A0A3Q0KJH5_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KJH5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 94 aa.

						>A0A3Q0KJH5_SCHMA|A0A3Q0KJH5
MKFLLGLSLLVLVTLVCVEATPEVGDEMLLKRMVLDTADKLKMLTLKHIAACRNKVQTYFREDDLGEKIADVLVVLLKRLNKRLENCLKSSNLE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	68.9	Low	205 Å²	205	124.4 Å²	124.4	100%	1.01	65%	0.654	S	S	*	*				0	-41.7	0	-59.5	-157.7	-179.6	0	0	113.7	F3 L4 L5	M1-F3 VanDerWaalsContact C-N 3.31Å; M1-F3 PolarHBondContact O-N 3.08Å; M1-L4 PolarHBondContact O-N 2.7Å; M1-L5 PolarHBondContact O-N 3.44Å
2	K	64.1	Low	69.4	Low	189 Å²	189	123.2 Å²	123.2	82%	0.822	65%	0.647	S	S	*	*	H	α-helix	trans	-57.5	-35.3	178.8	-66.7	175.1	173.1	169.8	0	114.8	L5 G6	K2-L5 PolarHBondContact O-N 3.21Å; K2-G6 PolarHBondContact O-N 3.31Å; K2-G6 VanDerWaalsContact O-N 3.11Å
3	F	57.2	Low	69.8	Low	192 Å²	192	119.8 Å²	119.8	84%	0.842	63%	0.634	S	S	*	*	H	α-helix	trans	-67.3	-37.9	178.2	-88	-83.2	0	0	0	114.2	M1 L5 G6 L7	M1-F3 VanDerWaalsContact C-N 3.31Å; M1-F3 PolarHBondContact O-N 3.08Å; F3-L5 VanDerWaalsContact C-N 3.34Å; F3-G6 PolarHBondContact O-N 3Å; F3-L7 PolarHBondContact O-N 3.33Å
4	L	71.8	Confident	70	Confident	130 Å²	130	116.5 Å²	116.5	68%	0.681	62%	0.621	S	S	*	*	H	α-helix	trans	-66.4	-39.1	177.9	-73.2	166.6	0	0	0	111.2	M1 L7 S8	M1-L4 PolarHBondContact O-N 2.7Å; L4-L7 PolarHBondContact O-N 3.48Å; L4-S8 VanDerWaalsContact O-CB 3.27Å; L4-S8 WeakPolarHBondContact O-CB 3.39Å; L4-S8 PolarHBondContact O-N 2.94Å
5	L	68.7	Low	70.2	Confident	123 Å²	123	115.5 Å²	115.5	64%	0.644	62%	0.615	S	S	*	*	H	α-helix	trans	-60.9	-45.6	172.4	-102.1	152.8	0	0	0	111.7	M1 K2 F3 S8 L9	M1-L5 PolarHBondContact O-N 3.44Å; K2-L5 PolarHBondContact O-N 3.21Å; F3-L5 VanDerWaalsContact C-N 3.34Å; L5-S8 PolarHBondContact O-N 2.84Å; L5-L9 WeakPolarHBondContact O-CB 3.29Å; L5-L9 PolarHBondContact O-N 3.12Å
6	G	73.5	Confident	70.1	Confident	45 Å²	45	113.6 Å²	113.6	46%	0.464	61%	0.609	S	S	.	*	H	α-helix	trans	-62.4	-41.9	176.3	0	0	0	0	0	113.1	K2 F3 L9 L10	K2-G6 PolarHBondContact O-N 3.31Å; K2-G6 VanDerWaalsContact O-N 3.11Å; F3-G6 PolarHBondContact O-N 3Å; G6-L9 PolarHBondContact O-N 3.38Å; G6-L10 WeakPolarHBondContact O-CB 3.42Å; G6-L10 PolarHBondContact O-N 3.41Å
7	L	73.4	Confident	69.6	Low	110 Å²	110	112.1 Å²	112.1	58%	0.576	61%	0.608	S	S	*	*	H	α-helix	trans	-67.4	-43	177.4	-164.9	73.4	0	0	0	111.7	F3 L4 L9 L10 V11	F3-L7 PolarHBondContact O-N 3.33Å; L4-L7 PolarHBondContact O-N 3.48Å; L7-L9 VanDerWaalsContact C-N 3.34Å; L7-L9 PolarHBondContact O-N 3.5Å; L7-L10 PolarHBondContact O-N 3.42Å; L7-V11 WeakPolarHBondContact O-CG2 3.36Å; L7-V11 PolarHBondContact O-N 3.21Å
8	S	72.2	Confident	69.3	Low	71 Å²	71	112.3 Å²	112.3	50%	0.497	61%	0.614	S	S	.	*	H	α-helix	trans	-60.3	-43	174.9	167.1	0	0	0	0	111.7	L4 L5 V11 L12	L4-S8 VanDerWaalsContact O-CB 3.27Å; L4-S8 WeakPolarHBondContact O-CB 3.39Å; L4-S8 PolarHBondContact O-N 2.94Å; L5-S8 PolarHBondContact O-N 2.84Å; S8-V11 PolarHBondContact O-N 3.11Å; S8-L12 PolarHBondContact O-N 3.22Å
9	L	76.1	Confident	68.7	Low	114 Å²	114	114.3 Å²	114.3	60%	0.597	62%	0.618	S	S	*	*	H	α-helix	trans	-64.6	-42.1	177.1	-148.2	94.7	0	0	0	111.3	L5 G6 L7 L12 V13	L5-L9 WeakPolarHBondContact O-CB 3.29Å; L5-L9 PolarHBondContact O-N 3.12Å; G6-L9 PolarHBondContact O-N 3.38Å; L7-L9 VanDerWaalsContact C-N 3.34Å; L7-L9 PolarHBondContact O-N 3.5Å; L9-L12 PolarHBondContact O-N 3.1Å; L9-V13 VanDerWaalsContact O-CG2 3.29Å; L9-V13 WeakPolarHBondContact O-CG2 3.21Å; L9-V13 PolarHBondContact O-N 2.88Å
10	L	76.5	Confident	68	Low	105 Å²	105	111.6 Å²	111.6	55%	0.55	61%	0.612	S	S	.	*	H	α-helix	trans	-60.8	-45.2	177	-174.1	71	0	0	0	111.3	G6 L7 L12 V13 T14	G6-L10 WeakPolarHBondContact O-CB 3.42Å; G6-L10 PolarHBondContact O-N 3.41Å; L7-L10 PolarHBondContact O-N 3.42Å; L10-L12 VanDerWaalsContact C-N 3.34Å; L10-L12 PolarHBondContact O-N 3.22Å; L10-V13 PolarHBondContact O-N 3.17Å; L10-T14 WeakPolarHBondContact O-CG2 3.14Å; L10-T14 PolarHBondContact O-N 3.04Å; L10-T14 PolarHBondContact O-OG1 2.79Å
11	V	76.2	Confident	67.4	Low	84 Å²	84	112 Å²	112	51%	0.509	62%	0.618	S	S	.	*	H	α-helix	trans	-61.7	-43.5	176.5	172.9	0	0	0	0	110.8	L7 S8 V13 T14 L15	L7-V11 WeakPolarHBondContact O-CG2 3.36Å; L7-V11 PolarHBondContact O-N 3.21Å; S8-V11 PolarHBondContact O-N 3.11Å; V11-V13 PolarHBondContact O-N 3.4Å; V11-T14 WeakPolarHBondContact CA-OG1 3.21Å; V11-T14 PolarHBondContact O-N 3Å; V11-T14 PolarHBondContact O-OG1 2.77Å; V11-L15 WeakPolarHBondContact O-CB 3.41Å; V11-L15 PolarHBondContact O-N 3.43Å
12	L	74.6	Confident	67.7	Low	110 Å²	110	104.7 Å²	104.7	58%	0.576	59%	0.586	S	S	*	*	H	α-helix	trans	-61.3	-45	178.2	-142.1	102.7	0	0	0	111.4	S8 L9 L10 L15 V16	S8-L12 PolarHBondContact O-N 3.22Å; L9-L12 PolarHBondContact O-N 3.1Å; L10-L12 VanDerWaalsContact C-N 3.34Å; L10-L12 PolarHBondContact O-N 3.22Å; L12-L15 PolarHBondContact O-N 3.14Å; L12-V16 VanDerWaalsContact O-CG2 3.29Å; L12-V16 WeakPolarHBondContact O-CG2 3.05Å; L12-V16 PolarHBondContact O-N 3.35Å
13	V	75.2	Confident	67.3	Low	79 Å²	79	103.9 Å²	103.9	48%	0.479	59%	0.585	S	S	.	*	H	α-helix	trans	-62.6	-43.9	176.8	172	0	0	0	0	110.7	L9 L10 V11 L15 V16 C17	L9-V13 VanDerWaalsContact O-CG2 3.29Å; L9-V13 WeakPolarHBondContact O-CG2 3.21Å; L9-V13 PolarHBondContact O-N 2.88Å; L10-V13 PolarHBondContact O-N 3.17Å; V11-V13 PolarHBondContact O-N 3.4Å; V13-L15 VanDerWaalsContact C-N 3.33Å; V13-L15 PolarHBondContact O-N 3.21Å; V13-V16 PolarHBondContact O-N 3.49Å; V13-C17 WeakPolarHBondContact O-CB 3.39Å; V13-C17 PolarHBondContact O-N 2.74Å; V13-C17 PolarHBondContact O-SG 3.34Å
14	T	71.8	Confident	67.3	Low	74 Å²	74	101 Å²	101	45%	0.454	58%	0.583	S	S	.	*	H	α-helix	trans	-65.2	-36.1	177.1	53	0	0	0	0	112.6	L10 V11 C17 V18	L10-T14 WeakPolarHBondContact O-CG2 3.14Å; L10-T14 PolarHBondContact O-N 3.04Å; L10-T14 PolarHBondContact O-OG1 2.79Å; V11-T14 WeakPolarHBondContact CA-OG1 3.21Å; V11-T14 PolarHBondContact O-N 3Å; V11-T14 PolarHBondContact O-OG1 2.77Å; T14-C17 PolarHBondContact O-N 3.41Å; T14-V18 WeakPolarHBondContact O-CG2 3.34Å; T14-V18 PolarHBondContact O-N 3.37Å
15	L	74.2	Confident	66.7	Low	101 Å²	101	98.6 Å²	98.6	53%	0.529	59%	0.589	S	S	.	*	H	α-helix	trans	-66	-47.7	177.6	-157.8	89.6	0	0	0	110.8	V11 L12 V13 C17 V18 E19	V11-L15 WeakPolarHBondContact O-CB 3.41Å; V11-L15 PolarHBondContact O-N 3.43Å; L12-L15 PolarHBondContact O-N 3.14Å; V13-L15 VanDerWaalsContact C-N 3.33Å; V13-L15 PolarHBondContact O-N 3.21Å; L15-C17 VanDerWaalsContact C-N 3.33Å; L15-C17 PolarHBondContact O-N 2.8Å; L15-V18 PolarHBondContact O-N 2.8Å; L15-V18 VanDerWaalsContact O-N 3.12Å; L15-E19 PolarHBondContact O-N 3.47Å
16	V	68.6	Low	66.3	Low	85 Å²	85	96.6 Å²	96.6	52%	0.515	58%	0.579	S	S	.	*	H	α-helix	trans	-62.9	-39.6	177.3	172.9	0	0	0	0	111.2	L12 V13 V18 A20	L12-V16 VanDerWaalsContact O-CG2 3.29Å; L12-V16 WeakPolarHBondContact O-CG2 3.05Å; L12-V16 PolarHBondContact O-N 3.35Å; V13-V16 PolarHBondContact O-N 3.49Å; V16-V18 VanDerWaalsContact C-N 3.3Å; V16-V18 PolarHBondContact O-N 2.87Å; V16-A20 WeakPolarHBondContact O-CB 3.17Å; V16-A20 PolarHBondContact O-N 3.42Å
17	C	61.7	Low	65.9	Low	89 Å²	89	98.4 Å²	98.4	60%	0.601	58%	0.576	S	S	*	*	H	α-helix	trans	-68	-26.2	175.2	-73.1	0	0	0	0	113.7	V13 T14 L15	V13-C17 WeakPolarHBondContact O-CB 3.39Å; V13-C17 PolarHBondContact O-N 2.74Å; V13-C17 PolarHBondContact O-SG 3.34Å; T14-C17 PolarHBondContact O-N 3.41Å; L15-C17 VanDerWaalsContact C-N 3.33Å; L15-C17 PolarHBondContact O-N 2.8Å
18	V	62.9	Low	65.6	Low	116 Å²	116	100.9 Å²	100.9	70%	0.703	59%	0.586	S	S	*	*	H	α-helix	trans	-80.5	-39.7	176.2	167.9	0	0	0	0	111.3	T14 L15 V16	T14-V18 WeakPolarHBondContact O-CG2 3.34Å; T14-V18 PolarHBondContact O-N 3.37Å; L15-V18 PolarHBondContact O-N 2.8Å; L15-V18 VanDerWaalsContact O-N 3.12Å; V16-V18 VanDerWaalsContact C-N 3.3Å; V16-V18 PolarHBondContact O-N 2.87Å
19	E	59	Low	65.5	Low	149 Å²	149	102.3 Å²	102.3	70%	0.696	59%	0.588	S	S	*	*	H	α-helix	trans	-73.2	-30.2	176.7	-75	-176.6	171.4	0	0	112.8	L15 T21	L15-E19 PolarHBondContact O-N 3.47Å; E19-T21 PolarHBondContact O-N 3.46Å; E19-T21 PolarHBondContact O-OG1 3.31Å
20	A	55	Low	65.2	Low	60 Å²	60	100 Å²	100	50%	0.496	58%	0.576	S	S	.	*			trans	-75.5	65.6	171.7	0	0	0	0	0	110.8	V16 P22	V16-A20 WeakPolarHBondContact O-CB 3.17Å; V16-A20 PolarHBondContact O-N 3.42Å; A20-P22 WeakPolarHBondContact O-CD 3.32Å; A20-P22 VanDerWaalsContact O-N 3.16Å
21	T	54.8	Low	65.2	Low	120 Å²	120	101 Å²	101	74%	0.736	58%	0.576	S	S	*	*			trans	-58.6	112.7	162.2	-0.7	0	0	0	0	107.9	E19	E19-T21 PolarHBondContact O-N 3.46Å; E19-T21 PolarHBondContact O-OG1 3.31Å
22	P	53.4	Low	65.2	Low	53 Å²	53	105.9 Å²	105.9	34%	0.344	59%	0.585	S	S	.	*			trans	-76	134.4	-174.4	30.5	-33.2	0	0	0	110.8	A20 L30	A20-P22 WeakPolarHBondContact O-CD 3.32Å; A20-P22 VanDerWaalsContact O-N 3.16Å; P22-L30 HydrophobicContact CB-CD1 3.09Å; P22-L30 HydrophobicContact CG-CD1 3.71Å
23	E	56.5	Low	65.3	Low	171 Å²	171	105.8 Å²	105.8	80%	0.799	58%	0.583	S	S	*	*			trans	-58.3	139.7	173	-63.6	-157.8	161.9	0	0	110.3	G25 D26	E23-G25 PolarHBondContact O-N 2.96Å; E23-D26 PolarHBondContact O-N 3.39Å
24	V	57.2	Low	65.3	Low	133 Å²	133	106.6 Å²	106.6	81%	0.806	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54	-12.2	-163.6	179.1	0	0	0	0	115
25	G	59.9	Low	65.5	Low	78 Å²	78	108.1 Å²	108.1	80%	0.804	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.1	-24.2	174.5	0	0	0	0	0	115.8	E23	E23-G25 PolarHBondContact O-N 2.96Å
26	D	59.9	Low	65.9	Low	82 Å²	82	107 Å²	107	44%	0.439	59%	0.587	S	S	.	*	S	Bend	trans	-102.2	-1.4	-170	-128.6	-14.3	0	0	0	113.5	E23 M28 L29 L30	E23-D26 PolarHBondContact O-N 3.39Å; D26-M28 VanDerWaalsContact C-N 3.29Å; D26-M28 PolarHBondContact O-N 3.27Å; D26-L29 PolarHBondContact O-N 2.87Å; D26-L29 WeakPolarHBondContact OD1-CD1 3.18Å; D26-L30 HydrophobicContact CB-CD1 4.31Å; D26-L30 WeakPolarHBondContact O-CB 3.08Å; D26-L30 PolarHBondContact O-N 2.96Å
27	E	64.7	Low	66.2	Low	82 Å²	82	107.2 Å²	107.2	38%	0.383	59%	0.589	S	S	.	*	H	α-helix	trans	-58.5	-38	-176.5	-68.8	-158.8	147.4	0	0	113.3	K31	E27-K31 VanDerWaalsContact O-CB 3.25Å; E27-K31 WeakPolarHBondContact O-CB 3.09Å; E27-K31 WeakPolarHBondContact O-CG 3.29Å; E27-K31 PolarHBondContact O-N 3.43Å; E27-K31 IonicContact OE2-NZ 3.11Å
28	M	66.3	Low	66.9	Low	163 Å²	163	104.7 Å²	104.7	80%	0.803	57%	0.574	S	S	*	*	H	α-helix	trans	-69.3	-39	-179.9	-80.5	-122.4	-75.9	0	0	112	D26 R32	D26-M28 VanDerWaalsContact C-N 3.29Å; D26-M28 PolarHBondContact O-N 3.27Å; M28-R32 WeakPolarHBondContact O-CB 3.5Å; M28-R32 PolarHBondContact O-N 2.93Å
29	L	71.4	Confident	67.5	Low	101 Å²	101	102.9 Å²	102.9	53%	0.529	56%	0.561	S	S	.	*	H	α-helix	trans	-69.9	-42.2	176.6	-73.4	176.9	0	0	0	110.7	D26 R32 M33	D26-L29 PolarHBondContact O-N 2.87Å; D26-L29 WeakPolarHBondContact OD1-CD1 3.18Å; L29-R32 PolarHBondContact O-N 2.92Å; L29-M33 HydrophobicContact CB-CE 4.48Å; L29-M33 WeakPolarHBondContact O-CB 3.25Å; L29-M33 WeakPolarHBondContact O-CG 3.35Å; L29-M33 PolarHBondContact O-N 2.79Å
30	L	69.9	Low	68.5	Low	64 Å²	64	101.6 Å²	101.6	34%	0.335	55%	0.552	S	S	.	*	H	α-helix	trans	-64.2	-45.4	174.9	-75.6	164.6	0	0	0	112.3	P22 D26 R32 M33 V34	P22-L30 HydrophobicContact CB-CD1 3.09Å; P22-L30 HydrophobicContact CG-CD1 3.71Å; D26-L30 HydrophobicContact CB-CD1 4.31Å; D26-L30 WeakPolarHBondContact O-CB 3.08Å; D26-L30 PolarHBondContact O-N 2.96Å; L30-R32 VanDerWaalsContact C-N 3.28Å; L30-R32 PolarHBondContact O-N 3.18Å; L30-M33 HydrophobicContact CD2-CE 3.89Å; L30-M33 HydrophobicContact CG-CE 4.28Å; L30-M33 PolarHBondContact O-N 3.42Å; L30-V34 WeakPolarHBondContact O-CB 3.14Å; L30-V34 WeakPolarHBondContact O-CG2 3.21Å; L30-V34 PolarHBondContact O-N 2.76Å
31	K	76	Confident	69.4	Low	127 Å²	127	104 Å²	104	55%	0.552	56%	0.556	S	S	*	*	H	α-helix	trans	-57.9	-42.5	174.3	-77.5	171.4	-177	165.6	0	111.2	E27 L35	E27-K31 VanDerWaalsContact O-CB 3.25Å; E27-K31 WeakPolarHBondContact O-CB 3.09Å; E27-K31 WeakPolarHBondContact O-CG 3.29Å; E27-K31 PolarHBondContact O-N 3.43Å; E27-K31 IonicContact OE2-NZ 3.11Å; K31-L35 VanDerWaalsContact O-CB 3.32Å; K31-L35 WeakPolarHBondContact O-CB 3.35Å; K31-L35 WeakPolarHBondContact O-CD1 3.19Å; K31-L35 VanDerWaalsContact O-CG 3.28Å; K31-L35 WeakPolarHBondContact O-CG 3.29Å; K31-L35 PolarHBondContact O-N 3.31Å
32	R	76.7	Confident	70.4	Confident	187 Å²	187	103.8 Å²	103.8	71%	0.706	55%	0.545	S	S	*	.	H	α-helix	trans	-66.1	-44	176.9	-173.4	175	-74.5	-168	-2.6	112.1	M28 L29 L30 L35 D36	M28-R32 WeakPolarHBondContact O-CB 3.5Å; M28-R32 PolarHBondContact O-N 2.93Å; L29-R32 PolarHBondContact O-N 2.92Å; L30-R32 VanDerWaalsContact C-N 3.28Å; L30-R32 PolarHBondContact O-N 3.18Å; R32-L35 PolarHBondContact O-N 3.48Å; R32-D36 WeakPolarHBondContact O-CB 3.31Å; R32-D36 PolarHBondContact O-N 2.86Å
33	M	76.1	Confident	71.5	Confident	108 Å²	108	108 Å²	108	53%	0.532	56%	0.562	S	S	.	*	H	α-helix	trans	-64.7	-41.1	176.6	-75.5	-170	-76.2	0	0	112	L29 L30 T37	L29-M33 HydrophobicContact CB-CE 4.48Å; L29-M33 WeakPolarHBondContact O-CB 3.25Å; L29-M33 WeakPolarHBondContact O-CG 3.35Å; L29-M33 PolarHBondContact O-N 2.79Å; L30-M33 HydrophobicContact CD2-CE 3.89Å; L30-M33 HydrophobicContact CG-CE 4.28Å; L30-M33 PolarHBondContact O-N 3.42Å; M33-T37 WeakPolarHBondContact O-CB 3.23Å; M33-T37 PolarHBondContact O-N 2.75Å; M33-T37 PolarHBondContact O-OG1 3.49Å
34	V	74.9	Confident	72.3	Confident	96 Å²	96	104.4 Å²	104.4	58%	0.582	55%	0.548	S	S	*	.	H	α-helix	trans	-65.4	-44.1	176.2	170.3	0	0	0	0	110.5	L30 T37 A38	L30-V34 WeakPolarHBondContact O-CB 3.14Å; L30-V34 WeakPolarHBondContact O-CG2 3.21Å; L30-V34 PolarHBondContact O-N 2.76Å; V34-T37 PolarHBondContact O-N 2.81Å; V34-A38 WeakPolarHBondContact O-CB 3.33Å; V34-A38 PolarHBondContact O-N 2.87Å
35	L	76.9	Confident	72.9	Confident	105 Å²	105	101.2 Å²	101.2	55%	0.55	53%	0.529	S	S	.	.	H	α-helix	trans	-62.7	-47.7	176.1	-79	164.7	0	0	0	111.8	K31 R32 T37 A38 D39	K31-L35 VanDerWaalsContact O-CB 3.32Å; K31-L35 WeakPolarHBondContact O-CB 3.35Å; K31-L35 WeakPolarHBondContact O-CD1 3.19Å; K31-L35 VanDerWaalsContact O-CG 3.28Å; K31-L35 WeakPolarHBondContact O-CG 3.29Å; K31-L35 PolarHBondContact O-N 3.31Å; R32-L35 PolarHBondContact O-N 3.48Å; L35-T37 VanDerWaalsContact C-N 3.33Å; L35-T37 PolarHBondContact O-N 3.43Å; L35-A38 PolarHBondContact O-N 3.06Å; L35-D39 WeakPolarHBondContact O-CB 3.34Å; L35-D39 PolarHBondContact O-N 3.45Å
36	D	81.6	Confident	73.5	Confident	79 Å²	79	103 Å²	103	42%	0.422	52%	0.52	S	S	.	.	H	α-helix	trans	-65.2	-38.4	179	-171.8	40.3	0	0	0	111.6	R32 D39 K40	R32-D36 WeakPolarHBondContact O-CB 3.31Å; R32-D36 PolarHBondContact O-N 2.86Å; D36-D39 PolarHBondContact O-N 3.46Å; D36-K40 WeakPolarHBondContact O-CB 3.43Å; D36-K40 WeakPolarHBondContact O-CG 3.46Å; D36-K40 PolarHBondContact O-N 2.72Å; D36-K40 IonicContact OD1-NZ 3.72Å; D36-K40 IonicContact OD2-NZ 2.72Å; D36-K40 PolarHBondContact OD2-NZ 3.26Å
37	T	76.5	Confident	74.2	Confident	89 Å²	89	106.6 Å²	106.6	55%	0.546	53%	0.531	S	S	.	.	H	α-helix	trans	-67.8	-41.6	174.5	-56.2	0	0	0	0	111.2	M33 V34 L35 K40 L41	M33-T37 WeakPolarHBondContact O-CB 3.23Å; M33-T37 PolarHBondContact O-N 2.75Å; M33-T37 PolarHBondContact O-OG1 3.49Å; V34-T37 PolarHBondContact O-N 2.81Å; L35-T37 VanDerWaalsContact C-N 3.33Å; L35-T37 PolarHBondContact O-N 3.43Å; T37-K40 PolarHBondContact O-N 2.84Å; T37-L41 VanDerWaalsContact O-CB 3.22Å; T37-L41 WeakPolarHBondContact O-CB 3.3Å; T37-L41 PolarHBondContact O-N 3.28Å
38	A	74.5	Confident	74.5	Confident	35 Å²	35	108.7 Å²	108.7	29%	0.289	54%	0.541	S	S	.	.	H	α-helix	trans	-64.8	-39.7	176.7	0	0	0	0	0	111.3	V34 L35 L41 K42	V34-A38 WeakPolarHBondContact O-CB 3.33Å; V34-A38 PolarHBondContact O-N 2.87Å; L35-A38 PolarHBondContact O-N 3.06Å; A38-L41 PolarHBondContact O-N 3.4Å; A38-K42 WeakPolarHBondContact O-CB 3.34Å; A38-K42 WeakPolarHBondContact O-CG 3.4Å; A38-K42 PolarHBondContact O-N 2.83Å
39	D	76.7	Confident	74.7	Confident	79 Å²	79	105.6 Å²	105.6	42%	0.422	53%	0.526	S	S	.	.	H	α-helix	trans	-72.5	-38.1	178.1	-73.8	-22.2	0	0	0	112	L35 D36 K42 M43	L35-D39 WeakPolarHBondContact O-CB 3.34Å; L35-D39 PolarHBondContact O-N 3.45Å; D36-D39 PolarHBondContact O-N 3.46Å; D39-K42 PolarHBondContact O-N 3.29Å; D39-K42 IonicContact OD1-NZ 3.55Å; D39-K42 PolarHBondContact OD1-NZ 2.92Å; D39-K42 VanDerWaalsContact OD1-NZ 3.11Å; D39-M43 WeakPolarHBondContact O-CB 3.19Å; D39-M43 PolarHBondContact O-N 2.67Å
40	K	78.9	Confident	74.7	Confident	121 Å²	121	103.1 Å²	103.1	53%	0.526	52%	0.52	S	S	.	.	H	α-helix	trans	-62.2	-43.7	169	-77.5	168.6	179.6	158.6	0	111.8	D36 T37 M43 L44	D36-K40 WeakPolarHBondContact O-CB 3.43Å; D36-K40 WeakPolarHBondContact O-CG 3.46Å; D36-K40 PolarHBondContact O-N 2.72Å; D36-K40 IonicContact OD1-NZ 3.72Å; D36-K40 IonicContact OD2-NZ 2.72Å; D36-K40 PolarHBondContact OD2-NZ 3.26Å; T37-K40 PolarHBondContact O-N 2.84Å; K40-M43 PolarHBondContact O-N 3.3Å; K40-L44 WeakPolarHBondContact O-CB 3.35Å; K40-L44 VanDerWaalsContact O-CG 3.29Å; K40-L44 WeakPolarHBondContact O-CG 3.45Å; K40-L44 PolarHBondContact O-N 2.75Å
41	L	74.7	Confident	74.8	Confident	110 Å²	110	102.6 Å²	102.6	58%	0.576	53%	0.525	S	S	*	.	H	α-helix	trans	-64.5	-42.8	176.8	-166.8	89.6	0	0	0	110.9	T37 A38 L44 T45	T37-L41 VanDerWaalsContact O-CB 3.22Å; T37-L41 WeakPolarHBondContact O-CB 3.3Å; T37-L41 PolarHBondContact O-N 3.28Å; A38-L41 PolarHBondContact O-N 3.4Å; L41-L44 PolarHBondContact O-N 3.39Å; L41-T45 WeakPolarHBondContact O-CB 3.29Å; L41-T45 PolarHBondContact O-N 2.88Å; L41-T45 PolarHBondContact O-OG1 3.48Å
42	K	75.5	Confident	74.4	Confident	117 Å²	117	100 Å²	100	51%	0.509	52%	0.523	S	S	.	.	H	α-helix	trans	-59.7	-47	173.2	-78.3	171.9	-169	161.8	0	110.6	A38 D39 L44 T45 L46	A38-K42 WeakPolarHBondContact O-CB 3.34Å; A38-K42 WeakPolarHBondContact O-CG 3.4Å; A38-K42 PolarHBondContact O-N 2.83Å; D39-K42 PolarHBondContact O-N 3.29Å; D39-K42 IonicContact OD1-NZ 3.55Å; D39-K42 PolarHBondContact OD1-NZ 2.92Å; D39-K42 VanDerWaalsContact OD1-NZ 3.11Å; K42-L44 PolarHBondContact O-N 2.78Å; K42-T45 PolarHBondContact O-N 3.21Å; K42-L46 VanDerWaalsContact O-CB 3.3Å; K42-L46 WeakPolarHBondContact O-CB 3.22Å; K42-L46 VanDerWaalsContact O-CG 3.23Å; K42-L46 WeakPolarHBondContact O-CG 3.35Å; K42-L46 PolarHBondContact O-N 3.5Å
43	M	76.8	Confident	74	Confident	140 Å²	140	99.5 Å²	99.5	69%	0.69	52%	0.52	S	S	*	.	H	α-helix	trans	-63.2	-42.8	179.5	-168.8	-177.1	-68.6	0	0	111.5	D39 K40 K47	D39-M43 WeakPolarHBondContact O-CB 3.19Å; D39-M43 PolarHBondContact O-N 2.67Å; K40-M43 PolarHBondContact O-N 3.3Å; M43-K47 WeakPolarHBondContact O-CB 3.4Å; M43-K47 PolarHBondContact O-N 3.24Å
44	L	72.7	Confident	73.7	Confident	96 Å²	96	99 Å²	99	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-63.1	-47.3	173.4	-73	173.9	0	0	0	111	K40 L41 K42 L46 K47 H48	K40-L44 WeakPolarHBondContact O-CB 3.35Å; K40-L44 VanDerWaalsContact O-CG 3.29Å; K40-L44 WeakPolarHBondContact O-CG 3.45Å; K40-L44 PolarHBondContact O-N 2.75Å; L41-L44 PolarHBondContact O-N 3.39Å; K42-L44 PolarHBondContact O-N 2.78Å; L44-L46 PolarHBondContact O-N 2.84Å; L44-K47 PolarHBondContact O-N 3.42Å; L44-H48 PolarHBondContact O-N 3.4Å; L44-H48 PolarHBondContact O-ND1 2.72Å
45	T	69.8	Low	73.4	Confident	66 Å²	66	101.2 Å²	101.2	41%	0.405	52%	0.522	S	S	.	.	H	α-helix	trans	-61.7	-43.9	179.5	-57.8	0	0	0	0	110.6	L41 K42 K47 H48 I49	L41-T45 WeakPolarHBondContact O-CB 3.29Å; L41-T45 PolarHBondContact O-N 2.88Å; L41-T45 PolarHBondContact O-OG1 3.48Å; K42-T45 PolarHBondContact O-N 3.21Å; T45-K47 PolarHBondContact O-N 3.44Å; T45-H48 PolarHBondContact O-N 3.04Å; T45-I49 HydrophobicContact CG2-CD1 3.68Å; T45-I49 HydrophobicContact CG2-CG1 4.26Å; T45-I49 VanDerWaalsContact O-CB 3.31Å; T45-I49 WeakPolarHBondContact O-CB 3.45Å; T45-I49 WeakPolarHBondContact O-CG1 3.41Å; T45-I49 PolarHBondContact O-N 3.46Å
46	L	72.9	Confident	72.8	Confident	117 Å²	117	99 Å²	99	61%	0.613	51%	0.513	S	S	*	.	H	α-helix	trans	-62.4	-41.5	174.5	-74.3	171.9	0	0	0	111.8	K42 L44 I49 A50	K42-L46 VanDerWaalsContact O-CB 3.3Å; K42-L46 WeakPolarHBondContact O-CB 3.22Å; K42-L46 VanDerWaalsContact O-CG 3.23Å; K42-L46 WeakPolarHBondContact O-CG 3.35Å; K42-L46 PolarHBondContact O-N 3.5Å; L44-L46 PolarHBondContact O-N 2.84Å; L46-I49 PolarHBondContact O-N 2.91Å; L46-A50 WeakPolarHBondContact O-CB 3.43Å; L46-A50 PolarHBondContact O-N 2.8Å
47	K	74.6	Confident	72	Confident	156 Å²	156	99.3 Å²	99.3	68%	0.678	51%	0.512	S	S	*	.	H	α-helix	trans	-65.1	-41.3	176.3	-167.5	174.8	-177.1	176.2	0	111.8	M43 L44 T45 A51	M43-K47 WeakPolarHBondContact O-CB 3.4Å; M43-K47 PolarHBondContact O-N 3.24Å; L44-K47 PolarHBondContact O-N 3.42Å; T45-K47 PolarHBondContact O-N 3.44Å; K47-A51 VanDerWaalsContact O-CB 3.32Å; K47-A51 WeakPolarHBondContact O-CB 3.36Å; K47-A51 PolarHBondContact O-N 3.04Å
48	H	72	Confident	71.5	Confident	127 Å²	127	98.7 Å²	98.7	59%	0.588	51%	0.508	S	S	*	.	H	α-helix	trans	-68.2	-42.2	175.4	-73.6	82.1	0	0	0	111.7	L44 T45 A51 C52	L44-H48 PolarHBondContact O-N 3.4Å; L44-H48 PolarHBondContact O-ND1 2.72Å; T45-H48 PolarHBondContact O-N 3.04Å; H48-A51 PolarHBondContact O-N 2.81Å; H48-C52 WeakPolarHBondContact O-CB 3.5Å; H48-C52 PolarHBondContact O-N 3.11Å
49	I	70	Confident	70.7	Confident	98 Å²	98	104 Å²	104	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-63.2	-43.4	175	-71.9	170.5	0	0	0	110.1	T45 L46 C52 R53	T45-I49 HydrophobicContact CG2-CD1 3.68Å; T45-I49 HydrophobicContact CG2-CG1 4.26Å; T45-I49 VanDerWaalsContact O-CB 3.31Å; T45-I49 WeakPolarHBondContact O-CB 3.45Å; T45-I49 WeakPolarHBondContact O-CG1 3.41Å; T45-I49 PolarHBondContact O-N 3.46Å; L46-I49 PolarHBondContact O-N 2.91Å; I49-C52 PolarHBondContact O-N 2.83Å; I49-R53 WeakPolarHBondContact O-CB 3.36Å; I49-R53 PolarHBondContact O-N 3.45Å
50	A	72.2	Confident	70	Confident	48 Å²	48	103.7 Å²	103.7	40%	0.397	52%	0.516	S	S	.	.	H	α-helix	trans	-65.3	-43.7	177.9	0	0	0	0	0	111.7	L46 R53 N54	L46-A50 WeakPolarHBondContact O-CB 3.43Å; L46-A50 PolarHBondContact O-N 2.8Å; A50-R53 PolarHBondContact O-N 3.47Å; A50-N54 WeakPolarHBondContact O-CB 3.22Å; A50-N54 VanDerWaalsContact O-CG 3.31Å; A50-N54 PolarHBondContact O-N 3.41Å
51	A	71.5	Confident	69.3	Low	53 Å²	53	107.1 Å²	107.1	44%	0.438	53%	0.526	S	S	.	.	H	α-helix	trans	-64.8	-42.7	175.8	0	0	0	0	0	112	K47 H48 N54 K55	K47-A51 VanDerWaalsContact O-CB 3.32Å; K47-A51 WeakPolarHBondContact O-CB 3.36Å; K47-A51 PolarHBondContact O-N 3.04Å; H48-A51 PolarHBondContact O-N 2.81Å; A51-N54 PolarHBondContact O-N 2.91Å; A51-K55 PolarHBondContact O-N 2.89Å
52	C	68	Low	68.6	Low	74 Å²	74	108.7 Å²	108.7	50%	0.5	53%	0.53	S	S	.	.	H	α-helix	trans	-62.9	-48.5	175.1	-170.1	0	0	0	0	110.2	H48 I49 N54 K55 V56	H48-C52 WeakPolarHBondContact O-CB 3.5Å; H48-C52 PolarHBondContact O-N 3.11Å; I49-C52 PolarHBondContact O-N 2.83Å; C52-N54 VanDerWaalsContact C-N 3.34Å; C52-N54 PolarHBondContact O-N 3.24Å; C52-K55 PolarHBondContact O-N 3.13Å; C52-V56 WeakPolarHBondContact O-CB 3.47Å; C52-V56 WeakPolarHBondContact O-CG2 3.33Å; C52-V56 PolarHBondContact O-N 2.77Å
53	R	68.5	Low	68	Low	175 Å²	175	108.1 Å²	108.1	66%	0.66	53%	0.533	S	S	*	.	H	α-helix	trans	-58.4	-43	177.4	-176.9	176.6	170.2	173.2	-1.3	111.8	I49 A50 V56 Q57	I49-R53 WeakPolarHBondContact O-CB 3.36Å; I49-R53 PolarHBondContact O-N 3.45Å; A50-R53 PolarHBondContact O-N 3.47Å; R53-V56 PolarHBondContact O-N 2.92Å; R53-Q57 WeakPolarHBondContact O-CB 3.39Å; R53-Q57 PolarHBondContact O-N 3.29Å
54	N	69.5	Low	67.2	Low	97 Å²	97	108.4 Å²	108.4	52%	0.519	54%	0.537	S	S	.	.	H	α-helix	trans	-66.3	-43.6	177.1	-75.6	-13.1	0	0	0	112	A50 A51 C52 Q57 T58	A50-N54 WeakPolarHBondContact O-CB 3.22Å; A50-N54 VanDerWaalsContact O-CG 3.31Å; A50-N54 PolarHBondContact O-N 3.41Å; A51-N54 PolarHBondContact O-N 2.91Å; C52-N54 VanDerWaalsContact C-N 3.34Å; C52-N54 PolarHBondContact O-N 3.24Å; N54-Q57 PolarHBondContact O-N 3.45Å; N54-T58 WeakPolarHBondContact O-CB 3.39Å; N54-T58 PolarHBondContact O-N 2.87Å; N54-T58 PolarHBondContact O-OG1 3.08Å
55	K	67.5	Low	66.5	Low	144 Å²	144	107 Å²	107	63%	0.626	53%	0.529	S	S	*	.	H	α-helix	trans	-61.3	-50.4	174.3	-77.8	-173.6	176.4	-174.8	0	111	A51 C52 Q57 T58 Y59	A51-K55 PolarHBondContact O-N 2.89Å; C52-K55 PolarHBondContact O-N 3.13Å; K55-Q57 VanDerWaalsContact C-N 3.32Å; K55-Q57 PolarHBondContact O-N 3.08Å; K55-T58 PolarHBondContact O-N 2.83Å; K55-T58 VanDerWaalsContact O-N 3.1Å; K55-Y59 HydrophobicContact CB-CD2 4.43Å; K55-Y59 WeakPolarHBondContact O-CD2 3.4Å; K55-Y59 PolarHBondContact O-N 3.43Å
56	V	64.7	Low	66	Low	59 Å²	59	105.9 Å²	105.9	36%	0.358	53%	0.531	S	S	.	.	H	α-helix	trans	-59.2	-43.2	179.8	170.4	0	0	0	0	110.9	C52 R53 T58 F60	C52-V56 WeakPolarHBondContact O-CB 3.47Å; C52-V56 WeakPolarHBondContact O-CG2 3.33Å; C52-V56 PolarHBondContact O-N 2.77Å; R53-V56 PolarHBondContact O-N 2.92Å; V56-T58 VanDerWaalsContact C-N 3.35Å; V56-T58 PolarHBondContact O-N 3.21Å; V56-F60 HydrophobicContact CB-CE2 4.38Å; V56-F60 HydrophobicContact CG1-CD2 3.4Å; V56-F60 VanDerWaalsContact CG1-CD2 3.4Å; V56-F60 HydrophobicContact CG1-CE2 3.03Å; V56-F60 HydrophobicContact CG1-CZ 3.94Å; V56-F60 WeakPolarHBondContact O-CB 3.14Å; V56-F60 WeakPolarHBondContact O-CD2 3.41Å; V56-F60 WeakPolarHBondContact O-CG 3.48Å; V56-F60 PolarHBondContact O-N 3.41Å
57	Q	64.4	Low	65.4	Low	85 Å²	85	108.3 Å²	108.3	40%	0.397	54%	0.539	S	S	.	.	H	α-helix	trans	-68.1	-33.3	176.2	-171.3	176.1	3.5	0	0	112.6	R53 N54 K55 R61	R53-Q57 WeakPolarHBondContact O-CB 3.39Å; R53-Q57 PolarHBondContact O-N 3.29Å; N54-Q57 PolarHBondContact O-N 3.45Å; K55-Q57 VanDerWaalsContact C-N 3.32Å; K55-Q57 PolarHBondContact O-N 3.08Å; Q57-R61 WeakPolarHBondContact O-CB 3.39Å; Q57-R61 VanDerWaalsContact O-CG 3.29Å; Q57-R61 WeakPolarHBondContact O-CG 3.39Å; Q57-R61 PolarHBondContact O-N 3.11Å
58	T	67.3	Low	64.9	Low	76 Å²	76	108.3 Å²	108.3	47%	0.466	54%	0.539	S	S	.	.	H	α-helix	trans	-70.3	-48.5	175.5	-51.7	0	0	0	0	110.4	N54 K55 V56 F60 R61 E62	N54-T58 WeakPolarHBondContact O-CB 3.39Å; N54-T58 PolarHBondContact O-N 2.87Å; N54-T58 PolarHBondContact O-OG1 3.08Å; K55-T58 PolarHBondContact O-N 2.83Å; K55-T58 VanDerWaalsContact O-N 3.1Å; V56-T58 VanDerWaalsContact C-N 3.35Å; V56-T58 PolarHBondContact O-N 3.21Å; T58-F60 VanDerWaalsContact C-N 3.32Å; T58-F60 PolarHBondContact O-N 3.47Å; T58-R61 PolarHBondContact O-N 3.46Å; T58-R61 VanDerWaalsContact O-N 3.12Å; T58-E62 PolarHBondContact O-N 3.26Å; T58-E62 VanDerWaalsContact O-N 3.08Å
59	Y	57.7	Low	64.5	Low	147 Å²	147	104.2 Å²	104.2	58%	0.576	52%	0.522	S	S	*	.	H	α-helix	trans	-57.5	-43	173.8	-82.5	-69	0	0	0	111.9	K55 R61 E62 D63	K55-Y59 HydrophobicContact CB-CD2 4.43Å; K55-Y59 WeakPolarHBondContact O-CD2 3.4Å; K55-Y59 PolarHBondContact O-N 3.43Å; Y59-R61 VanDerWaalsContact C-N 3.32Å; Y59-R61 PolarHBondContact O-N 3.48Å; Y59-E62 PolarHBondContact O-N 3.29Å; Y59-D63 PolarHBondContact O-N 2.93Å
60	F	60.8	Low	64.3	Low	71 Å²	71	102.1 Å²	102.1	31%	0.311	52%	0.519	S	S	.	.	H	α-helix	trans	-73.6	-20.3	178.4	-68.1	-38.7	0	0	0	114.8	V56 T58 D64 L65 I69	V56-F60 HydrophobicContact CB-CE2 4.38Å; V56-F60 HydrophobicContact CG1-CD2 3.4Å; V56-F60 VanDerWaalsContact CG1-CD2 3.4Å; V56-F60 HydrophobicContact CG1-CE2 3.03Å; V56-F60 HydrophobicContact CG1-CZ 3.94Å; V56-F60 WeakPolarHBondContact O-CB 3.14Å; V56-F60 WeakPolarHBondContact O-CD2 3.41Å; V56-F60 WeakPolarHBondContact O-CG 3.48Å; V56-F60 PolarHBondContact O-N 3.41Å; T58-F60 VanDerWaalsContact C-N 3.32Å; T58-F60 PolarHBondContact O-N 3.47Å; F60-D64 PolarHBondContact O-N 3.46Å; F60-L65 HydrophobicContact CD1-CB 3.88Å; F60-L65 HydrophobicContact CD1-CD2 4.45Å; F60-L65 HydrophobicContact CE1-CD2 4.37Å; F60-L65 PolarHBondContact O-N 2.89Å; F60-I69 HydrophobicContact CB-CD1 4.31Å; F60-I69 HydrophobicContact CD1-CD1 3.08Å; F60-I69 HydrophobicContact CD2-CD1 3.57Å; F60-I69 HydrophobicContact CE1-CD1 3.02Å; F60-I69 HydrophobicContact CE1-CG1 4.19Å; F60-I69 HydrophobicContact CE2-CD1 3.44Å; F60-I69 VanDerWaalsContact CE2-CD1 3.44Å; F60-I69 HydrophobicContact CE2-CG1 4.48Å; F60-I69 HydrophobicContact CE2-CG2 4.49Å; F60-I69 HydrophobicContact CG-CD1 3.4Å; F60-I69 HydrophobicContact CZ-CD1 3.21Å; F60-I69 HydrophobicContact CZ-CG1 4.17Å
61	R	63.4	Low	64.1	Low	194 Å²	194	105 Å²	105	73%	0.732	53%	0.528	S	S	*	.	H	α-helix	trans	-77	-34.4	171	-84	179.1	168.7	-172	-2.8	112	Q57 T58 Y59	Q57-R61 WeakPolarHBondContact O-CB 3.39Å; Q57-R61 VanDerWaalsContact O-CG 3.29Å; Q57-R61 WeakPolarHBondContact O-CG 3.39Å; Q57-R61 PolarHBondContact O-N 3.11Å; T58-R61 PolarHBondContact O-N 3.46Å; T58-R61 VanDerWaalsContact O-N 3.12Å; Y59-R61 VanDerWaalsContact C-N 3.32Å; Y59-R61 PolarHBondContact O-N 3.48Å
62	E	61.7	Low	64	Low	143 Å²	143	106.6 Å²	106.6	67%	0.668	53%	0.532	S	S	*	.	H	α-helix	trans	-69.7	-36.5	177	-72.9	177.6	178.3	0	0	112	T58 Y59	T58-E62 PolarHBondContact O-N 3.26Å; T58-E62 VanDerWaalsContact O-N 3.08Å; Y59-E62 PolarHBondContact O-N 3.29Å
63	D	61.4	Low	64.2	Low	104 Å²	104	107.5 Å²	107.5	56%	0.556	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.9	4.6	-177.1	-67	-37.7	0	0	0	115.1	Y59 L65	Y59-D63 PolarHBondContact O-N 2.93Å; D63-L65 HydrophobicContact CB-CB 4.22Å; D63-L65 HydrophobicContact CB-CD1 3.57Å; D63-L65 HydrophobicContact CB-CG 4.46Å; D63-L65 WeakPolarHBondContact O-CD1 3.4Å; D63-L65 PolarHBondContact O-N 3.27Å
64	D	60	Low	64.4	Low	146 Å²	146	102.2 Å²	102.2	78%	0.781	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.2	22.9	-173.3	-141.2	-3.3	0	0	0	113.6	F60 G66	F60-D64 PolarHBondContact O-N 3.46Å; D64-G66 VanDerWaalsContact C-N 3.26Å; D64-G66 PolarHBondContact O-N 2.69Å
65	L	59	Low	64.7	Low	66 Å²	66	101 Å²	101	35%	0.346	51%	0.514	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82	-4.9	-170.6	-115.8	90.2	0	0	0	113.3	F60 D63 E67 K68 I69	F60-L65 HydrophobicContact CD1-CB 3.88Å; F60-L65 HydrophobicContact CD1-CD2 4.45Å; F60-L65 HydrophobicContact CE1-CD2 4.37Å; F60-L65 PolarHBondContact O-N 2.89Å; D63-L65 HydrophobicContact CB-CB 4.22Å; D63-L65 HydrophobicContact CB-CD1 3.57Å; D63-L65 HydrophobicContact CB-CG 4.46Å; D63-L65 WeakPolarHBondContact O-CD1 3.4Å; D63-L65 PolarHBondContact O-N 3.27Å; L65-E67 VanDerWaalsContact C-N 3.25Å; L65-E67 PolarHBondContact O-N 2.79Å; L65-K68 PolarHBondContact O-N 3.23Å; L65-I69 HydrophobicContact CB-CD1 3.88Å; L65-I69 HydrophobicContact CD2-CD1 4.25Å; L65-I69 WeakPolarHBondContact O-CD1 3.2Å; L65-I69 WeakPolarHBondContact O-CG1 3.38Å; L65-I69 PolarHBondContact O-N 2.83Å; L65-I69 VanDerWaalsContact O-N 3.11Å
66	G	59.2	Low	64.9	Low	43 Å²	43	98.5 Å²	98.5	44%	0.443	51%	0.507	S	S	.	.	H	α-helix	trans	-54.9	-38.4	-175.6	0	0	0	0	0	113.5	D64 A70	D64-G66 VanDerWaalsContact C-N 3.26Å; D64-G66 PolarHBondContact O-N 2.69Å; G66-A70 PolarHBondContact O-N 3.41Å; G66-A70 VanDerWaalsContact O-N 3.14Å
67	E	60.6	Low	65.4	Low	168 Å²	168	100.2 Å²	100.2	79%	0.785	51%	0.513	S	S	*	.	H	α-helix	trans	-70.5	-44	-179.4	-165.3	170.9	-160.8	0	0	112	L65 I69 A70 D71	L65-E67 VanDerWaalsContact C-N 3.25Å; L65-E67 PolarHBondContact O-N 2.79Å; E67-I69 VanDerWaalsContact C-N 3.29Å; E67-I69 PolarHBondContact O-N 3.35Å; E67-A70 PolarHBondContact O-N 3.28Å; E67-D71 PolarHBondContact O-N 3.03Å
68	K	62.9	Low	66.1	Low	156 Å²	156	103.2 Å²	103.2	68%	0.678	53%	0.525	S	S	*	.	H	α-helix	trans	-63.9	-34.7	176.9	-83.3	178.2	177.9	171	0	112.6	L65 D71 V72	L65-K68 PolarHBondContact O-N 3.23Å; K68-D71 PolarHBondContact O-N 2.89Å; K68-V72 VanDerWaalsContact O-CG2 3.29Å; K68-V72 WeakPolarHBondContact O-CG2 3.32Å; K68-V72 PolarHBondContact O-N 2.83Å
69	I	64.2	Low	66.6	Low	42 Å²	42	108 Å²	108	22%	0.215	54%	0.535	C	S	.	.	H	α-helix	trans	-76.4	-37.2	-177.8	-68.4	152.6	0	0	0	111.4	F60 L65 E67 D71 V72 L73	F60-I69 HydrophobicContact CB-CD1 4.31Å; F60-I69 HydrophobicContact CD1-CD1 3.08Å; F60-I69 HydrophobicContact CD2-CD1 3.57Å; F60-I69 HydrophobicContact CE1-CD1 3.02Å; F60-I69 HydrophobicContact CE1-CG1 4.19Å; F60-I69 HydrophobicContact CE2-CD1 3.44Å; F60-I69 VanDerWaalsContact CE2-CD1 3.44Å; F60-I69 HydrophobicContact CE2-CG1 4.48Å; F60-I69 HydrophobicContact CE2-CG2 4.49Å; F60-I69 HydrophobicContact CG-CD1 3.4Å; F60-I69 HydrophobicContact CZ-CD1 3.21Å; F60-I69 HydrophobicContact CZ-CG1 4.17Å; L65-I69 HydrophobicContact CB-CD1 3.88Å; L65-I69 HydrophobicContact CD2-CD1 4.25Å; L65-I69 WeakPolarHBondContact O-CD1 3.2Å; L65-I69 WeakPolarHBondContact O-CG1 3.38Å; L65-I69 PolarHBondContact O-N 2.83Å; L65-I69 VanDerWaalsContact O-N 3.11Å; E67-I69 VanDerWaalsContact C-N 3.29Å; E67-I69 PolarHBondContact O-N 3.35Å; I69-D71 PolarHBondContact O-N 2.98Å; I69-V72 PolarHBondContact O-N 3.43Å; I69-L73 HydrophobicContact CG2-CD1 3.74Å; I69-L73 VanDerWaalsContact O-CB 3.29Å; I69-L73 WeakPolarHBondContact O-CB 3.38Å; I69-L73 PolarHBondContact O-N 3.33Å
70	A	65.6	Low	67.4	Low	53 Å²	53	105.2 Å²	105.2	44%	0.438	53%	0.529	S	S	.	.	H	α-helix	trans	-56.6	-43.9	170.1	0	0	0	0	0	110.2	G66 E67 L73 V74	G66-A70 PolarHBondContact O-N 3.41Å; G66-A70 VanDerWaalsContact O-N 3.14Å; E67-A70 PolarHBondContact O-N 3.28Å; A70-L73 WeakPolarHBondContact O-CB 3.48Å; A70-L73 PolarHBondContact O-N 3.1Å; A70-V74 VanDerWaalsContact O-CG2 3.25Å; A70-V74 WeakPolarHBondContact O-CG2 3.28Å; A70-V74 PolarHBondContact O-N 3.46Å
71	D	67.2	Low	68.2	Low	110 Å²	110	106.2 Å²	106.2	59%	0.588	54%	0.538	S	S	*	.	H	α-helix	trans	-66.8	-43.1	179.8	-145.8	17.2	0	0	0	112.1	E67 K68 I69 L73 V74 V75	E67-D71 PolarHBondContact O-N 3.03Å; K68-D71 PolarHBondContact O-N 2.89Å; I69-D71 PolarHBondContact O-N 2.98Å; D71-L73 PolarHBondContact O-N 3.31Å; D71-V74 PolarHBondContact O-N 2.92Å; D71-V75 WeakPolarHBondContact O-CG2 3.47Å; D71-V75 PolarHBondContact O-N 2.94Å
72	V	70.5	Confident	69.1	Low	86 Å²	86	103.5 Å²	103.5	52%	0.521	53%	0.531	S	S	.	.	H	α-helix	trans	-63	-40.9	173.8	172.5	0	0	0	0	111.7	K68 I69 V75 L76	K68-V72 VanDerWaalsContact O-CG2 3.29Å; K68-V72 WeakPolarHBondContact O-CG2 3.32Å; K68-V72 PolarHBondContact O-N 2.83Å; I69-V72 PolarHBondContact O-N 3.43Å; V72-V75 PolarHBondContact O-N 3.42Å; V72-L76 HydrophobicContact CG1-CD1 3.81Å; V72-L76 WeakPolarHBondContact O-CB 3.41Å; V72-L76 PolarHBondContact O-N 3.28Å
73	L	71.7	Confident	69.9	Low	92 Å²	92	105.5 Å²	105.5	48%	0.482	53%	0.533	S	S	.	.	H	α-helix	trans	-62.4	-42.6	174.9	-96.3	148.1	0	0	0	111.5	I69 A70 D71 V75 L76 L77	I69-L73 HydrophobicContact CG2-CD1 3.74Å; I69-L73 VanDerWaalsContact O-CB 3.29Å; I69-L73 WeakPolarHBondContact O-CB 3.38Å; I69-L73 PolarHBondContact O-N 3.33Å; A70-L73 WeakPolarHBondContact O-CB 3.48Å; A70-L73 PolarHBondContact O-N 3.1Å; D71-L73 PolarHBondContact O-N 3.31Å; L73-V75 VanDerWaalsContact C-N 3.33Å; L73-V75 PolarHBondContact O-N 3.42Å; L73-L76 PolarHBondContact O-N 3.46Å; L73-L77 WeakPolarHBondContact O-CB 3.32Å; L73-L77 WeakPolarHBondContact O-CG 3.27Å; L73-L77 PolarHBondContact O-N 2.96Å
74	V	73.6	Confident	70.7	Confident	64 Å²	64	105.6 Å²	105.6	39%	0.388	53%	0.533	S	S	.	.	H	α-helix	trans	-61.6	-43.5	175.5	168.7	0	0	0	0	110.4	A70 D71 L77 K78	A70-V74 VanDerWaalsContact O-CG2 3.25Å; A70-V74 WeakPolarHBondContact O-CG2 3.28Å; A70-V74 PolarHBondContact O-N 3.46Å; D71-V74 PolarHBondContact O-N 2.92Å; V74-L77 PolarHBondContact O-N 3.39Å; V74-K78 HydrophobicContact CG1-CD 4.33Å; V74-K78 WeakPolarHBondContact O-CB 3.29Å; V74-K78 WeakPolarHBondContact O-CG 3.44Å; V74-K78 PolarHBondContact O-N 3.22Å
75	V	75.2	Confident	71.7	Confident	72 Å²	72	104.2 Å²	104.2	44%	0.436	52%	0.522	S	S	.	.	H	α-helix	trans	-64	-41.9	176.2	173.5	0	0	0	0	111.5	D71 V72 L73 K78 R79	D71-V75 WeakPolarHBondContact O-CG2 3.47Å; D71-V75 PolarHBondContact O-N 2.94Å; V72-V75 PolarHBondContact O-N 3.42Å; L73-V75 VanDerWaalsContact C-N 3.33Å; L73-V75 PolarHBondContact O-N 3.42Å; V75-K78 PolarHBondContact O-N 2.86Å; V75-R79 PolarHBondContact O-N 3.4Å
76	L	71.4	Confident	72.5	Confident	91 Å²	91	105.7 Å²	105.7	48%	0.476	53%	0.53	S	S	.	.	H	α-helix	trans	-64.2	-45.3	176.2	-85	156.2	0	0	0	111.8	V72 L73 K78 R79 L80	V72-L76 HydrophobicContact CG1-CD1 3.81Å; V72-L76 WeakPolarHBondContact O-CB 3.41Å; V72-L76 PolarHBondContact O-N 3.28Å; L73-L76 PolarHBondContact O-N 3.46Å; L76-K78 PolarHBondContact O-N 2.99Å; L76-R79 PolarHBondContact O-N 2.94Å; L76-L80 WeakPolarHBondContact O-CB 3.3Å; L76-L80 WeakPolarHBondContact O-CG 3.4Å; L76-L80 PolarHBondContact O-N 3.28Å
77	L	75.4	Confident	73.1	Confident	95 Å²	95	107.6 Å²	107.6	50%	0.497	54%	0.536	S	S	.	.	H	α-helix	trans	-61	-43.6	176	-78.8	167.2	0	0	0	111.4	L73 V74 R79 L80 N81	L73-L77 WeakPolarHBondContact O-CB 3.32Å; L73-L77 WeakPolarHBondContact O-CG 3.27Å; L73-L77 PolarHBondContact O-N 2.96Å; V74-L77 PolarHBondContact O-N 3.39Å; L77-R79 VanDerWaalsContact C-N 3.34Å; L77-R79 PolarHBondContact O-N 3.48Å; L77-L80 PolarHBondContact O-N 3.44Å; L77-N81 WeakPolarHBondContact O-CB 3.41Å; L77-N81 PolarHBondContact O-N 2.93Å
78	K	78.6	Confident	73.6	Confident	149 Å²	149	104.7 Å²	104.7	65%	0.648	53%	0.525	S	S	*	.	H	α-helix	trans	-59.2	-43	174.3	-77.7	178	179.6	176.5	0	112	V74 V75 L76 K82	V74-K78 HydrophobicContact CG1-CD 4.33Å; V74-K78 WeakPolarHBondContact O-CB 3.29Å; V74-K78 WeakPolarHBondContact O-CG 3.44Å; V74-K78 PolarHBondContact O-N 3.22Å; V75-K78 PolarHBondContact O-N 2.86Å; L76-K78 PolarHBondContact O-N 2.99Å; K78-K82 WeakPolarHBondContact O-CB 3.5Å; K78-K82 PolarHBondContact O-N 3.48Å
79	R	78.9	Confident	74.1	Confident	177 Å²	177	104.4 Å²	104.4	67%	0.668	52%	0.524	S	S	*	.	H	α-helix	trans	-65.9	-41	175.7	-77.4	-173.6	-164.8	-169.8	4.7	112.4	V75 L76 L77 K82 R83	V75-R79 PolarHBondContact O-N 3.4Å; L76-R79 PolarHBondContact O-N 2.94Å; L77-R79 VanDerWaalsContact C-N 3.34Å; L77-R79 PolarHBondContact O-N 3.48Å; R79-K82 PolarHBondContact O-N 3.35Å; R79-R83 WeakPolarHBondContact O-CG 3.32Å; R79-R83 PolarHBondContact O-N 2.94Å
80	L	73	Confident	74.1	Confident	87 Å²	87	106.3 Å²	106.3	46%	0.455	54%	0.541	S	S	.	.	H	α-helix	trans	-65.5	-46.7	178.6	-76.2	167.3	0	0	0	111.3	L76 L77 K82 R83 L84	L76-L80 WeakPolarHBondContact O-CB 3.3Å; L76-L80 WeakPolarHBondContact O-CG 3.4Å; L76-L80 PolarHBondContact O-N 3.28Å; L77-L80 PolarHBondContact O-N 3.44Å; L80-K82 VanDerWaalsContact C-N 3.32Å; L80-K82 PolarHBondContact O-N 3.28Å; L80-R83 WeakPolarHBondContact O-CB 3.43Å; L80-R83 PolarHBondContact O-N 3.19Å; L80-R83 VanDerWaalsContact O-N 3.08Å; L80-L84 PolarHBondContact O-N 3.26Å
81	N	79.6	Confident	73.8	Confident	93 Å²	93	107.1 Å²	107.1	50%	0.497	54%	0.543	S	S	.	.	H	α-helix	trans	-58.2	-44.8	174.6	-80.5	-4.6	0	0	0	111.3	L77 R83 L84 E85	L77-N81 WeakPolarHBondContact O-CB 3.41Å; L77-N81 PolarHBondContact O-N 2.93Å; N81-R83 VanDerWaalsContact C-N 3.27Å; N81-R83 PolarHBondContact O-N 2.98Å; N81-L84 PolarHBondContact O-N 2.91Å; N81-L84 VanDerWaalsContact O-N 3.13Å; N81-E85 WeakPolarHBondContact O-CB 3.2Å; N81-E85 WeakPolarHBondContact O-CG 3.22Å; N81-E85 PolarHBondContact O-N 2.83Å
82	K	81.1	Confident	73.4	Confident	136 Å²	136	108.3 Å²	108.3	59%	0.591	55%	0.55	S	S	*	.	H	α-helix	trans	-59.7	-36.9	175.9	-170.4	174	-176.3	176	0	112.8	K78 R79 L80 N86	K78-K82 WeakPolarHBondContact O-CB 3.5Å; K78-K82 PolarHBondContact O-N 3.48Å; R79-K82 PolarHBondContact O-N 3.35Å; L80-K82 VanDerWaalsContact C-N 3.32Å; L80-K82 PolarHBondContact O-N 3.28Å; K82-N86 WeakPolarHBondContact O-CB 3.18Å; K82-N86 PolarHBondContact O-N 2.78Å; K82-N86 VanDerWaalsContact O-N 3.08Å; K82-N86 PolarHBondContact O-OD1 3.28Å
83	R	79.3	Confident	72.5	Confident	186 Å²	186	111.7 Å²	111.7	70%	0.702	56%	0.564	S	S	*	*	H	α-helix	trans	-70	-40.6	174.9	-73	-178.4	71.3	-172	2.1	112.1	R79 L80 N81 N86 C87	R79-R83 WeakPolarHBondContact O-CG 3.32Å; R79-R83 PolarHBondContact O-N 2.94Å; L80-R83 WeakPolarHBondContact O-CB 3.43Å; L80-R83 PolarHBondContact O-N 3.19Å; L80-R83 VanDerWaalsContact O-N 3.08Å; N81-R83 VanDerWaalsContact C-N 3.27Å; N81-R83 PolarHBondContact O-N 2.98Å; R83-N86 PolarHBondContact O-N 3.5Å; R83-C87 WeakPolarHBondContact O-CB 3.25Å; R83-C87 PolarHBondContact O-N 2.98Å
84	L	77.8	Confident	71.1	Confident	106 Å²	106	119 Å²	119	56%	0.555	60%	0.596	S	S	*	*	H	α-helix	trans	-66.1	-43.1	176.8	-73.1	172	0	0	0	111.5	L80 N81 N86 C87 L88	L80-L84 PolarHBondContact O-N 3.26Å; N81-L84 PolarHBondContact O-N 2.91Å; N81-L84 VanDerWaalsContact O-N 3.13Å; L84-N86 VanDerWaalsContact C-N 3.34Å; L84-N86 PolarHBondContact O-N 3.44Å; L84-C87 PolarHBondContact O-N 3.48Å; L84-L88 WeakPolarHBondContact O-CB 3.29Å; L84-L88 WeakPolarHBondContact O-CG 3.19Å; L84-L88 PolarHBondContact O-N 3.44Å
85	E	80.5	Confident	70.9	Confident	116 Å²	116	121.8 Å²	121.8	54%	0.542	61%	0.606	S	S	.	*	H	α-helix	trans	-60.5	-43	173.8	-73.4	178.1	156.2	0	0	111.7	N81 L88 K89	N81-E85 WeakPolarHBondContact O-CB 3.2Å; N81-E85 WeakPolarHBondContact O-CG 3.22Å; N81-E85 PolarHBondContact O-N 2.83Å; E85-L88 PolarHBondContact O-N 3.45Å; E85-K89 WeakPolarHBondContact O-CB 3.35Å; E85-K89 WeakPolarHBondContact O-CG 3.35Å; E85-K89 PolarHBondContact O-N 2.9Å
86	N	77.1	Confident	70.7	Confident	97 Å²	97	124.4 Å²	124.4	52%	0.519	62%	0.615	S	S	.	*	H	α-helix	trans	-64.6	-39.2	175.2	-75.6	-1.6	0	0	0	112.1	K82 R83 L84 S90	K82-N86 WeakPolarHBondContact O-CB 3.18Å; K82-N86 PolarHBondContact O-N 2.78Å; K82-N86 VanDerWaalsContact O-N 3.08Å; K82-N86 PolarHBondContact O-OD1 3.28Å; R83-N86 PolarHBondContact O-N 3.5Å; L84-N86 VanDerWaalsContact C-N 3.34Å; L84-N86 PolarHBondContact O-N 3.44Å; N86-S90 VanDerWaalsContact O-CB 3.3Å; N86-S90 WeakPolarHBondContact O-CB 3.45Å; N86-S90 PolarHBondContact O-N 3.03Å
87	C	70.7	Confident	70.7	Confident	84 Å²	84	126.2 Å²	126.2	57%	0.568	62%	0.623	S	S	*	*	H	α-helix	trans	-67.5	-40.8	176.7	-163.4	0	0	0	0	111.8	R83 L84 S90 S91	R83-C87 WeakPolarHBondContact O-CB 3.25Å; R83-C87 PolarHBondContact O-N 2.98Å; L84-C87 PolarHBondContact O-N 3.48Å; C87-S90 WeakPolarHBondContact O-CB 3.21Å; C87-S90 PolarHBondContact O-N 3.25Å; C87-S91 PolarHBondContact O-N 2.93Å; C87-S91 PolarHBondContact O-OG 3.44Å
88	L	71.9	Confident	70.4	Confident	107 Å²	107	128.1 Å²	128.1	56%	0.56	63%	0.63	S	S	*	*	H	α-helix	trans	-69.6	-36.1	177.3	-76.9	168.2	0	0	0	112.4	L84 E85 S91 N92	L84-L88 WeakPolarHBondContact O-CB 3.29Å; L84-L88 WeakPolarHBondContact O-CG 3.19Å; L84-L88 PolarHBondContact O-N 3.44Å; E85-L88 PolarHBondContact O-N 3.45Å; L88-S91 PolarHBondContact O-N 2.95Å; L88-S91 PolarHBondContact O-OG 2.86Å; L88-S91 VanDerWaalsContact O-OG 3.1Å; L88-N92 PolarHBondContact O-N 2.97Å; L88-N92 PolarHBondContact O-ND2 2.78Å
89	K	72.6	Confident	69.9	Low	150 Å²	150	126.8 Å²	126.8	65%	0.652	63%	0.629	S	S	*	*	H	α-helix	trans	-67.7	-38.7	171.6	-78.2	-178.6	178.8	-179.8	0	111.7	E85 S91 N92	E85-K89 WeakPolarHBondContact O-CB 3.35Å; E85-K89 WeakPolarHBondContact O-CG 3.35Å; E85-K89 PolarHBondContact O-N 2.9Å; K89-S91 VanDerWaalsContact C-N 3.28Å; K89-S91 PolarHBondContact O-N 3.12Å; K89-N92 PolarHBondContact O-N 3.43Å
90	S	64.2	Low	69.3	Low	81 Å²	81	123.4 Å²	123.4	57%	0.566	63%	0.626	S	S	*	*	H	α-helix	trans	-63.5	-32.9	174.2	179.4	0	0	0	0	112.6	N86 C87	N86-S90 VanDerWaalsContact O-CB 3.3Å; N86-S90 WeakPolarHBondContact O-CB 3.45Å; N86-S90 PolarHBondContact O-N 3.03Å; C87-S90 WeakPolarHBondContact O-CB 3.21Å; C87-S90 PolarHBondContact O-N 3.25Å
91	S	59	Low	69	Low	71 Å²	71	126 Å²	126	50%	0.497	64%	0.638	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.5	-5.1	-178.2	71.1	0	0	0	0	114.7	C87 L88 K89	C87-S91 PolarHBondContact O-N 2.93Å; C87-S91 PolarHBondContact O-OG 3.44Å; L88-S91 PolarHBondContact O-N 2.95Å; L88-S91 PolarHBondContact O-OG 2.86Å; L88-S91 VanDerWaalsContact O-OG 3.1Å; K89-S91 VanDerWaalsContact C-N 3.28Å; K89-S91 PolarHBondContact O-N 3.12Å
92	N	58.4	Low	68.2	Low	135 Å²	135	128.5 Å²	128.5	72%	0.722	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.2	10.5	175.4	-83.3	-83.8	0	0	0	112.6	L88 K89	L88-N92 PolarHBondContact O-N 2.97Å; L88-N92 PolarHBondContact O-ND2 2.78Å; K89-N92 PolarHBondContact O-N 3.43Å
93	L	53.5	Low	67.2	Low	156 Å²	156	127.9 Å²	127.9	82%	0.817	65%	0.654	S	S	*	*			trans	-118.6	13.2	-176.9	-116.9	146.5	0	0	0	113.1
94	E	40.9	Very low	66	Low	246 Å²	246	122.6 Å²	122.6	100%	1.15	65%	0.65	S	S	*	*			trans	-116	0	167.9	-73.5	-175.6	109.1	0	0	110.9

Retrieved 94 of 94 residues in 97.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).