	*	*			trans	-69.7	86	175	-163.9	176.9	-173.1	177.9	0	107.5	K5 K9	K5-K7 PolarHBondContact O-N 2.86Å; K7-K9 PolarHBondContact O-N 3.21Å
8	V	69.1	Low	67.1	Low	106 Å²	106	148.3 Å²	148.3	64%	0.642	79%	0.793	S	S	*	*			trans	-59.5	114.6	179.8	-179.8	0	0	0	0	107.8	L6 T10	L6-V8 PolarHBondContact O-N 3.32Å; V8-T10 HydrophobicContact CG1-CG2 4.29Å; V8-T10 PolarHBondContact O-N 3.32Å
9	K	65.3	Low	67.2	Low	192 Å²	192	144.1 Å²	144.1	84%	0.835	79%	0.788	S	S	*	*			trans	-66.9	89.9	165.6	-71.1	-179	179.3	177.1	0	106.4	K7 K11	K7-K9 PolarHBondContact O-N 3.21Å; K9-K11 VanDerWaalsContact C-N 3.27Å; K9-K11 PolarHBondContact O-N 3.07Å
10	T	66.9	Low	67.4	Low	121 Å²	121	143.1 Å²	143.1	74%	0.742	78%	0.776	S	S	*	*			trans	-63.5	93.4	169.9	42.6	0	0	0	0	107.5	V8 L12	V8-T10 HydrophobicContact CG1-CG2 4.29Å; V8-T10 PolarHBondContact O-N 3.32Å; T10-L12 PolarHBondContact O-N 3.26Å
11	K	67.9	Low	67.9	Low	193 Å²	193	139.8 Å²	139.8	84%	0.839	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-64.1	119.6	167.2	-68.3	-177.7	-179.4	177.6	0	106.1	K9	K9-K11 VanDerWaalsContact C-N 3.27Å; K9-K11 PolarHBondContact O-N 3.07Å
12	L	65.3	Low	69.4	Low	123 Å²	123	137 Å²	137	64%	0.644	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-57	141.2	172.9	-73.1	169.8	0	0	0	109.2	T10	T10-L12 PolarHBondContact O-N 3.26Å
13	P	74.1	Confident	70.1	Confident	89 Å²	89	140.4 Å²	140.4	58%	0.578	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-60.6	146.5	-173.3	16.4	-23.8	0	0	0	111.8	G15 V16	P13-G15 PolarHBondContact O-N 3.2Å; P13-V16 HydrophobicContact CG-CG2 3.74Å; P13-V16 PolarHBondContact O-N 3.42Å; P13-V16 VanDerWaalsContact O-N 3.08Å
14	K	70.6	Confident	70.7	Confident	223 Å²	223	133.1 Å²	133.1	97%	0.97	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	113.2	179.8	-65.9	-178.4	-178.9	179	0	108.8
15	G	71.2	Confident	70.9	Confident	76 Å²	76	134.6 Å²	134.6	78%	0.784	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	120.1	-17.5	-178.8	0	0	0	0	0	114.6	P13 K17	P13-G15 PolarHBondContact O-N 3.2Å; G15-K17 PolarHBondContact O-N 3.11Å
16	V	69.5	Low	71.3	Confident	82 Å²	82	130 Å²	130	50%	0.497	68%	0.683	S	S	.	*			trans	-74.6	97.5	170.9	-178.1	0	0	0	0	108.2	P13 S18	P13-V16 HydrophobicContact CG-CG2 3.74Å; P13-V16 PolarHBondContact O-N 3.42Å; P13-V16 VanDerWaalsContact O-N 3.08Å; V16-S18 PolarHBondContact O-N 3.21Å
17	K	67.6	Low	71.9	Confident	195 Å²	195	129.2 Å²	129.2	85%	0.848	67%	0.673	S	S	*	*			trans	-58.1	112.8	164.8	-67.2	178.9	-178.6	174.7	0	105.7	G15 G19	G15-K17 PolarHBondContact O-N 3.11Å; K17-G19 PolarHBondContact O-N 3.1Å
18	S	68.9	Low	72.1	Confident	100 Å²	100	124.1 Å²	124.1	70%	0.699	65%	0.653	S	S	*	*			trans	-54	110.6	167.1	46	0	0	0	0	106.3	V16 K20	V16-S18 PolarHBondContact O-N 3.21Å; S18-K20 PolarHBondContact O-N 3.12Å; S18-K20 VanDerWaalsContact O-N 3.16Å
19	G	69.4	Low	72.2	Confident	68 Å²	68	123.5 Å²	123.5	70%	0.701	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-52.6	128.4	176.2	0	0	0	0	0	106.9	K17 S21	K17-G19 PolarHBondContact O-N 3.1Å; G19-S21 PolarHBondContact O-N 2.96Å; G19-S21 VanDerWaalsContact O-N 3.12Å
20	K	71.6	Confident	72.6	Confident	125 Å²	125	120.2 Å²	120.2	54%	0.543	64%	0.643	S	S	.	*	P	Polyproline II helix	trans	-52	127	172.1	-69	177.3	178.7	175.8	0	106.5	S18 L25	S18-K20 PolarHBondContact O-N 3.12Å; S18-K20 VanDerWaalsContact O-N 3.16Å; K20-L25 HydrophobicContact CB-CD2 4.02Å; K20-L25 HydrophobicContact CB-CG 4.12Å; K20-L25 HydrophobicContact CD-CD2 3.93Å
21	S	77.6	Confident	73	Confident	74 Å²	74	121.7 Å²	121.7	52%	0.517	64%	0.639	S	S	.	*	P	Polyproline II helix	trans	-58.1	149.5	177.6	60.3	0	0	0	0	110.1	G19 R23 S24 L25	G19-S21 PolarHBondContact O-N 2.96Å; G19-S21 VanDerWaalsContact O-N 3.12Å; S21-R23 PolarHBondContact O-N 3.47Å; S21-R23 VanDerWaalsContact O-N 3.16Å; S21-S24 WeakPolarHBondContact O-CA 3.44Å; S21-S24 VanDerWaalsContact O-CB 3.25Å; S21-S24 WeakPolarHBondContact O-CB 3.47Å; S21-S24 PolarHBondContact O-N 3.47Å; S21-S24 WeakPolarHBondContact OG-CB 3.33Å; S21-S24 PolarHBondContact OG-N 2.92Å; S21-L25 PolarHBondContact O-N 3.23Å
22	E	77.8	Confident	73.4	Confident	171 Å²	171	118.3 Å²	118.3	80%	0.799	64%	0.637	S	S	*	*	H	α-helix	trans	-50.8	-41	177	-172.2	178.9	-178.4	0	0	111.6	S24 L25 Q26	E22-S24 VanDerWaalsContact C-N 3.31Å; E22-S24 PolarHBondContact O-N 3.23Å; E22-L25 WeakPolarHBondContact O-CB 3.32Å; E22-L25 PolarHBondContact O-N 3.46Å; E22-Q26 WeakPolarHBondContact O-CB 3.41Å; E22-Q26 PolarHBondContact O-N 3.42Å
23	R	77.8	Confident	73.9	Confident	181 Å²	181	119 Å²	119	68%	0.683	64%	0.639	S	S	*	*	H	α-helix	trans	-61.6	-35	174.5	-165	175.5	-175.1	-175.2	1.8	113.4	S21 K27	S21-R23 PolarHBondContact O-N 3.47Å; S21-R23 VanDerWaalsContact O-N 3.16Å; R23-K27 WeakPolarHBondContact O-CG 3.42Å; R23-K27 PolarHBondContact O-N 3Å; R23-K27 VanDerWaalsContact O-N 3.12Å
24	S	78.4	Confident	74.3	Confident	42 Å²	42	124.7 Å²	124.7	29%	0.294	65%	0.649	S	S	.	*	H	α-helix	trans	-70.3	-41	175.2	-175.4	0	0	0	0	111.3	S21 E22 K27 Q28	S21-S24 WeakPolarHBondContact O-CA 3.44Å; S21-S24 VanDerWaalsContact O-CB 3.25Å; S21-S24 WeakPolarHBondContact O-CB 3.47Å; S21-S24 PolarHBondContact O-N 3.47Å; S21-S24 WeakPolarHBondContact OG-CB 3.33Å; S21-S24 PolarHBondContact OG-N 2.92Å; E22-S24 VanDerWaalsContact C-N 3.31Å; E22-S24 PolarHBondContact O-N 3.23Å; S24-K27 PolarHBondContact O-N 3.28Å; S24-Q28 WeakPolarHBondContact O-CG 3.17Å; S24-Q28 PolarHBondContact O-N 2.88Å; S24-Q28 VanDerWaalsContact O-N 3.14Å
25	L	76.9	Confident	74.8	Confident	92 Å²	92	124.5 Å²	124.5	48%	0.482	65%	0.648	S	S	.	*	H	α-helix	trans	-63.1	-42	174.6	-65.7	173.2	0	0	0	111.4	K20 S21 E22 K27 Q28 S29	K20-L25 HydrophobicContact CB-CD2 4.02Å; K20-L25 HydrophobicContact CB-CG 4.12Å; K20-L25 HydrophobicContact CD-CD2 3.93Å; S21-L25 PolarHBondContact O-N 3.23Å; E22-L25 WeakPolarHBondContact O-CB 3.32Å; E22-L25 PolarHBondContact O-N 3.46Å; L25-K27 PolarHBondContact O-N 2.75Å; L25-Q28 PolarHBondContact O-N 2.88Å; L25-Q28 VanDerWaalsContact O-N 3.1Å; L25-S29 PolarHBondContact O-N 2.98Å
26	Q	77.5	Confident	75.2	Confident	120 Å²	120	124.7 Å²	124.7	56%	0.561	65%	0.649	S	S	*	*	H	α-helix	trans	-63.3	-40.2	176.6	-164.3	178.6	29.8	0	0	112.3	E22 Q28 S29 I30	E22-Q26 WeakPolarHBondContact O-CB 3.41Å; E22-Q26 PolarHBondContact O-N 3.42Å; Q26-Q28 VanDerWaalsContact C-N 3.26Å; Q26-Q28 PolarHBondContact O-N 3.46Å; Q26-S29 PolarHBondContact O-N 3.37Å; Q26-S29 PolarHBondContact O-OG 3.37Å; Q26-I30 HydrophobicContact CG-CD1 4.26Å; Q26-I30 WeakPolarHBondContact O-CD1 3.38Å; Q26-I30 VanDerWaalsContact O-CG1 3.25Å; Q26-I30 WeakPolarHBondContact O-CG1 3.1Å; Q26-I30 PolarHBondContact O-N 3.47Å
27	K	77.2	Confident	75.8	Confident	140 Å²	140	124.4 Å²	124.4	61%	0.609	65%	0.648	S	S	*	*	H	α-helix	trans	-63.5	-32.3	173.1	-73.8	-179.9	-178.2	-171.4	0	112.6	R23 S24 L25	R23-K27 WeakPolarHBondContact O-CG 3.42Å; R23-K27 PolarHBondContact O-N 3Å; R23-K27 VanDerWaalsContact O-N 3.12Å; S24-K27 PolarHBondContact O-N 3.28Å; L25-K27 PolarHBondContact O-N 2.75Å
28	Q	72.6	Confident	76.4	Confident	94 Å²	94	124.4 Å²	124.4	44%	0.439	64%	0.643	S	S	.	*	H	α-helix	trans	-74.4	-34.5	177.4	-70.8	-172.8	-5.9	0	0	112.3	S24 L25 Q26 I30	S24-Q28 WeakPolarHBondContact O-CG 3.17Å; S24-Q28 PolarHBondContact O-N 2.88Å; S24-Q28 VanDerWaalsContact O-N 3.14Å; L25-Q28 PolarHBondContact O-N 2.88Å; L25-Q28 VanDerWaalsContact O-N 3.1Å; Q26-Q28 VanDerWaalsContact C-N 3.26Å; Q26-Q28 PolarHBondContact O-N 3.46Å; Q28-I30 VanDerWaalsContact C-N 3.35Å
29	S	72.7	Confident	77	Confident	93 Å²	93	125.8 Å²	125.8	65%	0.65	65%	0.647	S	S	*	*	H	α-helix	trans	-71.8	-26.6	177.9	64.6	0	0	0	0	113.7	L25 Q26 K31	L25-S29 PolarHBondContact O-N 2.98Å; Q26-S29 PolarHBondContact O-N 3.37Å; Q26-S29 PolarHBondContact O-OG 3.37Å; S29-K31 VanDerWaalsContact C-N 3.31Å; S29-K31 PolarHBondContact O-N 2.9Å
30	I	72.7	Confident	77.7	Confident	123 Å²	123	128.6 Å²	128.6	63%	0.631	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.6	-15	180	-63	161.8	0	0	0	112.5	Q26 Q28 P32	Q26-I30 HydrophobicContact CG-CD1 4.26Å; Q26-I30 WeakPolarHBondContact O-CD1 3.38Å; Q26-I30 VanDerWaalsContact O-CG1 3.25Å; Q26-I30 WeakPolarHBondContact O-CG1 3.1Å; Q26-I30 PolarHBondContact O-N 3.47Å; Q28-I30 VanDerWaalsContact C-N 3.35Å; I30-P32 VanDerWaalsContact O-N 3.12Å
31	K	76.8	Confident	78.3	Confident	151 Å²	151	126.8 Å²	126.8	66%	0.657	64%	0.636	S	S	*	*	S	Bend	trans	-56.5	124.7	-179.5	-74.2	-171.4	178.5	-173.8	0	109.5	S29 M33	S29-K31 VanDerWaalsContact C-N 3.31Å; S29-K31 PolarHBondContact O-N 2.9Å; K31-M33 PolarHBondContact O-N 2.9Å
32	P	76	Confident	79	Confident	122 Å²	122	126.9 Å²	126.9	79%	0.792	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-59.3	127.3	-178.7	23.3	-32.3	0	0	0	108.8	I30 R34	I30-P32 VanDerWaalsContact O-N 3.12Å; P32-R34 PolarHBondContact O-N 2.98Å
33	M	75.6	Confident	79.7	Confident	139 Å²	139	126.8 Å²	126.8	69%	0.685	63%	0.632	S	S	*	*	P	Polyproline II helix	trans	-59.6	133	169.5	-67.4	-174	72	0	0	108.1	K31 K35	K31-M33 PolarHBondContact O-N 2.9Å; M33-K35 PolarHBondContact O-N 3.41Å
34	R	81.7	Confident	80.4	Confident	208 Å²	208	127 Å²	127	79%	0.785	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-59.1	138.9	175.6	-68.7	-178.8	178	176.2	-1.1	109.1	P32 G36 T37	P32-R34 PolarHBondContact O-N 2.98Å; R34-G36 PolarHBondContact O-N 2.88Å; R34-T37 HydrophobicContact CB-CG2 3.81Å; R34-T37 PolarHBondContact O-N 2.95Å; R34-T37 VanDerWaalsContact O-N 3.11Å; R34-T37 PolarHBondContact O-OG1 3.34Å
35	K	80.8	Confident	81.1	Confident	219 Å²	219	130 Å²	130	95%	0.952	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.3	127.3	175.6	-171.8	178.2	178.9	-178.1	0	108.9	M33	M33-K35 PolarHBondContact O-N 3.41Å
36	G	79.9	Confident	81.8	Confident	79 Å²	79	130.9 Å²	130.9	81%	0.814	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	91.7	-8.5	179.7	0	0	0	0	0	116.5	R34 R38	R34-G36 PolarHBondContact O-N 2.88Å; G36-R38 VanDerWaalsContact C-N 3.28Å; G36-R38 PolarHBondContact O-N 3.19Å
37	T	82.5	Confident	82.6	Confident	76 Å²	76	130.6 Å²	130.6	47%	0.466	65%	0.646	S	S	.	*			trans	-85.1	2.7	177.3	64.3	0	0	0	0	114.1	R34 V39	R34-T37 HydrophobicContact CB-CG2 3.81Å; R34-T37 PolarHBondContact O-N 2.95Å; R34-T37 VanDerWaalsContact O-N 3.11Å; R34-T37 PolarHBondContact O-OG1 3.34Å; T37-V39 PolarHBondContact O-N 3.24Å; T37-V39 VanDerWaalsContact O-N 3.12Å
38	R	80.5	Confident	83.5	Confident	196 Å²	196	130.3 Å²	130.3	74%	0.74	65%	0.645	S	S	*	*			trans	-71.4	110.5	179.9	-171.7	178.4	-175.9	-175.7	2.5	109.2	G36 I40	G36-R38 VanDerWaalsContact C-N 3.28Å; G36-R38 PolarHBondContact O-N 3.19Å; R38-I40 PolarHBondContact O-N 3.36Å; R38-I40 VanDerWaalsContact O-N 3.1Å
39	V	81.5	Confident	84.5	Confident	129 Å²	129	130.3 Å²	130.3	78%	0.782	65%	0.645	S	S	*	*			trans	-65.3	111.8	170.4	-177.5	0	0	0	0	108.5	T37 K41	T37-V39 PolarHBondContact O-N 3.24Å; T37-V39 VanDerWaalsContact O-N 3.12Å; V39-K41 PolarHBondContact O-N 2.89Å
40	I	83.4	Confident	85.5	Confident	127 Å²	127	128.2 Å²	128.2	65%	0.651	63%	0.633	S	S	*	*			trans	-82.2	102.6	176.2	-71.2	174.9	0	0	0	106.9	R38	R38-I40 PolarHBondContact O-N 3.36Å; R38-I40 VanDerWaalsContact O-N 3.1Å
41	K	85.2	Confident	86.6	Confident	86 Å²	86	127 Å²	127	37%	0.374	63%	0.625	S	S	.	*			trans	-57.5	147.1	170.9	-64.2	-174.4	-171.5	172.5	0	111.1	V39 E45 R46 E49	V39-K41 PolarHBondContact O-N 2.89Å; K41-E45 HydrophobicContact CB-CB 4.47Å; K41-R46 HydrophobicContact CB-CG 4.14Å; K41-R46 PolarHBondContact O-NE 3.21Å; K41-E49 IonicContact NZ-OE1 2.75Å; K41-E49 PolarHBondContact NZ-OE1 3.49Å; K41-E49 IonicContact NZ-OE2 3Å; K41-E49 PolarHBondContact NZ-OE2 3.14Å
42	P	92.6	Very high	87.5	Confident	76 Å²	76	124.8 Å²	124.8	49%	0.494	62%	0.617	S	S	.	*			trans	-52.4	151.4	171.4	-25.9	33.2	0	0	0	113.5	K44 E45 R46	P42-K44 VanDerWaalsContact C-N 3.29Å; P42-K44 PolarHBondContact O-N 3.27Å; P42-E45 WeakPolarHBondContact CD-OE2 3.06Å; P42-E45 PolarHBondContact O-N 3.17Å; P42-R46 PolarHBondContact O-N 3.26Å
43	K	91.5	Very high	88.5	Confident	170 Å²	170	124.7 Å²	124.7	74%	0.739	61%	0.607	S	S	*	*	H	α-helix	trans	-56.6	-40.3	-178.1	-171.9	177.5	180	-179.6	0	112.8	R46 L47	K43-R46 PolarHBondContact O-N 3.11Å; K43-L47 WeakPolarHBondContact O-CG 3.45Å; K43-L47 PolarHBondContact O-N 3.01Å; K43-L47 VanDerWaalsContact O-N 3.17Å
44	K	92.9	Very high	89.5	Confident	184 Å²	184	124.2 Å²	124.2	80%	0.8	60%	0.601	S	S	*	*	H	α-helix	trans	-62.5	-44.2	179.5	-68.6	-174.1	179.4	-179.1	0	112.3	P42 L47 K48	P42-K44 VanDerWaalsContact C-N 3.29Å; P42-K44 PolarHBondContact O-N 3.27Å; K44-L47 PolarHBondContact O-N 3.5Å; K44-K48 PolarHBondContact O-N 2.92Å; K44-K48 VanDerWaalsContact O-N 3.07Å
45	E	92.3	Very high	90.2	Very high	105 Å²	105	119.4 Å²	119.4	49%	0.491	59%	0.586	S	S	.	*	H	α-helix	trans	-64.8	-40.6	178.7	-69.5	179.4	-169.1	0	0	111.9	K41 P42 L47 K48 E49	K41-E45 HydrophobicContact CB-CB 4.47Å; P42-E45 WeakPolarHBondContact CD-OE2 3.06Å; P42-E45 PolarHBondContact O-N 3.17Å; E45-L47 VanDerWaalsContact C-N 3.32Å; E45-L47 PolarHBondContact O-N 3.37Å; E45-K48 PolarHBondContact O-N 2.9Å; E45-E49 WeakPolarHBondContact O-CB 3.48Å; E45-E49 PolarHBondContact O-N 3.33Å
46	R	92.4	Very high	91	Very high	112 Å²	112	113.9 Å²	113.9	42%	0.423	56%	0.563	S	S	.	*	H	α-helix	trans	-60.6	-41.2	176	-66.4	178.2	-175.2	-159.5	-9.3	112.5	K41 P42 K43 A50	K41-R46 HydrophobicContact CB-CG 4.14Å; K41-R46 PolarHBondContact O-NE 3.21Å; P42-R46 PolarHBondContact O-N 3.26Å; K43-R46 PolarHBondContact O-N 3.11Å; R46-A50 VanDerWaalsContact O-CB 3.32Å; R46-A50 WeakPolarHBondContact O-CB 3.41Å; R46-A50 PolarHBondContact O-N 3.37Å
47	L	94.5	Very high	91.7	Very high	113 Å²	113	114.4 Å²	114.4	59%	0.592	55%	0.546	S	S	*	.	H	α-helix	trans	-66.7	-40	177.3	-69.1	174.1	0	0	0	111.4	K43 K44 E45 A50 H51	K43-L47 WeakPolarHBondContact O-CG 3.45Å; K43-L47 PolarHBondContact O-N 3.01Å; K43-L47 VanDerWaalsContact O-N 3.17Å; K44-L47 PolarHBondContact O-N 3.5Å; E45-L47 VanDerWaalsContact C-N 3.32Å; E45-L47 PolarHBondContact O-N 3.37Å; L47-A50 PolarHBondContact O-N 3.39Å; L47-H51 WeakPolarHBondContact O-CB 3.4Å; L47-H51 PolarHBondContact O-N 3.04Å
48	K	94.9	Very high	92.4	Very high	134 Å²	134	114.9 Å²	114.9	58%	0.583	54%	0.542	S	S	*	.	H	α-helix	trans	-62.3	-48.3	175.2	-173	179.5	174.8	-175.5	0	111.3	K44 E45 A50 H51 E52	K44-K48 PolarHBondContact O-N 2.92Å; K44-K48 VanDerWaalsContact O-N 3.07Å; E45-K48 PolarHBondContact O-N 2.9Å; K48-A50 PolarHBondContact O-N 3.37Å; K48-H51 PolarHBondContact O-N 3.46Å; K48-E52 WeakPolarHBondContact CE-OE1 3.42Å; K48-E52 WeakPolarHBondContact O-CG 3.34Å; K48-E52 PolarHBondContact O-N 3.01Å
49	E	93.7	Very high	93.2	Very high	95 Å²	95	112.1 Å²	112.1	44%	0.444	54%	0.536	S	S	.	.	H	α-helix	trans	-60.3	-43.6	177.1	-176.4	171	-155.7	0	0	111.8	K41 E45 H51 E52 M53	K41-E49 IonicContact NZ-OE1 2.75Å; K41-E49 PolarHBondContact NZ-OE1 3.49Å; K41-E49 IonicContact NZ-OE2 3Å; K41-E49 PolarHBondContact NZ-OE2 3.14Å; E45-E49 WeakPolarHBondContact O-CB 3.48Å; E45-E49 PolarHBondContact O-N 3.33Å; E49-H51 PolarHBondContact O-N 2.99Å; E49-E52 PolarHBondContact O-N 3.48Å; E49-M53 WeakPolarHBondContact O-CB 3.48Å; E49-M53 PolarHBondContact O-N 3.1Å
50	A	94.4	Very high	93.9	Very high	49 Å²	49	110 Å²	110	41%	0.405	52%	0.52	S	S	.	.	H	α-helix	trans	-63.7	-40.1	176.1	0	0	0	0	0	112.4	R46 L47 K48 M53 K54	R46-A50 VanDerWaalsContact O-CB 3.32Å; R46-A50 WeakPolarHBondContact O-CB 3.41Å; R46-A50 PolarHBondContact O-N 3.37Å; L47-A50 PolarHBondContact O-N 3.39Å; K48-A50 PolarHBondContact O-N 3.37Å; A50-M53 PolarHBondContact O-N 3.08Å; A50-K54 WeakPolarHBondContact O-CB 3.37Å; A50-K54 PolarHBondContact O-N 3.22Å
51	H	96.1	Very high	94.5	Very high	97 Å²	97	109.4 Å²	109.4	45%	0.449	52%	0.517	S	S	.	.	H	α-helix	trans	-69.6	-40	177.6	176.2	-110	0	0	0	112.4	L47 K48 E49 K54 K55	L47-H51 WeakPolarHBondContact O-CB 3.4Å; L47-H51 PolarHBondContact O-N 3.04Å; K48-H51 PolarHBondContact O-N 3.46Å; E49-H51 PolarHBondContact O-N 2.99Å; H51-K54 PolarHBondContact O-N 2.95Å; H51-K55 WeakPolarHBondContact CE1-CE 3.34Å; H51-K55 PolarHBondContact CE1-NZ 2.7Å; H51-K55 VanDerWaalsContact CE1-NZ 3.28Å; H51-K55 WeakPolarHBondContact NE2-CE 3.5Å; H51-K55 WeakPolarHBondContact O-CG 3.34Å; H51-K55 PolarHBondContact O-N 2.86Å
52	E	96.3	Very high	95	Very high	105 Å²	105	111.9 Å²	111.9	49%	0.491	53%	0.528	S	S	.	.	H	α-helix	trans	-62.3	-43.7	172.6	-74.5	173.9	-178.5	0	0	111.4	K48 E49 K55 H56	K48-E52 WeakPolarHBondContact CE-OE1 3.42Å; K48-E52 WeakPolarHBondContact O-CG 3.34Å; K48-E52 PolarHBondContact O-N 3.01Å; E49-E52 PolarHBondContact O-N 3.48Å; E52-K55 PolarHBondContact O-N 2.95Å; E52-H56 WeakPolarHBondContact O-CB 3.33Å; E52-H56 PolarHBondContact O-N 2.88Å
53	M	95.5	Very high	95.1	Very high	119 Å²	119	115 Å²	115	59%	0.586	53%	0.534	S	S	*	.	H	α-helix	trans	-61.4	-44.4	174.7	-174.7	178.8	67.9	0	0	111.6	E49 A50 K55 H56 M57	E49-M53 WeakPolarHBondContact O-CB 3.48Å; E49-M53 PolarHBondContact O-N 3.1Å; A50-M53 PolarHBondContact O-N 3.08Å; M53-K55 PolarHBondContact O-N 3.12Å; M53-H56 PolarHBondContact O-N 3.36Å; M53-M57 WeakPolarHBondContact O-CG 3.34Å; M53-M57 PolarHBondContact O-N 2.95Å
54	K	96.6	Very high	95.3	Very high	130 Å²	130	109 Å²	109	57%	0.565	51%	0.514	S	S	*	.	H	α-helix	trans	-57.4	-50.1	175	-178.7	179.3	173.2	-179.5	0	111.2	A50 H51 H56 M57 E58	A50-K54 WeakPolarHBondContact O-CB 3.37Å; A50-K54 PolarHBondContact O-N 3.22Å; H51-K54 PolarHBondContact O-N 2.95Å; K54-H56 VanDerWaalsContact C-N 3.29Å; K54-H56 PolarHBondContact O-N 3.38Å; K54-M57 PolarHBondContact O-N 3.12Å; K54-E58 WeakPolarHBondContact CE-OE1 3.4Å; K54-E58 WeakPolarHBondContact O-CG 3.25Å; K54-E58 PolarHBondContact O-N 2.82Å
55	K	97	Very high	95.4	Very high	106 Å²	106	104.6 Å²	104.6	46%	0.461	50%	0.502	S	S	.	.	H	α-helix	trans	-59.3	-39.8	176.4	-77.5	-178.4	169.1	-178.1	0	112.5	H51 E52 M53 K59	H51-K55 WeakPolarHBondContact CE1-CE 3.34Å; H51-K55 PolarHBondContact CE1-NZ 2.7Å; H51-K55 VanDerWaalsContact CE1-NZ 3.28Å; H51-K55 WeakPolarHBondContact NE2-CE 3.5Å; H51-K55 WeakPolarHBondContact O-CG 3.34Å; H51-K55 PolarHBondContact O-N 2.86Å; E52-K55 PolarHBondContact O-N 2.95Å; M53-K55 PolarHBondContact O-N 3.12Å; K55-K59 WeakPolarHBondContact O-CG 3.45Å; K55-K59 PolarHBondContact O-N 3.16Å; K55-K59 VanDerWaalsContact O-N 3.11Å
56	H	96.4	Very high	95.5	Very high	104 Å²	104	105.3 Å²	105.3	48%	0.481	51%	0.505	S	S	.	.	H	α-helix	trans	-65.9	-44.7	177.6	-178.8	-101.2	0	0	0	111.7	E52 M53 K54 K59 L60	E52-H56 WeakPolarHBondContact O-CB 3.33Å; E52-H56 PolarHBondContact O-N 2.88Å; M53-H56 PolarHBondContact O-N 3.36Å; K54-H56 VanDerWaalsContact C-N 3.29Å; K54-H56 PolarHBondContact O-N 3.38Å; H56-K59 WeakPolarHBondContact O-CB 3.49Å; H56-K59 PolarHBondContact O-N 3.12Å; H56-L60 PolarHBondContact O-N 3.43Å
57	M	96.6	Very high	95.6	Very high	90 Å²	90	106.1 Å²	106.1	44%	0.443	51%	0.512	S	S	.	.	H	α-helix	trans	-61.7	-44.4	175.8	-69.2	-62.6	102	0	0	112	M53 K54 K59 L60 L61	M53-M57 WeakPolarHBondContact O-CG 3.34Å; M53-M57 PolarHBondContact O-N 2.95Å; K54-M57 PolarHBondContact O-N 3.12Å; M57-K59 VanDerWaalsContact C-N 3.3Å; M57-K59 PolarHBondContact O-N 3.18Å; M57-L60 HydrophobicContact CE-CD1 3.64Å; M57-L60 PolarHBondContact O-N 3.35Å; M57-L60 VanDerWaalsContact O-N 3.17Å; M57-L61 WeakPolarHBondContact O-CG 3.37Å; M57-L61 PolarHBondContact O-N 3.04Å
58	E	96.4	Very high	95.5	Very high	85 Å²	85	105.7 Å²	105.7	40%	0.397	51%	0.507	S	S	.	.	H	α-helix	trans	-58.4	-41.6	175.3	-73.8	172.4	-175.9	0	0	112.1	K54 L61 K62	K54-E58 WeakPolarHBondContact CE-OE1 3.4Å; K54-E58 WeakPolarHBondContact O-CG 3.25Å; K54-E58 PolarHBondContact O-N 2.82Å; E58-L61 PolarHBondContact O-N 3.38Å; E58-K62 WeakPolarHBondContact O-CG 3.48Å; E58-K62 PolarHBondContact O-N 2.87Å
59	K	96.6	Very high	95.3	Very high	139 Å²	139	101.8 Å²	101.8	60%	0.604	50%	0.499	S	S	*	.	H	α-helix	trans	-63.9	-42.4	175.4	-74.2	176	-179.5	-175.8	0	112.3	K55 H56 M57 K63	K55-K59 WeakPolarHBondContact O-CG 3.45Å; K55-K59 PolarHBondContact O-N 3.16Å; K55-K59 VanDerWaalsContact O-N 3.11Å; H56-K59 WeakPolarHBondContact O-CB 3.49Å; H56-K59 PolarHBondContact O-N 3.12Å; M57-K59 VanDerWaalsContact C-N 3.3Å; M57-K59 PolarHBondContact O-N 3.18Å; K59-K63 WeakPolarHBondContact O-CG 3.38Å; K59-K63 PolarHBondContact O-N 3.04Å; K59-K63 VanDerWaalsContact O-N 3.08Å
60	L	96.4	Very high	95.1	Very high	84 Å²	84	103 Å²	103	44%	0.44	51%	0.507	S	S	.	.	H	α-helix	trans	-65	-41.8	177.8	-72.6	-178.5	0	0	0	111.8	H56 M57 K63 S64	H56-L60 PolarHBondContact O-N 3.43Å; M57-L60 HydrophobicContact CE-CD1 3.64Å; M57-L60 PolarHBondContact O-N 3.35Å; M57-L60 VanDerWaalsContact O-N 3.17Å; L60-K63 PolarHBondContact O-N 3.08Å; L60-S64 WeakPolarHBondContact O-CB 3.47Å; L60-S64 PolarHBondContact O-N 3.26Å; L60-S64 PolarHBondContact O-OG 2.97Å
61	L	96.1	Very high	94.9	Very high	114 Å²	114	105.1 Å²	105.1	60%	0.597	51%	0.509	S	S	*	.	H	α-helix	trans	-62	-48.4	177.3	-72.8	173.5	0	0	0	111.3	M57 E58 K63 S64 V65	M57-L61 WeakPolarHBondContact O-CG 3.37Å; M57-L61 PolarHBondContact O-N 3.04Å; E58-L61 PolarHBondContact O-N 3.38Å; L61-K63 VanDerWaalsContact C-N 3.34Å; L61-K63 PolarHBondContact O-N 3.05Å; L61-S64 WeakPolarHBondContact CA-OG 3.27Å; L61-S64 PolarHBondContact O-N 2.92Å; L61-S64 VanDerWaalsContact O-N 3.12Å; L61-S64 PolarHBondContact O-OG 3.16Å; L61-V65 WeakPolarHBondContact O-CG2 3.37Å; L61-V65 PolarHBondContact O-N 3.48Å
62	K	95.5	Very high	94.4	Very high	139 Å²	139	107.1 Å²	107.1	60%	0.604	52%	0.517	S	S	*	.	H	α-helix	trans	-54.8	-49.6	175.4	-73	178.4	179.6	-173.9	0	111.8	E58 S64 V65 E66	E58-K62 WeakPolarHBondContact O-CG 3.48Å; E58-K62 PolarHBondContact O-N 2.87Å; K62-S64 VanDerWaalsContact C-N 3.34Å; K62-S64 PolarHBondContact O-N 3.28Å; K62-V65 PolarHBondContact O-N 3.44Å; K62-E66 WeakPolarHBondContact O-CG 3.48Å; K62-E66 PolarHBondContact O-N 3.01Å
63	K	95.7	Very high	93.7	Very high	140 Å²	140	107.5 Å²	107.5	61%	0.609	53%	0.526	S	S	*	.	H	α-helix	trans	-59.9	-40.6	176.5	-73.7	-178.8	177.9	-169.7	0	113	K59 L60 L61 K67	K59-K63 WeakPolarHBondContact O-CG 3.38Å; K59-K63 PolarHBondContact O-N 3.04Å; K59-K63 VanDerWaalsContact O-N 3.08Å; L60-K63 PolarHBondContact O-N 3.08Å; L61-K63 VanDerWaalsContact C-N 3.34Å; L61-K63 PolarHBondContact O-N 3.05Å; K63-K67 VanDerWaalsContact O-CB 3.27Å; K63-K67 WeakPolarHBondContact O-CB 3.25Å; K63-K67 PolarHBondContact O-N 3.44Å
64	S	95.7	Very high	93	Very high	46 Å²	46	106 Å²	106	32%	0.322	53%	0.527	S	S	.	.	H	α-helix	trans	-66.4	-38.3	178.3	67.6	0	0	0	0	112.3	L60 L61 K62 Q68	L60-S64 WeakPolarHBondContact O-CB 3.47Å; L60-S64 PolarHBondContact O-N 3.26Å; L60-S64 PolarHBondContact O-OG 2.97Å; L61-S64 WeakPolarHBondContact CA-OG 3.27Å; L61-S64 PolarHBondContact O-N 2.92Å; L61-S64 VanDerWaalsContact O-N 3.12Å; L61-S64 PolarHBondContact O-OG 3.16Å; K62-S64 VanDerWaalsContact C-N 3.34Å; K62-S64 PolarHBondContact O-N 3.28Å; S64-Q68 WeakPolarHBondContact O-CB 3.47Å; S64-Q68 VanDerWaalsContact O-CG 3.28Å; S64-Q68 WeakPolarHBondContact O-CG 3.3Å; S64-Q68 PolarHBondContact O-N 3.25Å
65	V	95.2	Very high	92.3	Very high	91 Å²	91	104 Å²	104	55%	0.552	53%	0.529	S	S	*	.	H	α-helix	trans	-68.6	-46.1	178	171	0	0	0	0	110.4	L61 K62 K67 Q68 A69	L61-V65 WeakPolarHBondContact O-CG2 3.37Å; L61-V65 PolarHBondContact O-N 3.48Å; K62-V65 PolarHBondContact O-N 3.44Å; V65-K67 VanDerWaalsContact C-N 3.33Å; V65-K67 PolarHBondContact O-N 3.32Å; V65-Q68 PolarHBondContact O-N 2.94Å; V65-A69 PolarHBondContact O-N 3.37Å
66	E	93.4	Very high	91.1	Very high	119 Å²	119	103.5 Å²	103.5	56%	0.556	54%	0.538	S	S	*	.	H	α-helix	trans	-57.5	-46.7	175	-73.1	167.2	-169.1	0	0	111.2	K62 Q68 A69 I70	K62-E66 WeakPolarHBondContact O-CG 3.48Å; K62-E66 PolarHBondContact O-N 3.01Å; E66-Q68 PolarHBondContact O-N 3.44Å; E66-A69 PolarHBondContact O-N 3.32Å; E66-I70 VanDerWaalsContact O-CG1 3.3Å; E66-I70 WeakPolarHBondContact O-CG1 3.29Å; E66-I70 PolarHBondContact O-N 3.33Å
67	K	94.5	Very high	89.7	Confident	130 Å²	130	106.4 Å²	106.4	57%	0.565	55%	0.552	S	S	*	*	H	α-helix	trans	-60.3	-46.4	177.3	-174.1	177.9	175.5	-171.9	0	111.9	K63 V65 A69 I70 E71	K63-K67 VanDerWaalsContact O-CB 3.27Å; K63-K67 WeakPolarHBondContact O-CB 3.25Å; K63-K67 PolarHBondContact O-N 3.44Å; V65-K67 VanDerWaalsContact C-N 3.33Å; V65-K67 PolarHBondContact O-N 3.32Å; K67-A69 VanDerWaalsContact C-N 3.32Å; K67-A69 PolarHBondContact O-N 2.87Å; K67-I70 PolarHBondContact O-N 2.99Å; K67-E71 WeakPolarHBondContact CE-OE1 3.5Å; K67-E71 IonicContact NZ-OE1 3.88Å; K67-E71 WeakPolarHBondContact O-CB 3.42Å; K67-E71 WeakPolarHBondContact O-CG 3.28Å; K67-E71 PolarHBondContact O-N 2.89Å
68	Q	92.5	Very high	88.2	Confident	104 Å²	104	107.8 Å²	107.8	49%	0.486	57%	0.568	S	S	.	*	H	α-helix	trans	-63.8	-36.7	177.5	-75.4	177.1	15.9	0	0	112.6	S64 V65 E66 K72	S64-Q68 WeakPolarHBondContact O-CB 3.47Å; S64-Q68 VanDerWaalsContact O-CG 3.28Å; S64-Q68 WeakPolarHBondContact O-CG 3.3Å; S64-Q68 PolarHBondContact O-N 3.25Å; V65-Q68 PolarHBondContact O-N 2.94Å; E66-Q68 PolarHBondContact O-N 3.44Å; Q68-K72 WeakPolarHBondContact O-CB 3.03Å; Q68-K72 VanDerWaalsContact O-CG 3.29Å; Q68-K72 WeakPolarHBondContact O-CG 3.35Å; Q68-K72 PolarHBondContact O-N 2.83Å
69	A	90.3	Very high	86.7	Confident	52 Å²	52	114.9 Å²	114.9	43%	0.43	59%	0.591	S	S	.	*	H	α-helix	trans	-65.2	-44.9	176.4	0	0	0	0	0	111.1	V65 E66 K67 K72 V73	V65-A69 PolarHBondContact O-N 3.37Å; E66-A69 PolarHBondContact O-N 3.32Å; K67-A69 VanDerWaalsContact C-N 3.32Å; K67-A69 PolarHBondContact O-N 2.87Å; A69-K72 PolarHBondContact O-N 2.89Å; A69-V73 WeakPolarHBondContact O-CG2 3.37Å; A69-V73 PolarHBondContact O-N 3.03Å
70	I	89.6	Confident	85	Confident	119 Å²	119	113.1 Å²	113.1	61%	0.61	60%	0.596	S	S	*	*	H	α-helix	trans	-61.6	-46.7	175.5	-65.6	164.2	0	0	0	110.6	E66 K67 K72 V73 S74	E66-I70 VanDerWaalsContact O-CG1 3.3Å; E66-I70 WeakPolarHBondContact O-CG1 3.29Å; E66-I70 PolarHBondContact O-N 3.33Å; K67-I70 PolarHBondContact O-N 2.99Å; I70-K72 PolarHBondContact O-N 3.41Å; I70-V73 PolarHBondContact O-N 3.19Å; I70-S74 WeakPolarHBondContact O-CB 3.33Å; I70-S74 PolarHBondContact O-N 3.44Å; I70-S74 PolarHBondContact O-OG 2.9Å
71	E	90	Very high	83.4	Confident	95 Å²	95	116.6 Å²	116.6	44%	0.444	61%	0.614	S	S	.	*	H	α-helix	trans	-58.8	-45.6	177.6	-76.5	173.3	176.4	0	0	111.4	K67 S74 S75	K67-E71 WeakPolarHBondContact CE-OE1 3.5Å; K67-E71 IonicContact NZ-OE1 3.88Å; K67-E71 WeakPolarHBondContact O-CB 3.42Å; K67-E71 WeakPolarHBondContact O-CG 3.28Å; K67-E71 PolarHBondContact O-N 2.89Å; E71-S74 WeakPolarHBondContact CA-OG 3.41Å; E71-S74 PolarHBondContact O-N 3.23Å; E71-S74 PolarHBondContact O-OG 2.73Å; E71-S75 WeakPolarHBondContact O-CB 3.42Å; E71-S75 PolarHBondContact O-N 3.27Å; E71-S75 PolarHBondContact O-OG 2.83Å
72	K	86.3	Confident	81.8	Confident	139 Å²	139	120.2 Å²	120.2	60%	0.604	63%	0.625	S	S	*	*	H	α-helix	trans	-61.2	-48.3	176.9	-76.6	178.2	-178.6	-177.8	0	112.3	Q68 A69 I70 S74 S75 C76	Q68-K72 WeakPolarHBondContact O-CB 3.03Å; Q68-K72 VanDerWaalsContact O-CG 3.29Å; Q68-K72 WeakPolarHBondContact O-CG 3.35Å; Q68-K72 PolarHBondContact O-N 2.83Å; A69-K72 PolarHBondContact O-N 2.89Å; I70-K72 PolarHBondContact O-N 3.41Å; K72-S74 VanDerWaalsContact C-N 3.31Å; K72-S74 PolarHBondContact O-N 2.75Å; K72-S75 WeakPolarHBondContact CA-OG 3.46Å; K72-S75 PolarHBondContact O-N 3.38Å; K72-S75 PolarHBondContact O-OG 2.83Å; K72-C76 PolarHBondContact O-N 3.04Å; K72-C76 PolarHBondContact O-SG 2.7Å; K72-C76 VanDerWaalsContact O-SG 3.41Å
73	V	82.6	Confident	80.4	Confident	112 Å²	112	120.5 Å²	120.5	68%	0.679	63%	0.632	S	S	*	*	H	α-helix	trans	-61.3	-42.6	177.7	173	0	0	0	0	110.7	A69 I70 S75 C76	A69-V73 WeakPolarHBondContact O-CG2 3.37Å; A69-V73 PolarHBondContact O-N 3.03Å; I70-V73 PolarHBondContact O-N 3.19Å; V73-S75 VanDerWaalsContact C-N 3.3Å; V73-S75 PolarHBondContact O-N 3.4Å; V73-C76 PolarHBondContact O-N 2.89Å
74	S	80.4	Confident	79	Confident	87 Å²	87	119.9 Å²	119.9	61%	0.608	64%	0.64	S	S	*	*	H	α-helix	trans	-65.5	-32	177.6	72.2	0	0	0	0	113.2	I70 E71 K72	I70-S74 WeakPolarHBondContact O-CB 3.33Å; I70-S74 PolarHBondContact O-N 3.44Å; I70-S74 PolarHBondContact O-OG 2.9Å; E71-S74 WeakPolarHBondContact CA-OG 3.41Å; E71-S74 PolarHBondContact O-N 3.23Å; E71-S74 PolarHBondContact O-OG 2.73Å; K72-S74 VanDerWaalsContact C-N 3.31Å; K72-S74 PolarHBondContact O-N 2.75Å
75	S	80.7	Confident	77.2	Confident	89 Å²	89	126.7 Å²	126.7	62%	0.622	66%	0.663	S	S	*	*	H	α-helix	trans	-78.5	-21.4	176.9	71.7	0	0	0	0	113.4	E71 K72 V73 E77	E71-S75 WeakPolarHBondContact O-CB 3.42Å; E71-S75 PolarHBondContact O-N 3.27Å; E71-S75 PolarHBondContact O-OG 2.83Å; K72-S75 WeakPolarHBondContact CA-OG 3.46Å; K72-S75 PolarHBondContact O-N 3.38Å; K72-S75 PolarHBondContact O-OG 2.83Å; V73-S75 VanDerWaalsContact C-N 3.3Å; V73-S75 PolarHBondContact O-N 3.4Å; S75-E77 PolarHBondContact O-N 3.06Å
76	C	72.4	Confident	75.2	Confident	96 Å²	96	134.9 Å²	134.9	65%	0.649	70%	0.696	S	S	*	*			trans	-81.2	71.6	171.2	-69.2	0	0	0	0	109.2	K72 V73	K72-C76 PolarHBondContact O-N 3.04Å; K72-C76 PolarHBondContact O-SG 2.7Å; K72-C76 VanDerWaalsContact O-SG 3.41Å; V73-C76 PolarHBondContact O-N 2.89Å
77	E	67.8	Low	74.3	Confident	164 Å²	164	135.7 Å²	135.7	77%	0.766	70%	0.703	S	S	*	*			trans	-52.3	139.8	155.1	-80.8	-165.8	160.5	0	0	108.1	S75 R79	S75-E77 PolarHBondContact O-N 3.06Å; E77-R79 PolarHBondContact O-N 2.87Å
78	P	65	Low	73.2	Confident	120 Å²	120	136 Å²	136	78%	0.779	71%	0.71	S	S	*	*			trans	-57.7	114.7	174.2	25.2	-31.4	0	0	0	105.8	S80	P78-S80 PolarHBondContact O-N 3.03Å
79	R	63.8	Low	72.2	Confident	234 Å²	234	137.8 Å²	137.8	88%	0.883	72%	0.722	S	S	*	*			trans	-55.3	100.3	168.9	-70.4	-175.5	-177.8	-156	0.8	104.8	E77 L81	E77-R79 PolarHBondContact O-N 2.87Å; R79-L81 VanDerWaalsContact C-N 3.28Å; R79-L81 PolarHBondContact O-N 2.76Å
80	S	61.5	Low	71.1	Confident	102 Å²	102	142.8 Å²	142.8	71%	0.713	74%	0.74	S	S	*	*			trans	-56	108.1	165.9	48.4	0	0	0	0	103.3	P78 K82	P78-S80 PolarHBondContact O-N 3.03Å; S80-K82 VanDerWaalsContact C-N 3.29Å; S80-K82 PolarHBondContact O-N 2.8Å
81	L	62.3	Low	69.9	Low	156 Å²	156	144.3 Å²	144.3	82%	0.817	75%	0.748	S	S	*	*			trans	-52.7	107.7	172.2	-68.2	166.8	0	0	0	103.5	R79 I83	R79-L81 VanDerWaalsContact C-N 3.28Å; R79-L81 PolarHBondContact O-N 2.76Å; L81-I83 PolarHBondContact O-N 2.84Å
82	K	61.8	Low	68.6	Low	190 Å²	190	147.6 Å²	147.6	83%	0.826	77%	0.768	S	S	*	*			trans	-63.9	93.8	167.3	-75.6	-174.4	179	-178.2	0	103.3	S80 V84	S80-K82 VanDerWaalsContact C-N 3.29Å; S80-K82 PolarHBondContact O-N 2.8Å; K82-V84 PolarHBondContact O-N 3.23Å
83	I	66.2	Low	67.3	Low	145 Å²	145	148.2 Å²	148.2	74%	0.744	78%	0.779	S	S	*	*			trans	-59.4	101	166.7	-60.5	173.6	0	0	0	103	L81 K85	L81-I83 PolarHBondContact O-N 2.84Å; I83-K85 VanDerWaalsContact C-N 3.28Å; I83-K85 PolarHBondContact O-N 3.35Å
84	V	67.1	Low	66.2	Low	128 Å²	128	151 Å²	151	78%	0.776	79%	0.787	S	S	*	*			trans	-63.9	101.6	170.3	-179.1	0	0	0	0	103.4	K82 E86	K82-V84 PolarHBondContact O-N 3.23Å; V84-E86 PolarHBondContact O-N 2.93Å
85	K	58.2	Low	65	Low	189 Å²	189	156.3 Å²	156.3	82%	0.822	80%	0.802	S	S	*	*			trans	-65.4	125.1	167.8	-78.1	-173	173.8	-175.6	0	106.2	I83	I83-K85 VanDerWaalsContact C-N 3.28Å; I83-K85 PolarHBondContact O-N 3.35Å
86	E	53.1	Low	63.6	Low	263 Å²	263	162.5 Å²	162.5	100%	1.229	82%	0.818	S	S	*	*			trans	-45.8	0	170.6	-64.4	175.9	150.6	0	0	112.6	V84	V84-E86 PolarHBondContact O-N 2.93Å

Retrieved 86 of 86 residues in 28.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).