A0A3Q0KKS0_SCHMA Loading...

UPAR/Ly6 domain-containing protein AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KKS0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 129 aa.

						>A0A3Q0KKS0_SCHMA|A0A3Q0KKS0
MLNKQYYMSITVMFIYILISSIYIGNSGALKCYVCQNCSNVTGKANFTIGDNCKFCQKIVRLKNGFLNSTTRSCLTDTCVNSNKSESPWLNITTCCTKPDLCNQSVRTTSKMNIQFIWILFSIWIWYNC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.3	Low	76.8	Confident	203 Å²	203	117.6 Å²	117.6	100%	1	57%	0.574	S	S	*	*				0	-44.8	0	-73.1	177.6	166.1	0	0	112.6	N3 K4 Q5	M1-N3 VanDerWaalsContact C-N 3.32Å; M1-N3 PolarHBondContact O-N 3.22Å; M1-K4 WeakPolarHBondContact O-CB 3.4Å; M1-K4 PolarHBondContact O-N 3.12Å; M1-Q5 PolarHBondContact O-N 3.43Å; M1-Q5 VanDerWaalsContact O-N 3.16Å
2	L	66.4	Low	77.4	Confident	142 Å²	142	112.4 Å²	112.4	74%	0.743	55%	0.554	S	S	*	*	H	α-helix	trans	-49.7	-43.7	178.7	-68.4	163.5	0	0	0	114.6	K4 Q5 Y6	L2-K4 PolarHBondContact O-N 3.02Å; L2-Q5 PolarHBondContact O-N 3.35Å; L2-Y6 PolarHBondContact O-N 3.46Å
3	N	74.8	Confident	77.7	Confident	117 Å²	117	112.2 Å²	112.2	63%	0.626	55%	0.553	S	S	*	*	H	α-helix	trans	-60.9	-44	175.9	-83.5	-5.5	0	0	0	112.7	M1 Q5 Y6 Y7	M1-N3 VanDerWaalsContact C-N 3.32Å; M1-N3 PolarHBondContact O-N 3.22Å; N3-Q5 VanDerWaalsContact C-N 3.34Å; N3-Q5 PolarHBondContact O-N 3.36Å; N3-Y6 PolarHBondContact O-N 3.33Å; N3-Y7 HydrophobicContact CB-CE2 4.14Å; N3-Y7 WeakPolarHBondContact O-CD2 3.43Å; N3-Y7 PolarHBondContact O-N 3.1Å; N3-Y7 VanDerWaalsContact O-N 3.1Å
4	K	76.7	Confident	78.4	Confident	162 Å²	162	113.4 Å²	113.4	70%	0.704	55%	0.554	S	S	*	*	H	α-helix	trans	-62.1	-42.6	179.2	-175	-176.1	175.7	-169.4	0	111.2	M1 L2 Y7 M8	M1-K4 WeakPolarHBondContact O-CB 3.4Å; M1-K4 PolarHBondContact O-N 3.12Å; L2-K4 PolarHBondContact O-N 3.02Å; K4-Y7 PolarHBondContact O-N 3.34Å; K4-M8 WeakPolarHBondContact O-CB 2.89Å; K4-M8 PolarHBondContact O-N 3.16Å
5	Q	73	Confident	78.9	Confident	75 Å²	75	112.1 Å²	112.1	35%	0.35	55%	0.549	S	S	.	.	H	α-helix	trans	-64.9	-42	178.7	-73.4	177.5	-30.8	0	0	111.9	M1 L2 N3 M8 S9	M1-Q5 PolarHBondContact O-N 3.43Å; M1-Q5 VanDerWaalsContact O-N 3.16Å; L2-Q5 PolarHBondContact O-N 3.35Å; N3-Q5 VanDerWaalsContact C-N 3.34Å; N3-Q5 PolarHBondContact O-N 3.36Å; Q5-M8 PolarHBondContact O-N 2.99Å; Q5-S9 PolarHBondContact O-N 3.43Å
6	Y	82.2	Confident	79.1	Confident	149 Å²	149	110.9 Å²	110.9	58%	0.584	54%	0.538	S	S	*	.	H	α-helix	trans	-60.5	-47.8	176	-179.4	-104.8	0	0	0	112.2	L2 N3 M8 S9 I10	L2-Y6 PolarHBondContact O-N 3.46Å; N3-Y6 PolarHBondContact O-N 3.33Å; Y6-M8 VanDerWaalsContact C-N 3.34Å; Y6-M8 PolarHBondContact O-N 3.03Å; Y6-S9 PolarHBondContact O-N 3.48Å; Y6-I10 HydrophobicContact CD1-CD1 3.75Å; Y6-I10 HydrophobicContact CD2-CD1 4.29Å; Y6-I10 HydrophobicContact CE1-CD1 3.24Å; Y6-I10 HydrophobicContact CE2-CD1 3.85Å; Y6-I10 HydrophobicContact CG-CD1 4.26Å; Y6-I10 WeakPolarHBondContact O-CG1 3.29Å; Y6-I10 PolarHBondContact O-N 2.99Å; Y6-I10 VanDerWaalsContact O-N 3.12Å
7	Y	82.2	Confident	79.5	Confident	144 Å²	144	110.8 Å²	110.8	57%	0.565	54%	0.539	S	S	*	.	H	α-helix	trans	-63.8	-39	177.3	-67.9	-61.7	0	0	0	112.5	N3 K4 I10 T11	N3-Y7 HydrophobicContact CB-CE2 4.14Å; N3-Y7 WeakPolarHBondContact O-CD2 3.43Å; N3-Y7 PolarHBondContact O-N 3.1Å; N3-Y7 VanDerWaalsContact O-N 3.1Å; K4-Y7 PolarHBondContact O-N 3.34Å; Y7-I10 PolarHBondContact O-N 3.33Å; Y7-T11 WeakPolarHBondContact O-CG2 3.48Å; Y7-T11 PolarHBondContact O-N 2.99Å; Y7-T11 PolarHBondContact O-OG1 3.44Å
8	M	79.8	Confident	79.8	Confident	77 Å²	77	109.4 Å²	109.4	38%	0.379	53%	0.534	S	S	.	.	H	α-helix	trans	-65.2	-40.5	178.2	-170.8	174.5	-169.5	0	0	112.4	K4 Q5 Y6 T11 V12 I125	K4-M8 WeakPolarHBondContact O-CB 2.89Å; K4-M8 PolarHBondContact O-N 3.16Å; Q5-M8 PolarHBondContact O-N 2.99Å; Y6-M8 VanDerWaalsContact C-N 3.34Å; Y6-M8 PolarHBondContact O-N 3.03Å; M8-T11 PolarHBondContact O-OG1 3.19Å; M8-V12 VanDerWaalsContact O-CG2 3.3Å; M8-V12 WeakPolarHBondContact O-CG2 3.34Å; M8-V12 PolarHBondContact O-N 3.03Å; M8-I125 HydrophobicContact CE-CG2 3.16Å; M8-I125 HydrophobicContact SD-CG2 4.18Å
9	S	80.4	Confident	80	Confident	72 Å²	72	106.5 Å²	106.5	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-65.1	-43.3	176.7	-176.2	0	0	0	0	111.8	Q5 Y6 V12 M13	Q5-S9 PolarHBondContact O-N 3.43Å; Y6-S9 PolarHBondContact O-N 3.48Å; S9-V12 PolarHBondContact O-N 3.33Å; S9-M13 VanDerWaalsContact O-CG 3.29Å; S9-M13 WeakPolarHBondContact O-CG 3.35Å; S9-M13 PolarHBondContact O-N 2.97Å
10	I	85	Confident	80	Confident	77 Å²	77	103.3 Å²	103.3	40%	0.395	51%	0.509	S	S	.	.	H	α-helix	trans	-63.5	-43.8	178.2	-70.1	172.5	0	0	0	111.7	Y6 Y7 V12 M13 F14	Y6-I10 HydrophobicContact CD1-CD1 3.75Å; Y6-I10 HydrophobicContact CD2-CD1 4.29Å; Y6-I10 HydrophobicContact CE1-CD1 3.24Å; Y6-I10 HydrophobicContact CE2-CD1 3.85Å; Y6-I10 HydrophobicContact CG-CD1 4.26Å; Y6-I10 WeakPolarHBondContact O-CG1 3.29Å; Y6-I10 PolarHBondContact O-N 2.99Å; Y6-I10 VanDerWaalsContact O-N 3.12Å; Y7-I10 PolarHBondContact O-N 3.33Å; I10-V12 VanDerWaalsContact C-N 3.34Å; I10-V12 PolarHBondContact O-N 2.99Å; I10-M13 PolarHBondContact O-N 2.93Å; I10-F14 WeakPolarHBondContact O-CB 3.33Å; I10-F14 PolarHBondContact O-N 2.9Å
11	T	84.8	Confident	79.9	Confident	76 Å²	76	101.3 Å²	101.3	47%	0.466	51%	0.505	S	S	.	.	H	α-helix	trans	-65.1	-38.9	-179.9	54	0	0	0	0	111.6	Y7 M8 F14 I15	Y7-T11 WeakPolarHBondContact O-CG2 3.48Å; Y7-T11 PolarHBondContact O-N 2.99Å; Y7-T11 PolarHBondContact O-OG1 3.44Å; M8-T11 PolarHBondContact O-OG1 3.19Å; T11-F14 PolarHBondContact O-N 3.37Å; T11-I15 WeakPolarHBondContact O-CB 3.48Å; T11-I15 VanDerWaalsContact O-CG1 3.24Å; T11-I15 WeakPolarHBondContact O-CG1 3.42Å; T11-I15 PolarHBondContact O-N 2.71Å
12	V	83.9	Confident	80.8	Confident	55 Å²	55	97.9 Å²	97.9	33%	0.333	49%	0.49	S	S	.	.	H	α-helix	trans	-64.4	-44.7	174.8	172.8	0	0	0	0	111.4	M8 S9 I10 F14 I15 Y16	M8-V12 VanDerWaalsContact O-CG2 3.3Å; M8-V12 WeakPolarHBondContact O-CG2 3.34Å; M8-V12 PolarHBondContact O-N 3.03Å; S9-V12 PolarHBondContact O-N 3.33Å; I10-V12 VanDerWaalsContact C-N 3.34Å; I10-V12 PolarHBondContact O-N 2.99Å; V12-F14 VanDerWaalsContact C-N 3.32Å; V12-F14 PolarHBondContact O-N 3.47Å; V12-I15 PolarHBondContact O-N 3.39Å; V12-Y16 WeakPolarHBondContact O-CB 3.2Å; V12-Y16 PolarHBondContact O-N 3.18Å
13	M	82.1	Confident	81	Confident	110 Å²	110	98.6 Å²	98.6	54%	0.542	48%	0.484	S	S	.	.	H	α-helix	trans	-60.9	-41.3	176	-70.9	-89	89.9	0	0	111.8	S9 I10 Y16 I17	S9-M13 VanDerWaalsContact O-CG 3.29Å; S9-M13 WeakPolarHBondContact O-CG 3.35Å; S9-M13 PolarHBondContact O-N 2.97Å; I10-M13 PolarHBondContact O-N 2.93Å; M13-Y16 WeakPolarHBondContact O-CB 3.3Å; M13-Y16 PolarHBondContact O-N 3.38Å; M13-I17 WeakPolarHBondContact O-CG1 3.46Å; M13-I17 PolarHBondContact O-N 2.94Å
14	F	86.8	Confident	80.7	Confident	129 Å²	129	99.2 Å²	99.2	57%	0.566	49%	0.486	S	S	*	.	H	α-helix	trans	-66.2	-45.1	177.6	-167.2	-105.3	0	0	0	112	I10 T11 V12 Y16 I17 L18	I10-F14 WeakPolarHBondContact O-CB 3.33Å; I10-F14 PolarHBondContact O-N 2.9Å; T11-F14 PolarHBondContact O-N 3.37Å; V12-F14 VanDerWaalsContact C-N 3.32Å; V12-F14 PolarHBondContact O-N 3.47Å; F14-Y16 VanDerWaalsContact C-N 3.27Å; F14-Y16 PolarHBondContact O-N 3.02Å; F14-I17 PolarHBondContact O-N 3.44Å; F14-L18 HydrophobicContact CD1-CD1 3.74Å; F14-L18 HydrophobicContact CD1-CG 4.18Å; F14-L18 HydrophobicContact CE1-CD1 3.52Å; F14-L18 HydrophobicContact CE1-CD2 4.35Å; F14-L18 HydrophobicContact CE1-CG 4.01Å; F14-L18 HydrophobicContact CZ-CD1 4.34Å; F14-L18 HydrophobicContact CZ-CD2 4.38Å; F14-L18 HydrophobicContact CZ-CG 4.44Å; F14-L18 WeakPolarHBondContact O-CG 3.24Å; F14-L18 PolarHBondContact O-N 3.45Å
15	I	85.6	Confident	80.2	Confident	94 Å²	94	94.3 Å²	94.3	48%	0.482	48%	0.481	S	S	.	.	H	α-helix	trans	-58.8	-41.8	174.2	-70.3	165.9	0	0	0	110.4	T11 V12 L18 I19	T11-I15 WeakPolarHBondContact O-CB 3.48Å; T11-I15 VanDerWaalsContact O-CG1 3.24Å; T11-I15 WeakPolarHBondContact O-CG1 3.42Å; T11-I15 PolarHBondContact O-N 2.71Å; V12-I15 PolarHBondContact O-N 3.39Å; I15-L18 PolarHBondContact O-N 3.47Å; I15-I19 HydrophobicContact CG2-CD1 3.6Å; I15-I19 HydrophobicContact CG2-CG1 4.28Å; I15-I19 WeakPolarHBondContact O-CB 3.48Å; I15-I19 VanDerWaalsContact O-CG1 3.26Å; I15-I19 WeakPolarHBondContact O-CG1 3.35Å; I15-I19 PolarHBondContact O-N 3.46Å
16	Y	82.5	Confident	79.9	Confident	93 Å²	93	97.2 Å²	97.2	37%	0.365	50%	0.499	S	S	.	.	H	α-helix	trans	-62	-45.7	177.1	-178.6	-94.9	0	0	0	112.4	V12 M13 F14 L18 I19 S20	V12-Y16 WeakPolarHBondContact O-CB 3.2Å; V12-Y16 PolarHBondContact O-N 3.18Å; M13-Y16 WeakPolarHBondContact O-CB 3.3Å; M13-Y16 PolarHBondContact O-N 3.38Å; F14-Y16 VanDerWaalsContact C-N 3.27Å; F14-Y16 PolarHBondContact O-N 3.02Å; Y16-L18 VanDerWaalsContact C-N 3.34Å; Y16-L18 PolarHBondContact O-N 3.41Å; Y16-I19 PolarHBondContact O-N 3.16Å; Y16-S20 WeakPolarHBondContact O-CB 3.36Å; Y16-S20 PolarHBondContact O-N 3Å; Y16-S20 PolarHBondContact O-OG 3.17Å
17	I	85.5	Confident	79.4	Confident	108 Å²	108	96 Å²	96	55%	0.554	51%	0.512	S	S	*	.	H	α-helix	trans	-61.5	-43.9	176.6	-68.6	164.4	0	0	0	110.5	M13 F14 S20 S21	M13-I17 WeakPolarHBondContact O-CG1 3.46Å; M13-I17 PolarHBondContact O-N 2.94Å; F14-I17 PolarHBondContact O-N 3.44Å; I17-S20 PolarHBondContact O-N 2.92Å; I17-S21 PolarHBondContact O-N 3.39Å
18	L	85.7	Confident	79.2	Confident	87 Å²	87	91.7 Å²	91.7	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-47	176.6	-70.3	179.5	0	0	0	111.8	F14 I15 Y16 S20 S21	F14-L18 HydrophobicContact CD1-CD1 3.74Å; F14-L18 HydrophobicContact CD1-CG 4.18Å; F14-L18 HydrophobicContact CE1-CD1 3.52Å; F14-L18 HydrophobicContact CE1-CD2 4.35Å; F14-L18 HydrophobicContact CE1-CG 4.01Å; F14-L18 HydrophobicContact CZ-CD1 4.34Å; F14-L18 HydrophobicContact CZ-CD2 4.38Å; F14-L18 HydrophobicContact CZ-CG 4.44Å; F14-L18 WeakPolarHBondContact O-CG 3.24Å; F14-L18 PolarHBondContact O-N 3.45Å; I15-L18 PolarHBondContact O-N 3.47Å; Y16-L18 VanDerWaalsContact C-N 3.34Å; Y16-L18 PolarHBondContact O-N 3.41Å; L18-S20 VanDerWaalsContact C-N 3.3Å; L18-S20 PolarHBondContact O-N 3.09Å; L18-S21 PolarHBondContact O-N 3.17Å; L18-S21 PolarHBondContact O-OG 2.69Å
19	I	83	Confident	79.5	Confident	54 Å²	54	90.6 Å²	90.6	28%	0.277	51%	0.514	S	S	.	.	H	α-helix	trans	-62.2	-40.5	177	-69.1	168.3	0	0	0	110.6	I15 Y16 S21 I22 Y23	I15-I19 HydrophobicContact CG2-CD1 3.6Å; I15-I19 HydrophobicContact CG2-CG1 4.28Å; I15-I19 WeakPolarHBondContact O-CB 3.48Å; I15-I19 VanDerWaalsContact O-CG1 3.26Å; I15-I19 WeakPolarHBondContact O-CG1 3.35Å; I15-I19 PolarHBondContact O-N 3.46Å; Y16-I19 PolarHBondContact O-N 3.16Å; I19-S21 VanDerWaalsContact C-N 3.3Å; I19-S21 PolarHBondContact O-N 3.43Å; I19-I22 WeakPolarHBondContact O-CB 3.48Å; I19-I22 PolarHBondContact O-N 3.24Å; I19-Y23 HydrophobicContact CG2-CE2 4.02Å; I19-Y23 VanDerWaalsContact O-CD2 3.25Å; I19-Y23 WeakPolarHBondContact O-CD2 3.32Å; I19-Y23 WeakPolarHBondContact O-CE2 3.43Å
20	S	79.4	Confident	80	Confident	42 Å²	42	87.9 Å²	87.9	29%	0.294	49%	0.494	S	S	.	.	H	α-helix	trans	-62.8	-36.4	178.3	-57.2	0	0	0	0	112.3	Y16 I17 L18 I22 Y23	Y16-S20 WeakPolarHBondContact O-CB 3.36Å; Y16-S20 PolarHBondContact O-N 3Å; Y16-S20 PolarHBondContact O-OG 3.17Å; I17-S20 PolarHBondContact O-N 2.92Å; L18-S20 VanDerWaalsContact C-N 3.3Å; L18-S20 PolarHBondContact O-N 3.09Å; S20-I22 PolarHBondContact O-N 2.86Å; S20-Y23 PolarHBondContact O-N 3.36Å
21	S	79.2	Confident	80.4	Confident	61 Å²	61	88.3 Å²	88.3	43%	0.427	49%	0.493	S	S	.	.	H	α-helix	trans	-65.2	-22.8	179.1	75.2	0	0	0	0	113.9	I17 L18 I19 Y23 I24	I17-S21 PolarHBondContact O-N 3.39Å; L18-S21 PolarHBondContact O-N 3.17Å; L18-S21 PolarHBondContact O-OG 2.69Å; I19-S21 VanDerWaalsContact C-N 3.3Å; I19-S21 PolarHBondContact O-N 3.43Å; S21-Y23 PolarHBondContact O-N 3.32Å; S21-I24 VanDerWaalsContact O-CD1 3.3Å; S21-I24 WeakPolarHBondContact O-CD1 3.23Å; S21-I24 VanDerWaalsContact O-CG1 3.23Å; S21-I24 WeakPolarHBondContact O-CG1 3.3Å; S21-I24 PolarHBondContact O-N 2.89Å
22	I	77.3	Confident	80.9	Confident	132 Å²	132	84.7 Å²	84.7	68%	0.677	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-22.9	177.9	-56.7	170.3	0	0	0	111.2	I19 S20 I24	I19-I22 WeakPolarHBondContact O-CB 3.48Å; I19-I22 PolarHBondContact O-N 3.24Å; S20-I22 PolarHBondContact O-N 2.86Å; I22-I24 VanDerWaalsContact C-N 3.3Å; I22-I24 PolarHBondContact O-N 3.49Å
23	Y	70.4	Confident	81.4	Confident	156 Å²	156	83.2 Å²	83.2	61%	0.612	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.8	8.4	-178.8	-61.2	-79.8	0	0	0	114.2	I19 S20 S21 G25	I19-Y23 HydrophobicContact CG2-CE2 4.02Å; I19-Y23 VanDerWaalsContact O-CD2 3.25Å; I19-Y23 WeakPolarHBondContact O-CD2 3.32Å; I19-Y23 WeakPolarHBondContact O-CE2 3.43Å; S20-Y23 PolarHBondContact O-N 3.36Å; S21-Y23 PolarHBondContact O-N 3.32Å; Y23-G25 PolarHBondContact O-N 2.91Å
24	I	69.8	Low	82	Confident	131 Å²	131	80.1 Å²	80.1	67%	0.672	45%	0.447	S	S	*	.			trans	-64	101.9	171.5	-60.6	165.2	0	0	0	107.4	S21 I22	S21-I24 VanDerWaalsContact O-CD1 3.3Å; S21-I24 WeakPolarHBondContact O-CD1 3.23Å; S21-I24 VanDerWaalsContact O-CG1 3.23Å; S21-I24 WeakPolarHBondContact O-CG1 3.3Å; S21-I24 PolarHBondContact O-N 2.89Å; I22-I24 VanDerWaalsContact C-N 3.3Å; I22-I24 PolarHBondContact O-N 3.49Å
25	G	66.2	Low	82.3	Confident	58 Å²	58	74.5 Å²	74.5	60%	0.598	42%	0.424	S	S	*	.			trans	-63.7	139	-179.4	0	0	0	0	0	111.1	Y23 S27	Y23-G25 PolarHBondContact O-N 2.91Å; G25-S27 PolarHBondContact O-N 3.44Å
26	N	66.9	Low	82.6	Confident	137 Å²	137	77.8 Å²	77.8	73%	0.733	44%	0.437	S	S	*	.			trans	-57	125.7	173.5	-70.9	15.1	0	0	0	109.9	G28	N26-G28 PolarHBondContact O-N 3.37Å
27	S	70.4	Confident	82.8	Confident	124 Å²	124	77.9 Å²	77.9	87%	0.867	44%	0.444	S	S	*	.			trans	-85.9	19.9	173.6	64.6	0	0	0	0	112.8	G25	G25-S27 PolarHBondContact O-N 3.44Å
28	G	79.2	Confident	82.8	Confident	53 Å²	53	73 Å²	73	55%	0.546	42%	0.419	S	S	.	.	S	Bend	trans	-70.6	163.7	179.4	0	0	0	0	0	113	N26 L30	N26-G28 PolarHBondContact O-N 3.37Å; G28-L30 PolarHBondContact O-N 2.65Å
29	A	84.7	Confident	82.2	Confident	53 Å²	53	72.6 Å²	72.6	44%	0.438	42%	0.423	S	S	.	.	P	Polyproline II helix	trans	-57.4	128	165.7	0	0	0	0	0	109.9	K31 N52	A29-K31 PolarHBondContact O-N 3.31Å; A29-N52 HydrophobicContact CB-CB 4.41Å
30	L	92.4	Very high	81.5	Confident	16 Å²	16	73.9 Å²	73.9	8%	0.084	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.4	129.7	-176.6	172.4	66.4	0	0	0	110.5	G28 N52 C53 T97 D100	G28-L30 PolarHBondContact O-N 2.65Å; L30-N52 PolarHBondContact O-N 2.94Å; L30-C53 HydrophobicContact CB-CB 4.42Å; L30-C53 WeakPolarHBondContact CB-O 3.13Å; L30-C53 HydrophobicContact CD2-CB 4.27Å; L30-C53 HydrophobicContact CG-CB 4.3Å; L30-C53 WeakPolarHBondContact O-CB 3.34Å; L30-C53 PolarHBondContact O-N 3.26Å; L30-C53 VanDerWaalsContact O-N 3.09Å; L30-C53 PolarHBondContact O-SG 3.37Å; L30-T97 WeakPolarHBondContact CD1-O 3.44Å; L30-T97 WeakPolarHBondContact CD2-O 3.44Å; L30-D100 WeakPolarHBondContact CA-OD1 3.26Å
31	K	93.2	Very high	80.6	Confident	85 Å²	85	72.2 Å²	72.2	37%	0.37	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.9	139.8	174.6	-50.6	-161.2	172.1	-153.2	0	111.5	A29 I49 G50 D51 C56 D100 L101	A29-K31 PolarHBondContact O-N 3.31Å; K31-I49 HydrophobicContact CB-CG2 4.01Å; K31-I49 HydrophobicContact CD-CG2 4.22Å; K31-G50 CarbonylContact C-O 3.54Å; K31-G50 VanDerWaalsContact CA-O 3.28Å; K31-G50 WeakPolarHBondContact CA-O 3.49Å; K31-D51 WeakPolarHBondContact CD-OD1 3.43Å; K31-D51 WeakPolarHBondContact CE-OD1 3.4Å; K31-D51 WeakPolarHBondContact CG-OD1 3.41Å; K31-D51 IonicContact NZ-OD1 3.31Å; K31-D51 PolarHBondContact NZ-OD1 3Å; K31-D51 IonicContact NZ-OD2 3.96Å; K31-C56 PolarHBondContact O-SG 3.28Å; K31-C56 VanDerWaalsContact O-SG 3.38Å; K31-D100 HydrophobicContact CB-CB 4.17Å; K31-D100 PolarHBondContact N-OD1 3.4Å; K31-L101 HydrophobicContact CB-CD2 4.13Å; K31-L101 WeakPolarHBondContact O-CA 3.47Å; K31-L101 PolarHBondContact O-N 3.24Å
32	C	95.4	Very high	79.8	Confident	0 Å²	0	74.3 Å²	74.3	0%	0	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	146.1	179.3	-57.2	0	0	0	0	111.5	I49 G50 C53 C56 C74	C32-I49 WeakPolarHBondContact O-CA 3.26Å; C32-G50 PolarHBondContact N-O 3.43Å; C32-G50 PolarHBondContact O-N 3.05Å; C32-C53 WeakPolarHBondContact SG-CB 3.36Å; C32-C53 PolarHBondContact SG-SG 2.89Å; C32-C56 WeakPolarHBondContact CA-SG 3.28Å; C32-C56 HydrophobicContact CB-CB 3.65Å; C32-C56 WeakPolarHBondContact CB-SG 3.18Å; C32-C56 WeakPolarHBondContact SG-CA 3.39Å; C32-C56 WeakPolarHBondContact SG-CB 3.41Å; C32-C56 PolarHBondContact SG-N 3.18Å; C32-C56 CovalentContact SG-SG 2.01Å; C32-C56 PolarHBondContact SG-SG 3.26Å; C32-C74 HydrophobicContact CB-CB 4.12Å
33	Y	94.5	Very high	79.2	Confident	24 Å²	24	70 Å²	70	9%	0.094	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.4	136.7	165	-69.1	-67.2	0	0	0	109.9	V41 F47 R72 L101 N103 Q104	Y33-V41 HydrophobicContact CD1-CG1 4.38Å; Y33-V41 HydrophobicContact CD2-CG1 4.46Å; Y33-V41 HydrophobicContact CG-CG1 4.17Å; Y33-F47 AromaticContact CD1-CD2 3.5Å; Y33-F47 HydrophobicContact CD1-CD2 3.5Å; Y33-F47 VanDerWaalsContact CD1-CD2 3.5Å; Y33-F47 AromaticContact CD1-CE2 3.69Å; Y33-F47 HydrophobicContact CD1-CE2 3.69Å; Y33-F47 HydrophobicContact CD1-CG 4.13Å; Y33-F47 HydrophobicContact CD1-CZ 4.44Å; Y33-F47 AromaticContact CE1-CD2 3.81Å; Y33-F47 HydrophobicContact CE1-CD2 3.81Å; Y33-F47 AromaticContact CE1-CE2 3.46Å; Y33-F47 HydrophobicContact CE1-CE2 3.46Å; Y33-F47 VanDerWaalsContact CE1-CE2 3.46Å; Y33-F47 AromaticContact CE1-CZ 3.97Å; Y33-F47 HydrophobicContact CE1-CZ 3.97Å; Y33-R72 CarbonylContact O-C 3.58Å; Y33-R72 VanDerWaalsContact O-CB 3.25Å; Y33-R72 WeakPolarHBondContact O-CB 3.01Å; Y33-L101 HydrophobicContact CD1-CD2 4.24Å; Y33-L101 HydrophobicContact CD2-CB 4.03Å; Y33-L101 HydrophobicContact CD2-CD2 4.16Å; Y33-L101 HydrophobicContact CE1-CD1 4.46Å; Y33-L101 HydrophobicContact CE1-CD2 4.13Å; Y33-L101 HydrophobicContact CE2-CB 3.55Å; Y33-L101 HydrophobicContact CE2-CD1 4.29Å; Y33-L101 HydrophobicContact CE2-CD2 4.07Å; Y33-L101 HydrophobicContact CE2-CG 4.17Å; Y33-L101 HydrophobicContact CG-CD2 4.26Å; Y33-N103 WeakPolarHBondContact CB-OD1 3.47Å; Y33-N103 WeakPolarHBondContact CD2-OD1 3.45Å; Y33-N103 PolarHBondContact N-OD1 3.42Å; Y33-N103 PolarHBondContact O-ND2 3Å; Y33-Q104 HydrophobicContact CD2-CB 4.04Å; Y33-Q104 HydrophobicContact CD2-CG 4.28Å; Y33-Q104 HydrophobicContact CE2-CB 3.61Å; Y33-Q104 HydrophobicContact CE2-CG 3.55Å
34	V	94.5	Very high	78.7	Confident	46 Å²	46	73 Å²	73	28%	0.279	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	118	175.9	-177.3	0	0	0	0	108.8	F47 T48 R72 C74	V34-F47 WeakPolarHBondContact O-CA 3.27Å; V34-T48 PolarHBondContact N-O 3.46Å; V34-T48 PolarHBondContact O-N 3.29Å; V34-R72 WeakPolarHBondContact CA-O 2.93Å; V34-C74 HydrophobicContact CG2-CB 3.71Å
35	C	93.2	Very high	78.5	Confident	11 Å²	11	68.2 Å²	68.2	7%	0.074	41%	0.413	C	S	.	.	B	Isolated β-bridge	trans	-165.2	150.3	177.5	50.8	0	0	0	0	111.8	C38 F47 T71 R72	C35-C38 HydrophobicContact CB-CB 3.6Å; C35-C38 WeakPolarHBondContact CB-SG 3.29Å; C35-C38 WeakPolarHBondContact SG-CB 3.47Å; C35-C38 CovalentContact SG-SG 2.02Å; C35-C38 PolarHBondContact SG-SG 3.4Å; C35-F47 HydrophobicContact CB-CB 3.79Å; C35-T71 WeakPolarHBondContact O-CA 3.25Å; C35-R72 PolarHBondContact N-O 3.4Å; C35-R72 PolarHBondContact O-N 2.87Å
36	Q	90.7	Very high	79.3	Confident	163 Å²	163	73 Å²	73	76%	0.762	43%	0.425	S	S	*	.	S	Bend	trans	-106.5	131.4	175.6	-170.3	171.5	0.7	0	0	109.7	C38	Q36-C38 VanDerWaalsContact C-N 3.27Å; Q36-C38 PolarHBondContact O-N 3.34Å
37	N	87.4	Confident	80.3	Confident	94 Å²	94	70 Å²	70	50%	0.503	41%	0.406	S	S	.	.	S	Bend	trans	53.1	37.8	-179.6	-64.1	-29.7	0	0	0	115	S69 T70	N37-S69 WeakPolarHBondContact OD1-CB 3.35Å; N37-S69 PolarHBondContact OD1-OG 3.38Å; N37-T70 CarbonylContact C-O 3.55Å; N37-T70 VanDerWaalsContact CA-O 3.29Å; N37-T70 WeakPolarHBondContact CA-O 3.25Å; N37-T70 PolarHBondContact N-O 3.09Å
38	C	85.5	Confident	81.4	Confident	6 Å²	6	68.5 Å²	68.5	4%	0.041	39%	0.392	C	S	.	.			trans	-93.8	93.7	175.7	49.4	0	0	0	0	110.8	C35 Q36 N40 A45 T70 R72	C35-C38 HydrophobicContact CB-CB 3.6Å; C35-C38 WeakPolarHBondContact CB-SG 3.29Å; C35-C38 WeakPolarHBondContact SG-CB 3.47Å; C35-C38 CovalentContact SG-SG 2.02Å; C35-C38 PolarHBondContact SG-SG 3.4Å; Q36-C38 VanDerWaalsContact C-N 3.27Å; Q36-C38 PolarHBondContact O-N 3.34Å; C38-N40 VanDerWaalsContact C-N 3.28Å; C38-N40 PolarHBondContact O-N 3.22Å; C38-A45 HydrophobicContact CB-CB 4.15Å; C38-T70 PolarHBondContact N-O 3.47Å; C38-T70 VanDerWaalsContact O-CB 3.29Å; C38-T70 WeakPolarHBondContact O-CB 2.97Å; C38-T70 PolarHBondContact SG-O 2.89Å; C38-T70 VanDerWaalsContact SG-O 3.34Å; C38-R72 PolarHBondContact O-NH1 2.76Å; C38-R72 PolarHBondContact SG-NH1 2.92Å
39	S	72.9	Confident	82	Confident	78 Å²	78	70.2 Å²	70.2	55%	0.545	39%	0.387	S	S	.	.	S	Bend	trans	-60.8	-36.1	179	35.2	0	0	0	0	112.6
40	N	68.5	Low	82.4	Confident	81 Å²	81	68.4 Å²	68.4	43%	0.433	37%	0.373	S	S	.	.			trans	-138.5	131.6	177.4	-163.9	-0.3	0	0	0	112.5	C38 T42 A45	C38-N40 VanDerWaalsContact C-N 3.28Å; C38-N40 PolarHBondContact O-N 3.22Å; N40-T42 VanDerWaalsContact CG-OG1 3.25Å; N40-T42 PolarHBondContact ND2-OG1 2.95Å; N40-T42 PolarHBondContact OD1-N 3.21Å; N40-T42 PolarHBondContact OD1-OG1 3.38Å; N40-T42 VanDerWaalsContact OD1-OG1 3.08Å; N40-A45 VanDerWaalsContact O-CB 3.23Å; N40-A45 WeakPolarHBondContact O-CB 3.42Å
41	V	60.3	Low	82.4	Confident	8 Å²	8	71.9 Å²	71.9	5%	0.048	39%	0.392	C	S	.	.	S	Bend	trans	-86.1	-10.3	175.2	-81.9	0	0	0	0	112.7	Y33 F47 Q104	Y33-V41 HydrophobicContact CD1-CG1 4.38Å; Y33-V41 HydrophobicContact CD2-CG1 4.46Å; Y33-V41 HydrophobicContact CG-CG1 4.17Å; V41-F47 HydrophobicContact CG1-CD1 4.43Å; V41-F47 WeakPolarHBondContact O-CE1 3.08Å; V41-Q104 HydrophobicContact CB-CG 4.46Å; V41-Q104 HydrophobicContact CG2-CB 4.28Å; V41-Q104 HydrophobicContact CG2-CG 3.4Å; V41-Q104 VanDerWaalsContact CG2-CG 3.4Å
42	T	62.7	Low	82.2	Confident	105 Å²	105	73.7 Å²	73.7	64%	0.644	41%	0.406	S	S	*	.	S	Bend	trans	-85.4	-11.6	172.8	67.4	0	0	0	0	113.2	N40	N40-T42 VanDerWaalsContact CG-OG1 3.25Å; N40-T42 PolarHBondContact ND2-OG1 2.95Å; N40-T42 PolarHBondContact OD1-N 3.21Å; N40-T42 PolarHBondContact OD1-OG1 3.38Å; N40-T42 VanDerWaalsContact OD1-OG1 3.08Å
43	G	64	Low	82.1	Confident	41 Å²	41	74.1 Å²	74.1	42%	0.423	41%	0.409	S	S	.	.	S	Bend	trans	-94	-172.3	179	0	0	0	0	0	113.7	A45	G43-A45 PolarHBondContact O-N 2.99Å
44	K	60.9	Low	82.1	Confident	220 Å²	220	79.2 Å²	79.2	96%	0.957	43%	0.431	S	S	*	.	S	Bend	trans	-67.4	35.1	171.5	-78.3	-174.9	173.5	-178.9	0	113.7
45	A	66.5	Low	82.1	Confident	29 Å²	29	79.2 Å²	79.2	24%	0.24	43%	0.428	C	S	.	.			trans	-75.9	135.1	175.1	0	0	0	0	0	109.6	C38 N40 G43 F47	C38-A45 HydrophobicContact CB-CB 4.15Å; N40-A45 VanDerWaalsContact O-CB 3.23Å; N40-A45 WeakPolarHBondContact O-CB 3.42Å; G43-A45 PolarHBondContact O-N 2.99Å; A45-F47 VanDerWaalsContact O-CD1 3.28Å; A45-F47 WeakPolarHBondContact O-CD1 3.43Å; A45-F47 PolarHBondContact O-N 3.37Å
46	N	81.1	Confident	82.2	Confident	160 Å²	160	78.7 Å²	78.7	86%	0.856	42%	0.424	S	S	*	.			trans	-70	101.2	168.3	-68.6	-17.3	0	0	0	108.1
47	F	88.7	Confident	82.4	Confident	74 Å²	74	72.6 Å²	72.6	33%	0.325	40%	0.396	S	S	.	.			trans	-124.6	152.4	169.8	66.3	-98.4	0	0	0	109.7	Y33 V34 C35 V41 A45	Y33-F47 AromaticContact CD1-CD2 3.5Å; Y33-F47 HydrophobicContact CD1-CD2 3.5Å; Y33-F47 VanDerWaalsContact CD1-CD2 3.5Å; Y33-F47 AromaticContact CD1-CE2 3.69Å; Y33-F47 HydrophobicContact CD1-CE2 3.69Å; Y33-F47 HydrophobicContact CD1-CG 4.13Å; Y33-F47 HydrophobicContact CD1-CZ 4.44Å; Y33-F47 AromaticContact CE1-CD2 3.81Å; Y33-F47 HydrophobicContact CE1-CD2 3.81Å; Y33-F47 AromaticContact CE1-CE2 3.46Å; Y33-F47 HydrophobicContact CE1-CE2 3.46Å; Y33-F47 VanDerWaalsContact CE1-CE2 3.46Å; Y33-F47 AromaticContact CE1-CZ 3.97Å; Y33-F47 HydrophobicContact CE1-CZ 3.97Å; V34-F47 WeakPolarHBondContact O-CA 3.27Å; C35-F47 HydrophobicContact CB-CB 3.79Å; V41-F47 HydrophobicContact CG1-CD1 4.43Å; V41-F47 WeakPolarHBondContact O-CE1 3.08Å; A45-F47 VanDerWaalsContact O-CD1 3.28Å; A45-F47 WeakPolarHBondContact O-CD1 3.43Å; A45-F47 PolarHBondContact O-N 3.37Å
48	T	92.8	Very high	82.8	Confident	92 Å²	92	69 Å²	69	56%	0.564	38%	0.375	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.3	163.3	168.4	57.9	0	0	0	0	109.5	V34	V34-T48 PolarHBondContact N-O 3.46Å; V34-T48 PolarHBondContact O-N 3.29Å
49	I	93	Very high	83.2	Confident	89 Å²	89	70 Å²	70	46%	0.456	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	115	172.8	-61.8	175.9	0	0	0	106.5	K31 C32 L101	K31-I49 HydrophobicContact CB-CG2 4.01Å; K31-I49 HydrophobicContact CD-CG2 4.22Å; C32-I49 WeakPolarHBondContact O-CA 3.26Å; I49-L101 HydrophobicContact CG1-CD2 4.42Å; I49-L101 HydrophobicContact CG2-CD2 4.14Å
50	G	92.7	Very high	84.1	Confident	14 Å²	14	67.4 Å²	67.4	14%	0.144	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	133.7	169.3	0	0	0	0	0	109.6	K31 C32 C53	K31-G50 CarbonylContact C-O 3.54Å; K31-G50 VanDerWaalsContact CA-O 3.28Å; K31-G50 WeakPolarHBondContact CA-O 3.49Å; C32-G50 PolarHBondContact N-O 3.43Å; C32-G50 PolarHBondContact O-N 3.05Å; G50-C53 PolarHBondContact O-SG 3.31Å; G50-C53 VanDerWaalsContact O-SG 3.4Å
51	D	91.3	Very high	85.3	Confident	90 Å²	90	67.7 Å²	67.7	48%	0.481	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	165.3	173.8	-71.3	-36.2	0	0	0	110.1	K31 C53	K31-D51 WeakPolarHBondContact CD-OD1 3.43Å; K31-D51 WeakPolarHBondContact CE-OD1 3.4Å; K31-D51 WeakPolarHBondContact CG-OD1 3.41Å; K31-D51 IonicContact NZ-OD1 3.31Å; K31-D51 PolarHBondContact NZ-OD1 3Å; K31-D51 IonicContact NZ-OD2 3.96Å; D51-C53 PolarHBondContact O-N 3.24Å
52	N	90.4	Very high	86.8	Confident	123 Å²	123	68.8 Å²	68.8	66%	0.658	36%	0.362	S	S	*	.	E	Extended strand (participates in β ladder)	trans	58.6	32.3	-179.7	-158.9	40.8	0	0	0	114.4	A29 L30	A29-N52 HydrophobicContact CB-CB 4.41Å; L30-N52 PolarHBondContact O-N 2.94Å
53	C	92.7	Very high	88.4	Confident	9 Å²	9	68.2 Å²	68.2	6%	0.061	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	151.8	174.2	-44.8	0	0	0	0	109.8	L30 C32 G50 D51 C74	L30-C53 HydrophobicContact CB-CB 4.42Å; L30-C53 WeakPolarHBondContact CB-O 3.13Å; L30-C53 HydrophobicContact CD2-CB 4.27Å; L30-C53 HydrophobicContact CG-CB 4.3Å; L30-C53 WeakPolarHBondContact O-CB 3.34Å; L30-C53 PolarHBondContact O-N 3.26Å; L30-C53 VanDerWaalsContact O-N 3.09Å; L30-C53 PolarHBondContact O-SG 3.37Å; C32-C53 WeakPolarHBondContact SG-CB 3.36Å; C32-C53 PolarHBondContact SG-SG 2.89Å; G50-C53 PolarHBondContact O-SG 3.31Å; G50-C53 VanDerWaalsContact O-SG 3.4Å; D51-C53 PolarHBondContact O-N 3.24Å; C53-C74 VanDerWaalsContact CA-SG 3.53Å; C53-C74 HydrophobicContact CB-CB 4.12Å; C53-C74 WeakPolarHBondContact CB-SG 3.17Å; C53-C74 WeakPolarHBondContact SG-CB 3.43Å; C53-C74 CovalentContact SG-SG 2.01Å; C53-C74 PolarHBondContact SG-SG 3.45Å
54	K	93.7	Very high	89.7	Confident	130 Å²	130	71.5 Å²	71.5	57%	0.565	36%	0.358	S	S	*	.	S	Bend	trans	-93.6	-34.4	164.3	-167.7	177.5	176.2	177.1	0	110.9	L75 T76 T97	K54-L75 WeakPolarHBondContact CA-O 3.05Å; K54-L75 PolarHBondContact N-O 3.42Å; K54-T76 WeakPolarHBondContact CB-O 3.49Å; K54-T76 VanDerWaalsContact CD-O 3.26Å; K54-T76 WeakPolarHBondContact CD-O 3.31Å; K54-T97 WeakPolarHBondContact O-CG2 3.17Å
55	F	95.2	Very high	91.1	Very high	47 Å²	47	64.1 Å²	64.1	21%	0.206	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.1	143.5	176.6	-55.7	-94.8	0	0	0	110.6	L75 D77 C79 C96 T97	F55-L75 HydrophobicContact CB-CB 4.4Å; F55-L75 PolarHBondContact N-O 3.32Å; F55-L75 PolarHBondContact O-N 3.14Å; F55-D77 WeakPolarHBondContact CD2-O 2.99Å; F55-D77 WeakPolarHBondContact CE2-O 3.04Å; F55-C79 HydrophobicContact CB-CB 3.73Å; F55-C79 HydrophobicContact CD1-CB 4.16Å; F55-C79 HydrophobicContact CD2-CB 4.41Å; F55-C79 HydrophobicContact CG-CB 3.87Å; F55-C96 WeakPolarHBondContact CA-O 3.38Å; F55-T97 HydrophobicContact CD1-CG2 3.27Å; F55-T97 HydrophobicContact CE1-CG2 3.48Å; F55-T97 VanDerWaalsContact CE1-CG2 3.48Å; F55-T97 HydrophobicContact CG-CG2 4.15Å; F55-T97 HydrophobicContact CZ-CG2 4.5Å
56	C	95.4	Very high	92.3	Very high	0 Å²	0	70.4 Å²	70.4	0%	0	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	130.3	162.1	-48.8	0	0	0	0	109.4	K31 C32 C95 C96 C102 N103	K31-C56 PolarHBondContact O-SG 3.28Å; K31-C56 VanDerWaalsContact O-SG 3.38Å; C32-C56 WeakPolarHBondContact CA-SG 3.28Å; C32-C56 HydrophobicContact CB-CB 3.65Å; C32-C56 WeakPolarHBondContact CB-SG 3.18Å; C32-C56 WeakPolarHBondContact SG-CA 3.39Å; C32-C56 WeakPolarHBondContact SG-CB 3.41Å; C32-C56 PolarHBondContact SG-N 3.18Å; C32-C56 CovalentContact SG-SG 2.01Å; C32-C56 PolarHBondContact SG-SG 3.26Å; C56-C95 WeakPolarHBondContact O-CA 3.04Å; C56-C96 PolarHBondContact N-O 3.45Å; C56-C96 PolarHBondContact O-N 2.02Å; C56-C102 VanDerWaalsContact CB-SG 3.57Å; C56-C102 PolarHBondContact SG-SG 3.16Å; C56-N103 HydrophobicContact CB-CB 3.73Å
57	Q	95.8	Very high	92.7	Very high	34 Å²	34	67.3 Å²	67.3	16%	0.159	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	144.3	174.5	-171.2	-179.3	66.7	0	0	110.3	I59 R72 S73 L75 T93 T94 N103	Q57-I59 HydrophobicContact CG-CG1 4.09Å; Q57-R72 VanDerWaalsContact O-CA 3.29Å; Q57-R72 WeakPolarHBondContact O-CA 3.49Å; Q57-S73 PolarHBondContact N-O 3.29Å; Q57-S73 PolarHBondContact O-N 3.32Å; Q57-L75 HydrophobicContact CB-CD1 3.74Å; Q57-L75 HydrophobicContact CB-CG 4.24Å; Q57-L75 HydrophobicContact CG-CD1 4.31Å; Q57-T93 HydrophobicContact CG-CG2 3.9Å; Q57-T94 CarbonylContact C-O 3.56Å; Q57-T94 WeakPolarHBondContact CA-O 3.43Å; Q57-N103 PolarHBondContact O-ND2 3.08Å; Q57-N103 VanDerWaalsContact O-ND2 3.1Å
58	K	94	Very high	92.8	Very high	18 Å²	18	67.9 Å²	67.9	8%	0.078	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	122.2	166.3	173.9	-175.9	-178	176.5	0	109.3	V60 T70 T71 R72 T93 T94 N103 S105	K58-V60 HydrophobicContact CD-CG2 4.34Å; K58-V60 HydrophobicContact CG-CG2 4.14Å; K58-T70 HydrophobicContact CD-CG2 4.48Å; K58-T70 HydrophobicContact CG-CG2 3.89Å; K58-T71 CarbonylContact C-O 3.58Å; K58-T71 WeakPolarHBondContact CA-O 3.43Å; K58-R72 HydrophobicContact CB-CG 4.44Å; K58-R72 HydrophobicContact CG-CG 4.42Å; K58-T93 WeakPolarHBondContact O-CA 3.46Å; K58-T94 WeakPolarHBondContact CB-OG1 3.04Å; K58-T94 PolarHBondContact N-O 2.85Å; K58-T94 PolarHBondContact O-N 3.06Å; K58-T94 PolarHBondContact O-OG1 2.92Å; K58-T94 VanDerWaalsContact O-OG1 3.06Å; K58-N103 HydrophobicContact CB-CB 4.1Å; K58-S105 PolarHBondContact NZ-O 2.91Å
59	I	93.9	Very high	92.7	Very high	28 Å²	28	63.9 Å²	63.9	14%	0.144	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	116.3	175.1	-55.8	174.5	0	0	0	107.9	Q57 R61 T70 T71 I92 T93	Q57-I59 HydrophobicContact CG-CG1 4.09Å; I59-R61 HydrophobicContact CG2-CG 4.28Å; I59-T70 CarbonylContact O-C 3.51Å; I59-T70 VanDerWaalsContact O-CA 3.23Å; I59-T70 WeakPolarHBondContact O-CA 3.09Å; I59-T71 PolarHBondContact N-O 3.41Å; I59-T71 PolarHBondContact O-N 3.36Å; I59-I92 CarbonylContact C-O 3.51Å; I59-I92 VanDerWaalsContact CA-O 3.31Å; I59-I92 WeakPolarHBondContact CA-O 3.36Å; I59-T93 HydrophobicContact CG1-CG2 4.17Å
60	V	92.7	Very high	92.7	Very high	24 Å²	24	59.8 Å²	59.8	15%	0.145	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	120.3	173.6	-179.6	0	0	0	0	108.1	K58 L62 L67 T70 N91 I92	K58-V60 HydrophobicContact CD-CG2 4.34Å; K58-V60 HydrophobicContact CG-CG2 4.14Å; V60-L62 HydrophobicContact CG1-CD2 3.77Å; V60-L62 HydrophobicContact CG1-CG 4.29Å; V60-L67 HydrophobicContact CG1-CD1 3.53Å; V60-T70 HydrophobicContact CG2-CG2 4.3Å; V60-N91 WeakPolarHBondContact O-CA 3.49Å; V60-I92 HydrophobicContact CB-CB 4.35Å; V60-I92 PolarHBondContact N-O 3.39Å; V60-I92 PolarHBondContact O-N 2.01Å
61	R	93	Very high	92.7	Very high	87 Å²	87	60 Å²	60	33%	0.328	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	122.2	174.9	-57.9	-156.7	172.7	101.9	-4.5	109.4	I59 N68 S69 N91	I59-R61 HydrophobicContact CG2-CG 4.28Å; R61-N68 WeakPolarHBondContact O-CA 3.11Å; R61-N68 WeakPolarHBondContact O-CB 2.92Å; R61-N68 PolarHBondContact O-N 3.31Å; R61-S69 PolarHBondContact N-O 3.36Å; R61-S69 PolarHBondContact O-N 3.27Å; R61-S69 VanDerWaalsContact O-N 3.13Å; R61-N91 WeakPolarHBondContact CD-OD1 3.31Å; R61-N91 WeakPolarHBondContact CG-OD1 3.5Å
62	L	93.3	Very high	92.8	Very high	31 Å²	31	56 Å²	56	16%	0.162	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	141.1	175.2	-51.5	178.4	0	0	0	109.3	V60 F66 L67 W89 L90 I92	V60-L62 HydrophobicContact CG1-CD2 3.77Å; V60-L62 HydrophobicContact CG1-CG 4.29Å; L62-F66 CarbonylContact C-O 3.57Å; L62-F66 WeakPolarHBondContact CA-O 3.03Å; L62-L67 HydrophobicContact CD2-CB 4.21Å; L62-L67 HydrophobicContact CD2-CD1 4.05Å; L62-W89 CarbonylContact O-C 3.57Å; L62-W89 VanDerWaalsContact O-CA 3.31Å; L62-W89 WeakPolarHBondContact O-CA 3.41Å; L62-L90 HydrophobicContact CB-CB 4.24Å; L62-L90 HydrophobicContact CD1-CD2 4.03Å; L62-L90 HydrophobicContact CD1-CG 4.41Å; L62-L90 PolarHBondContact N-O 2.96Å; L62-L90 PolarHBondContact O-N 3.49Å; L62-I92 HydrophobicContact CD1-CD1 4.11Å
63	K	94.4	Very high	93.1	Very high	93 Å²	93	51.6 Å²	51.6	40%	0.404	27%	0.266	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	121.6	171.5	-169.1	-173.9	-176.8	-179.4	0	108.1	G65 F66 N68 P88 W89	K63-G65 PolarHBondContact O-N 2.77Å; K63-F66 PolarHBondContact N-O 2.65Å; K63-F66 PolarHBondContact O-N 2.93Å; K63-N68 HydrophobicContact CB-CB 4.15Å; K63-P88 CarbonylContact C-O 3.38Å; K63-P88 WeakPolarHBondContact CA-O 3.48Å; K63-P88 HydrophobicContact CG-CB 4.33Å; K63-P88 HydrophobicContact CG-CG 4.3Å; K63-W89 HydrophobicContact CB-CD2 4.47Å; K63-W89 HydrophobicContact CB-CE3 3.79Å; K63-W89 HydrophobicContact CB-CH2 4.03Å; K63-W89 HydrophobicContact CB-CZ3 3.55Å; K63-W89 HydrophobicContact CD-CH2 3.62Å; K63-W89 HydrophobicContact CD-CZ2 3.87Å; K63-W89 HydrophobicContact CD-CZ3 4.07Å; K63-W89 HydrophobicContact CG-CD2 4.3Å; K63-W89 HydrophobicContact CG-CE3 4.08Å; K63-W89 HydrophobicContact CG-CH2 3.9Å; K63-W89 HydrophobicContact CG-CZ2 4.1Å; K63-W89 HydrophobicContact CG-CZ3 3.89Å
64	N	93.3	Very high	93.3	Very high	110 Å²	110	53 Å²	53	59%	0.588	28%	0.276	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.6	35.7	-175.1	-62.5	-29	0	0	0	112.7	F66 P88	N64-F66 HydrophobicContact CB-CD2 4.37Å; N64-F66 WeakPolarHBondContact O-CD2 3.49Å; N64-F66 PolarHBondContact O-N 3.31Å; N64-P88 PolarHBondContact N-O 3.38Å; N64-P88 WeakPolarHBondContact OD1-CB 3.49Å
65	G	89.9	Confident	93.4	Very high	64 Å²	64	49 Å²	49	66%	0.66	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.8	-9.7	-176.3	0	0	0	0	0	115.5	K63	K63-G65 PolarHBondContact O-N 2.77Å
66	F	91	Very high	93.3	Very high	162 Å²	162	50.9 Å²	50.9	71%	0.711	28%	0.276	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.7	142.4	178.2	-63.9	-83.6	0	0	0	111.9	L62 K63 N64 N68	L62-F66 CarbonylContact C-O 3.57Å; L62-F66 WeakPolarHBondContact CA-O 3.03Å; K63-F66 PolarHBondContact N-O 2.65Å; K63-F66 PolarHBondContact O-N 2.93Å; N64-F66 HydrophobicContact CB-CD2 4.37Å; N64-F66 WeakPolarHBondContact O-CD2 3.49Å; N64-F66 PolarHBondContact O-N 3.31Å; F66-N68 PolarHBondContact O-N 3.29Å
67	L	89.8	Confident	93	Very high	95 Å²	95	56.6 Å²	56.6	50%	0.497	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.8	111.5	175.5	-179.9	64.9	0	0	0	110.5	V60 L62	V60-L67 HydrophobicContact CG1-CD1 3.53Å; L62-L67 HydrophobicContact CD2-CB 4.21Å; L62-L67 HydrophobicContact CD2-CD1 4.05Å
68	N	91.2	Very high	92.9	Very high	85 Å²	85	60.7 Å²	60.7	46%	0.455	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	-52.6	176.6	-179.8	84.9	0	0	0	111	R61 K63 F66 W89	R61-N68 WeakPolarHBondContact O-CA 3.11Å; R61-N68 WeakPolarHBondContact O-CB 2.92Å; R61-N68 PolarHBondContact O-N 3.31Å; K63-N68 HydrophobicContact CB-CB 4.15Å; F66-N68 PolarHBondContact O-N 3.29Å; N68-W89 HydrophobicContact CB-CZ3 3.92Å
69	S	90.4	Very high	93	Very high	8 Å²	8	60.8 Å²	60.8	6%	0.056	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	162.9	176.8	79.4	0	0	0	0	112.8	N37 R61	N37-S69 WeakPolarHBondContact OD1-CB 3.35Å; N37-S69 PolarHBondContact OD1-OG 3.38Å; R61-S69 PolarHBondContact N-O 3.36Å; R61-S69 PolarHBondContact O-N 3.27Å; R61-S69 VanDerWaalsContact O-N 3.13Å
70	T	91.8	Very high	93	Very high	4 Å²	4	64.4 Å²	64.4	3%	0.025	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	134.7	171	-66.4	0	0	0	0	109.2	N37 C38 K58 I59 V60 R72	N37-T70 CarbonylContact C-O 3.55Å; N37-T70 VanDerWaalsContact CA-O 3.29Å; N37-T70 WeakPolarHBondContact CA-O 3.25Å; N37-T70 PolarHBondContact N-O 3.09Å; C38-T70 PolarHBondContact N-O 3.47Å; C38-T70 VanDerWaalsContact O-CB 3.29Å; C38-T70 WeakPolarHBondContact O-CB 2.97Å; C38-T70 PolarHBondContact SG-O 2.89Å; C38-T70 VanDerWaalsContact SG-O 3.34Å; K58-T70 HydrophobicContact CD-CG2 4.48Å; K58-T70 HydrophobicContact CG-CG2 3.89Å; I59-T70 CarbonylContact O-C 3.51Å; I59-T70 VanDerWaalsContact O-CA 3.23Å; I59-T70 WeakPolarHBondContact O-CA 3.09Å; V60-T70 HydrophobicContact CG2-CG2 4.3Å; T70-R72 HydrophobicContact CG2-CG 4.37Å
71	T	93.1	Very high	93.1	Very high	19 Å²	19	68.2 Å²	68.2	12%	0.117	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	139.7	176.1	-58.1	0	0	0	0	108.2	C35 K58 I59	C35-T71 WeakPolarHBondContact O-CA 3.25Å; K58-T71 CarbonylContact C-O 3.58Å; K58-T71 WeakPolarHBondContact CA-O 3.43Å; I59-T71 PolarHBondContact N-O 3.41Å; I59-T71 PolarHBondContact O-N 3.36Å
72	R	94.5	Very high	93.1	Very high	5 Å²	5	65.9 Å²	65.9	2%	0.019	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	138.4	179.5	-66.1	-177.4	179.9	75	-2.6	109.3	Y33 V34 C35 C38 Q57 K58 T70 N103 Q104	Y33-R72 CarbonylContact O-C 3.58Å; Y33-R72 VanDerWaalsContact O-CB 3.25Å; Y33-R72 WeakPolarHBondContact O-CB 3.01Å; V34-R72 WeakPolarHBondContact CA-O 2.93Å; C35-R72 PolarHBondContact N-O 3.4Å; C35-R72 PolarHBondContact O-N 2.87Å; C38-R72 PolarHBondContact O-NH1 2.76Å; C38-R72 PolarHBondContact SG-NH1 2.92Å; Q57-R72 VanDerWaalsContact O-CA 3.29Å; Q57-R72 WeakPolarHBondContact O-CA 3.49Å; K58-R72 HydrophobicContact CB-CG 4.44Å; K58-R72 HydrophobicContact CG-CG 4.42Å; T70-R72 HydrophobicContact CG2-CG 4.37Å; R72-N103 WeakPolarHBondContact CD-O 3.01Å; R72-N103 PolarHBondContact NE-O 3.39Å; R72-Q104 PolarHBondContact NH2-O 2.88Å
73	S	95.6	Very high	93.2	Very high	30 Å²	30	70.1 Å²	70.1	21%	0.21	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.1	149.9	-173.9	-54.4	0	0	0	0	111.7	Q57	Q57-S73 PolarHBondContact N-O 3.29Å; Q57-S73 PolarHBondContact O-N 3.32Å
74	C	96.6	Very high	93.2	Very high	40 Å²	40	72.2 Å²	72.2	27%	0.27	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.7	121.4	167.7	172	0	0	0	0	107.4	C32 V34 C53	C32-C74 HydrophobicContact CB-CB 4.12Å; V34-C74 HydrophobicContact CG2-CB 3.71Å; C53-C74 VanDerWaalsContact CA-SG 3.53Å; C53-C74 HydrophobicContact CB-CB 4.12Å; C53-C74 WeakPolarHBondContact CB-SG 3.17Å; C53-C74 WeakPolarHBondContact SG-CB 3.43Å; C53-C74 CovalentContact SG-SG 2.01Å; C53-C74 PolarHBondContact SG-SG 3.45Å
75	L	96.2	Very high	93.1	Very high	44 Å²	44	71.3 Å²	71.3	23%	0.23	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	132.9	-177.6	-59	178.7	0	0	0	110.1	K54 F55 Q57 C79	K54-L75 WeakPolarHBondContact CA-O 3.05Å; K54-L75 PolarHBondContact N-O 3.42Å; F55-L75 HydrophobicContact CB-CB 4.4Å; F55-L75 PolarHBondContact N-O 3.32Å; F55-L75 PolarHBondContact O-N 3.14Å; Q57-L75 HydrophobicContact CB-CD1 3.74Å; Q57-L75 HydrophobicContact CB-CG 4.24Å; Q57-L75 HydrophobicContact CG-CD1 4.31Å; L75-C79 HydrophobicContact CD1-CB 3.82Å
76	T	92.4	Very high	93.2	Very high	87 Å²	87	75.2 Å²	75.2	53%	0.534	41%	0.412	S	S	.	.	S	Bend	trans	-89.3	-24.4	170.1	50.3	0	0	0	0	112.1	K54	K54-T76 WeakPolarHBondContact CB-O 3.49Å; K54-T76 VanDerWaalsContact CD-O 3.26Å; K54-T76 WeakPolarHBondContact CD-O 3.31Å
77	D	91.1	Very high	93.2	Very high	120 Å²	120	73.1 Å²	73.1	64%	0.642	42%	0.417	S	S	*	.	S	Bend	trans	-93.3	-159.7	-179	-59.5	-32.9	0	0	0	111.7	F55	F55-D77 WeakPolarHBondContact CD2-O 2.99Å; F55-D77 WeakPolarHBondContact CE2-O 3.04Å
78	T	93.8	Very high	93.3	Very high	120 Å²	120	70.9 Å²	70.9	74%	0.736	41%	0.408	S	S	*	.			trans	-71.7	145.9	-179.4	58.2	0	0	0	0	112.6
79	C	94.7	Very high	93.5	Very high	20 Å²	20	71 Å²	71	14%	0.135	40%	0.403	C	S	.	.			trans	-127.1	126.5	168.9	-168.1	0	0	0	0	109.2	F55 L75 C95	F55-C79 HydrophobicContact CB-CB 3.73Å; F55-C79 HydrophobicContact CD1-CB 4.16Å; F55-C79 HydrophobicContact CD2-CB 4.41Å; F55-C79 HydrophobicContact CG-CB 3.87Å; L75-C79 HydrophobicContact CD1-CB 3.82Å; C79-C95 HydrophobicContact CB-CB 3.62Å; C79-C95 WeakPolarHBondContact CB-SG 3.2Å; C79-C95 WeakPolarHBondContact SG-CB 3.37Å; C79-C95 CovalentContact SG-SG 2.02Å; C79-C95 PolarHBondContact SG-SG 2.97Å
80	V	94.6	Very high	93.7	Very high	104 Å²	104	73.3 Å²	73.3	63%	0.63	41%	0.414	S	S	*	.			trans	-116.2	124.4	-179.2	-178	0	0	0	0	109.8	S82 C95	V80-S82 PolarHBondContact O-N 2.95Å; V80-C95 VanDerWaalsContact C-SG 3.57Å; V80-C95 PolarHBondContact N-SG 3.11Å; V80-C95 VanDerWaalsContact N-SG 3.37Å
81	N	93.6	Very high	93.8	Very high	105 Å²	105	75.2 Å²	75.2	56%	0.561	42%	0.424	S	S	*	.			trans	-62.8	129.5	170.9	-70.5	-3	0	0	0	109.1	T93 C95	N81-T93 VanDerWaalsContact CA-O 3.31Å; N81-T93 WeakPolarHBondContact CA-O 3.42Å; N81-C95 WeakPolarHBondContact OD1-CB 3.23Å; N81-C95 PolarHBondContact OD1-N 2.84Å; N81-C95 PolarHBondContact OD1-SG 3.37Å
82	S	94.9	Very high	93.9	Very high	38 Å²	38	76.6 Å²	76.6	27%	0.266	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153	146.4	-179.4	55.2	0	0	0	0	111.6	V80 T93	V80-S82 PolarHBondContact O-N 2.95Å; S82-T93 PolarHBondContact N-O 2.9Å; S82-T93 VanDerWaalsContact N-O 3.11Å; S82-T93 PolarHBondContact O-N 3.03Å; S82-T93 WeakPolarHBondContact OG-CB 3.29Å; S82-T93 PolarHBondContact OG-OG1 2.87Å
83	N	93.9	Very high	93.9	Very high	120 Å²	120	77.1 Å²	77.1	64%	0.642	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.2	107.7	172.6	-67.2	-17.8	0	0	0	107.5	N91 I92	N83-N91 CarbonylContact C-O 3.46Å; N83-N91 WeakPolarHBondContact CA-O 3.37Å; N83-I92 WeakPolarHBondContact OD1-CG2 3.36Å
84	K	94.1	Very high	93.8	Very high	136 Å²	136	78.5 Å²	78.5	59%	0.591	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105	121	177.6	-62.6	-174.7	179.9	-173.5	0	108.9	L90 N91	K84-L90 CarbonylContact O-C 3.39Å; K84-L90 WeakPolarHBondContact O-CA 3.47Å; K84-N91 HydrophobicContact CB-CB 4.41Å; K84-N91 PolarHBondContact N-O 2.81Å; K84-N91 PolarHBondContact O-N 2.03Å
85	S	92.9	Very high	93.7	Very high	92 Å²	92	77.8 Å²	77.8	64%	0.643	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.3	122.7	177.5	-170.2	0	0	0	0	109.8	W89	S85-W89 WeakPolarHBondContact CA-O 3.25Å
86	E	91.7	Very high	93.6	Very high	146 Å²	146	76.4 Å²	76.4	68%	0.682	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-138.3	93.1	173.6	-76.5	174.9	-162.3	0	0	106.3	W89	E86-W89 CarbonylContact C-O 3.5Å; E86-W89 PolarHBondContact N-O 2.01Å; E86-W89 VanDerWaalsContact O-CA 3.29Å; E86-W89 WeakPolarHBondContact O-CA 3.46Å; E86-W89 VanDerWaalsContact O-CB 3.27Å; E86-W89 WeakPolarHBondContact O-CB 3.28Å; E86-W89 PolarHBondContact O-N 3.49Å
87	S	90	Very high	93.5	Very high	118 Å²	118	75.6 Å²	75.6	83%	0.825	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47.2	128.4	-174.4	-170.7	0	0	0	0	111.5
88	P	93	Very high	93.3	Very high	47 Å²	47	76.7 Å²	76.7	31%	0.305	42%	0.424	S	S	.	.	T	Hydrogen-bonded Turn	cis	-87.3	6.3	11.7	34.4	-36.7	0	0	0	115.6	K63 N64	K63-P88 CarbonylContact C-O 3.38Å; K63-P88 WeakPolarHBondContact CA-O 3.48Å; K63-P88 HydrophobicContact CG-CB 4.33Å; K63-P88 HydrophobicContact CG-CG 4.3Å; N64-P88 PolarHBondContact N-O 3.38Å; N64-P88 WeakPolarHBondContact OD1-CB 3.49Å
89	W	95	Very high	93	Very high	88 Å²	88	75.3 Å²	75.3	33%	0.333	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	145	-169.5	-56.9	100.9	0	0	0	113.9	L62 K63 N68 S85 E86	L62-W89 CarbonylContact O-C 3.57Å; L62-W89 VanDerWaalsContact O-CA 3.31Å; L62-W89 WeakPolarHBondContact O-CA 3.41Å; K63-W89 HydrophobicContact CB-CD2 4.47Å; K63-W89 HydrophobicContact CB-CE3 3.79Å; K63-W89 HydrophobicContact CB-CH2 4.03Å; K63-W89 HydrophobicContact CB-CZ3 3.55Å; K63-W89 HydrophobicContact CD-CH2 3.62Å; K63-W89 HydrophobicContact CD-CZ2 3.87Å; K63-W89 HydrophobicContact CD-CZ3 4.07Å; K63-W89 HydrophobicContact CG-CD2 4.3Å; K63-W89 HydrophobicContact CG-CE3 4.08Å; K63-W89 HydrophobicContact CG-CH2 3.9Å; K63-W89 HydrophobicContact CG-CZ2 4.1Å; K63-W89 HydrophobicContact CG-CZ3 3.89Å; N68-W89 HydrophobicContact CB-CZ3 3.92Å; S85-W89 WeakPolarHBondContact CA-O 3.25Å; E86-W89 CarbonylContact C-O 3.5Å; E86-W89 PolarHBondContact N-O 2.01Å; E86-W89 VanDerWaalsContact O-CA 3.29Å; E86-W89 WeakPolarHBondContact O-CA 3.46Å; E86-W89 VanDerWaalsContact O-CB 3.27Å; E86-W89 WeakPolarHBondContact O-CB 3.28Å; E86-W89 PolarHBondContact O-N 3.49Å
90	L	95	Very high	92.8	Very high	56 Å²	56	77.3 Å²	77.3	29%	0.293	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	118.5	168.4	170.7	60.4	0	0	0	109.1	L62 K84 I92	L62-L90 HydrophobicContact CB-CB 4.24Å; L62-L90 HydrophobicContact CD1-CD2 4.03Å; L62-L90 HydrophobicContact CD1-CG 4.41Å; L62-L90 PolarHBondContact N-O 2.96Å; L62-L90 PolarHBondContact O-N 3.49Å; K84-L90 CarbonylContact O-C 3.39Å; K84-L90 WeakPolarHBondContact O-CA 3.47Å; L90-I92 HydrophobicContact CD1-CG1 4.29Å; L90-I92 HydrophobicContact CD2-CD1 4.25Å; L90-I92 HydrophobicContact CD2-CG1 4.48Å; L90-I92 HydrophobicContact CG-CD1 4.32Å; L90-I92 HydrophobicContact CG-CG1 4.09Å
91	N	94.2	Very high	92.6	Very high	45 Å²	45	74.4 Å²	74.4	24%	0.241	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	113.6	179.2	-65.2	-28.3	0	0	0	109.6	V60 R61 N83 K84	V60-N91 WeakPolarHBondContact O-CA 3.49Å; R61-N91 WeakPolarHBondContact CD-OD1 3.31Å; R61-N91 WeakPolarHBondContact CG-OD1 3.5Å; N83-N91 CarbonylContact C-O 3.46Å; N83-N91 WeakPolarHBondContact CA-O 3.37Å; K84-N91 HydrophobicContact CB-CB 4.41Å; K84-N91 PolarHBondContact N-O 2.81Å; K84-N91 PolarHBondContact O-N 2.03Å
92	I	94.2	Very high	92.5	Very high	48 Å²	48	70 Å²	70	25%	0.246	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	114.2	179.4	-62.4	168	0	0	0	108.3	I59 V60 L62 N83 L90 T94	I59-I92 CarbonylContact C-O 3.51Å; I59-I92 VanDerWaalsContact CA-O 3.31Å; I59-I92 WeakPolarHBondContact CA-O 3.36Å; V60-I92 HydrophobicContact CB-CB 4.35Å; V60-I92 PolarHBondContact N-O 3.39Å; V60-I92 PolarHBondContact O-N 2.01Å; L62-I92 HydrophobicContact CD1-CD1 4.11Å; N83-I92 WeakPolarHBondContact OD1-CG2 3.36Å; L90-I92 HydrophobicContact CD1-CG1 4.29Å; L90-I92 HydrophobicContact CD2-CD1 4.25Å; L90-I92 HydrophobicContact CD2-CG1 4.48Å; L90-I92 HydrophobicContact CG-CD1 4.32Å; L90-I92 HydrophobicContact CG-CG1 4.09Å; I92-T94 HydrophobicContact CG2-CG2 4.18Å
93	T	94.7	Very high	92.4	Very high	16 Å²	16	68.4 Å²	68.4	10%	0.098	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	125.5	177.2	-54.6	0	0	0	0	109.3	Q57 K58 I59 N81 S82	Q57-T93 HydrophobicContact CG-CG2 3.9Å; K58-T93 WeakPolarHBondContact O-CA 3.46Å; I59-T93 HydrophobicContact CG1-CG2 4.17Å; N81-T93 VanDerWaalsContact CA-O 3.31Å; N81-T93 WeakPolarHBondContact CA-O 3.42Å; S82-T93 PolarHBondContact N-O 2.9Å; S82-T93 VanDerWaalsContact N-O 3.11Å; S82-T93 PolarHBondContact O-N 3.03Å; S82-T93 WeakPolarHBondContact OG-CB 3.29Å; S82-T93 PolarHBondContact OG-OG1 2.87Å
94	T	93.8	Very high	92.1	Very high	58 Å²	58	66.3 Å²	66.3	36%	0.356	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	136.1	178.5	50.4	0	0	0	0	110	Q57 K58 I92	Q57-T94 CarbonylContact C-O 3.56Å; Q57-T94 WeakPolarHBondContact CA-O 3.43Å; K58-T94 WeakPolarHBondContact CB-OG1 3.04Å; K58-T94 PolarHBondContact N-O 2.85Å; K58-T94 PolarHBondContact O-N 3.06Å; K58-T94 PolarHBondContact O-OG1 2.92Å; K58-T94 VanDerWaalsContact O-OG1 3.06Å; I92-T94 HydrophobicContact CG2-CG2 4.18Å
95	C	94.9	Very high	91.3	Very high	26 Å²	26	63.5 Å²	63.5	18%	0.176	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	143.6	-176.5	-56.9	0	0	0	0	109.8	C56 C79 V80 N81	C56-C95 WeakPolarHBondContact O-CA 3.04Å; C79-C95 HydrophobicContact CB-CB 3.62Å; C79-C95 WeakPolarHBondContact CB-SG 3.2Å; C79-C95 WeakPolarHBondContact SG-CB 3.37Å; C79-C95 CovalentContact SG-SG 2.02Å; C79-C95 PolarHBondContact SG-SG 2.97Å; V80-C95 VanDerWaalsContact C-SG 3.57Å; V80-C95 PolarHBondContact N-SG 3.11Å; V80-C95 VanDerWaalsContact N-SG 3.37Å; N81-C95 WeakPolarHBondContact OD1-CB 3.23Å; N81-C95 PolarHBondContact OD1-N 2.84Å; N81-C95 PolarHBondContact OD1-SG 3.37Å
96	C	92.7	Very high	90.2	Very high	14 Å²	14	64.9 Å²	64.9	10%	0.095	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.2	153.3	175.7	57.2	0	0	0	0	111	F55 C56 C102	F55-C96 WeakPolarHBondContact CA-O 3.38Å; C56-C96 PolarHBondContact N-O 3.45Å; C56-C96 PolarHBondContact O-N 2.02Å; C96-C102 VanDerWaalsContact C-SG 3.54Å; C96-C102 HydrophobicContact CB-CB 3.69Å; C96-C102 WeakPolarHBondContact CB-SG 3.29Å; C96-C102 WeakPolarHBondContact SG-CB 3.29Å; C96-C102 CovalentContact SG-SG 2.03Å; C96-C102 PolarHBondContact SG-SG 2.98Å
97	T	91.1	Very high	88.8	Confident	71 Å²	71	63.9 Å²	63.9	44%	0.436	35%	0.351	S	S	.	.			trans	-118.1	-17.5	-178.8	53.1	0	0	0	0	113.5	L30 K54 F55	L30-T97 WeakPolarHBondContact CD1-O 3.44Å; L30-T97 WeakPolarHBondContact CD2-O 3.44Å; K54-T97 WeakPolarHBondContact O-CG2 3.17Å; F55-T97 HydrophobicContact CD1-CG2 3.27Å; F55-T97 HydrophobicContact CE1-CG2 3.48Å; F55-T97 VanDerWaalsContact CE1-CG2 3.48Å; F55-T97 HydrophobicContact CG-CG2 4.15Å; F55-T97 HydrophobicContact CZ-CG2 4.5Å
98	K	86.2	Confident	87.3	Confident	143 Å²	143	64.3 Å²	64.3	62%	0.622	35%	0.349	S	S	*	.	S	Bend	trans	-157.9	151.4	178.3	-66.4	-167.7	-179.5	-172.7	0	111.9	R107	K98-R107 VanDerWaalsContact O-CZ 3.3Å; K98-R107 PolarHBondContact O-NH1 2.82Å; K98-R107 VanDerWaalsContact O-NH1 3.11Å; K98-R107 PolarHBondContact O-NH2 2.77Å
99	P	87.9	Confident	85.7	Confident	91 Å²	91	68 Å²	68	59%	0.591	37%	0.371	S	S	*	.	S	Bend	cis	-73.5	-174.8	-6.6	33.3	-37	0	0	0	111.4	C102 R107	P99-C102 WeakPolarHBondContact O-CB 3.23Å; P99-C102 PolarHBondContact O-N 2.83Å; P99-R107 VanDerWaalsContact CD-NH2 3.33Å
100	D	90.4	Very high	83.9	Confident	62 Å²	62	68.3 Å²	68.3	33%	0.332	39%	0.387	S	S	.	.	T	Hydrogen-bonded Turn	trans	-50.8	146.9	168.1	-74.5	-25.8	0	0	0	111.4	L30 K31 C102	L30-D100 WeakPolarHBondContact CA-OD1 3.26Å; K31-D100 HydrophobicContact CB-CB 4.17Å; K31-D100 PolarHBondContact N-OD1 3.4Å; D100-C102 PolarHBondContact O-N 3.31Å; D100-C102 VanDerWaalsContact O-N 3.14Å
101	L	91.2	Very high	82.3	Confident	42 Å²	42	74.8 Å²	74.8	22%	0.22	41%	0.412	C	S	.	.	T	Hydrogen-bonded Turn	trans	59.6	25.6	178.1	-55.1	175.5	0	0	0	112.8	K31 Y33 I49 N103 Q104	K31-L101 HydrophobicContact CB-CD2 4.13Å; K31-L101 WeakPolarHBondContact O-CA 3.47Å; K31-L101 PolarHBondContact O-N 3.24Å; Y33-L101 HydrophobicContact CD1-CD2 4.24Å; Y33-L101 HydrophobicContact CD2-CB 4.03Å; Y33-L101 HydrophobicContact CD2-CD2 4.16Å; Y33-L101 HydrophobicContact CE1-CD1 4.46Å; Y33-L101 HydrophobicContact CE1-CD2 4.13Å; Y33-L101 HydrophobicContact CE2-CB 3.55Å; Y33-L101 HydrophobicContact CE2-CD1 4.29Å; Y33-L101 HydrophobicContact CE2-CD2 4.07Å; Y33-L101 HydrophobicContact CE2-CG 4.17Å; Y33-L101 HydrophobicContact CG-CD2 4.26Å; I49-L101 HydrophobicContact CG1-CD2 4.42Å; I49-L101 HydrophobicContact CG2-CD2 4.14Å; L101-N103 PolarHBondContact O-N 2.87Å; L101-Q104 WeakPolarHBondContact O-CB 3.21Å; L101-Q104 PolarHBondContact O-N 3.1Å
102	C	91.3	Very high	80.8	Confident	13 Å²	13	79.1 Å²	79.1	9%	0.088	43%	0.433	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.9	-15	-174.5	57.8	0	0	0	0	115.9	C56 C96 P99 D100 Q104	C56-C102 VanDerWaalsContact CB-SG 3.57Å; C56-C102 PolarHBondContact SG-SG 3.16Å; C96-C102 VanDerWaalsContact C-SG 3.54Å; C96-C102 HydrophobicContact CB-CB 3.69Å; C96-C102 WeakPolarHBondContact CB-SG 3.29Å; C96-C102 WeakPolarHBondContact SG-CB 3.29Å; C96-C102 CovalentContact SG-SG 2.03Å; C96-C102 PolarHBondContact SG-SG 2.98Å; P99-C102 WeakPolarHBondContact O-CB 3.23Å; P99-C102 PolarHBondContact O-N 2.83Å; D100-C102 PolarHBondContact O-N 3.31Å; D100-C102 VanDerWaalsContact O-N 3.14Å; C102-Q104 VanDerWaalsContact C-N 3.27Å
103	N	92.5	Very high	79.5	Confident	4 Å²	4	82.1 Å²	82.1	2%	0.021	45%	0.449	C	S	.	.	T	Hydrogen-bonded Turn	trans	-87.6	12.5	177.9	65.9	-16.1	0	0	0	113.2	Y33 C56 Q57 K58 R72 L101	Y33-N103 WeakPolarHBondContact CB-OD1 3.47Å; Y33-N103 WeakPolarHBondContact CD2-OD1 3.45Å; Y33-N103 PolarHBondContact N-OD1 3.42Å; Y33-N103 PolarHBondContact O-ND2 3Å; C56-N103 HydrophobicContact CB-CB 3.73Å; Q57-N103 PolarHBondContact O-ND2 3.08Å; Q57-N103 VanDerWaalsContact O-ND2 3.1Å; K58-N103 HydrophobicContact CB-CB 4.1Å; R72-N103 WeakPolarHBondContact CD-O 3.01Å; R72-N103 PolarHBondContact NE-O 3.39Å; L101-N103 PolarHBondContact O-N 2.87Å
104	Q	88.3	Confident	78.5	Confident	76 Å²	76	85.4 Å²	85.4	36%	0.355	47%	0.465	S	S	.	.	S	Bend	trans	-62.2	-62.6	177.7	-159.5	177.7	-8.7	0	0	112.5	Y33 V41 R72 L101 C102	Y33-Q104 HydrophobicContact CD2-CB 4.04Å; Y33-Q104 HydrophobicContact CD2-CG 4.28Å; Y33-Q104 HydrophobicContact CE2-CB 3.61Å; Y33-Q104 HydrophobicContact CE2-CG 3.55Å; V41-Q104 HydrophobicContact CB-CG 4.46Å; V41-Q104 HydrophobicContact CG2-CB 4.28Å; V41-Q104 HydrophobicContact CG2-CG 3.4Å; V41-Q104 VanDerWaalsContact CG2-CG 3.4Å; R72-Q104 PolarHBondContact NH2-O 2.88Å; L101-Q104 WeakPolarHBondContact O-CB 3.21Å; L101-Q104 PolarHBondContact O-N 3.1Å; C102-Q104 VanDerWaalsContact C-N 3.27Å
105	S	77.3	Confident	77.4	Confident	77 Å²	77	85.2 Å²	85.2	54%	0.538	46%	0.461	S	S	.	.	S	Bend	trans	-122.8	-178.7	-167.8	64.9	0	0	0	0	112.4	K58	K58-S105 PolarHBondContact NZ-O 2.91Å
106	V	68.4	Low	76.6	Confident	121 Å²	121	90.4 Å²	90.4	73%	0.733	48%	0.48	S	S	*	.			trans	-74.8	127.9	168.3	-176.9	0	0	0	0	107.4	T108	V106-T108 PolarHBondContact O-N 2.93Å
107	R	62.7	Low	76	Confident	126 Å²	126	94.6 Å²	94.6	48%	0.475	50%	0.501	S	S	.	.			trans	-74.5	114.5	175.1	-72.6	-176.8	170.3	-127.4	-25.1	109.8	K98 P99	K98-R107 VanDerWaalsContact O-CZ 3.3Å; K98-R107 PolarHBondContact O-NH1 2.82Å; K98-R107 VanDerWaalsContact O-NH1 3.11Å; K98-R107 PolarHBondContact O-NH2 2.77Å; P99-R107 VanDerWaalsContact CD-NH2 3.33Å
108	T	59	Low	75.3	Confident	127 Å²	127	97.9 Å²	97.9	78%	0.779	51%	0.505	S	S	*	.			trans	-83.7	106.2	155.2	48	0	0	0	0	106.7	V106 S110	V106-T108 PolarHBondContact O-N 2.93Å; T108-S110 VanDerWaalsContact C-N 3.29Å; T108-S110 PolarHBondContact O-N 3.04Å
109	T	58.2	Low	74.9	Confident	123 Å²	123	94.5 Å²	94.5	76%	0.755	49%	0.493	S	S	*	.			trans	-75.5	83.1	176.5	52.4	0	0	0	0	109.4	K111	T109-K111 PolarHBondContact O-N 3.45Å
110	S	57.8	Low	74.7	Confident	96 Å²	96	95.8 Å²	95.8	67%	0.671	49%	0.494	S	S	*	.			trans	-83.1	94.7	163.9	51.8	0	0	0	0	108.5	T108 M112	T108-S110 VanDerWaalsContact C-N 3.29Å; T108-S110 PolarHBondContact O-N 3.04Å; S110-M112 PolarHBondContact O-N 3.39Å
111	K	60.4	Low	74.3	Confident	191 Å²	191	97.8 Å²	97.8	83%	0.83	50%	0.5	S	S	*	.			trans	-76.3	59.8	164.6	-67.2	-174.8	-178.7	-179.7	0	109	T109 N113	T109-K111 PolarHBondContact O-N 3.45Å; K111-N113 PolarHBondContact O-N 3.11Å
112	M	63.5	Low	73.6	Confident	137 Å²	137	97.8 Å²	97.8	68%	0.675	50%	0.504	S	S	*	.			trans	-84.9	103	-177.4	-156.2	163.5	165.9	0	0	108.2	S110 I114	S110-M112 PolarHBondContact O-N 3.39Å; M112-I114 HydrophobicContact CG-CG1 4.33Å; M112-I114 PolarHBondContact O-N 2.74Å
113	N	67	Low	73.1	Confident	110 Å²	110	100.4 Å²	100.4	59%	0.588	52%	0.517	S	S	*	.			trans	-76.1	75.6	178.1	-70.8	-52.9	0	0	0	110.2	K111 Q115 F116	K111-N113 PolarHBondContact O-N 3.11Å; N113-Q115 PolarHBondContact O-N 2.81Å; N113-Q115 VanDerWaalsContact O-N 3.08Å; N113-F116 HydrophobicContact CB-CD2 3.64Å; N113-F116 HydrophobicContact CB-CE2 3.96Å; N113-F116 PolarHBondContact O-N 2.88Å
114	I	73.6	Confident	72.8	Confident	85 Å²	85	107.3 Å²	107.3	44%	0.436	54%	0.542	S	S	.	.	H	α-helix	trans	-59.6	-20.9	179.8	-63.5	167.2	0	0	0	111.7	M112 F116 I117 W118	M112-I114 HydrophobicContact CG-CG1 4.33Å; M112-I114 PolarHBondContact O-N 2.74Å; I114-F116 VanDerWaalsContact C-N 3.32Å; I114-F116 PolarHBondContact O-N 2.87Å; I114-I117 PolarHBondContact O-N 3.27Å; I114-I117 VanDerWaalsContact O-N 3.16Å; I114-W118 VanDerWaalsContact O-CD1 3.31Å
115	Q	71.9	Confident	72.3	Confident	55 Å²	55	105.2 Å²	105.2	26%	0.257	53%	0.533	S	S	.	.	H	α-helix	trans	-58.5	-37.1	178.3	-64.6	-66	-7.1	0	0	113.7	N113 I117 W118 I119	N113-Q115 PolarHBondContact O-N 2.81Å; N113-Q115 VanDerWaalsContact O-N 3.08Å; Q115-I117 VanDerWaalsContact C-N 3.29Å; Q115-I117 PolarHBondContact O-N 2.8Å; Q115-W118 PolarHBondContact O-N 2.8Å; Q115-I119 WeakPolarHBondContact O-CG1 3.16Å; Q115-I119 PolarHBondContact O-N 3.06Å
116	F	77	Confident	72.3	Confident	134 Å²	134	109.7 Å²	109.7	59%	0.588	54%	0.539	S	S	*	.	H	α-helix	trans	-65.8	-33.5	178.9	-73.7	-74	0	0	0	112.4	N113 I114 I119 L120	N113-F116 HydrophobicContact CB-CD2 3.64Å; N113-F116 HydrophobicContact CB-CE2 3.96Å; N113-F116 PolarHBondContact O-N 2.88Å; I114-F116 VanDerWaalsContact C-N 3.32Å; I114-F116 PolarHBondContact O-N 2.87Å; F116-I119 PolarHBondContact O-N 2.02Å; F116-L120 VanDerWaalsContact O-CG 3.29Å; F116-L120 WeakPolarHBondContact O-CG 3.49Å; F116-L120 PolarHBondContact O-N 3.36Å
117	I	80.6	Confident	72.8	Confident	103 Å²	103	112.3 Å²	112.3	53%	0.528	54%	0.536	S	S	.	.	H	α-helix	trans	-66.4	-42.7	-179.1	-59.5	174.5	0	0	0	110.1	I114 Q115 L120 F121	I114-I117 PolarHBondContact O-N 3.27Å; I114-I117 VanDerWaalsContact O-N 3.16Å; Q115-I117 VanDerWaalsContact C-N 3.29Å; Q115-I117 PolarHBondContact O-N 2.8Å; I117-L120 PolarHBondContact O-N 3.08Å; I117-F121 WeakPolarHBondContact O-CB 3.38Å; I117-F121 PolarHBondContact O-N 2.84Å
118	W	76.4	Confident	73.6	Confident	140 Å²	140	111.2 Å²	111.2	53%	0.53	54%	0.54	S	S	.	.	H	α-helix	trans	-66	-40.4	177.8	-70.7	108.4	0	0	0	112.8	I114 Q115 F121 S122	I114-W118 VanDerWaalsContact O-CD1 3.31Å; Q115-W118 PolarHBondContact O-N 2.8Å; W118-F121 PolarHBondContact O-N 3.03Å; W118-S122 PolarHBondContact O-N 2.85Å; W118-S122 PolarHBondContact O-OG 2.83Å
119	I	78.5	Confident	73.7	Confident	72 Å²	72	110.6 Å²	110.6	37%	0.369	54%	0.539	S	S	.	.	H	α-helix	trans	-62.7	-48.3	177	-65.4	168.1	0	0	0	110	Q115 F116 F121 S122 I123	Q115-I119 WeakPolarHBondContact O-CG1 3.16Å; Q115-I119 PolarHBondContact O-N 3.06Å; F116-I119 PolarHBondContact O-N 2.02Å; I119-F121 VanDerWaalsContact C-N 3.32Å; I119-F121 PolarHBondContact O-N 2.81Å; I119-S122 PolarHBondContact O-N 2.83Å; I119-S122 PolarHBondContact O-OG 2.83Å; I119-I123 HydrophobicContact CG2-CD1 3.85Å; I119-I123 WeakPolarHBondContact O-CG1 3.27Å; I119-I123 PolarHBondContact O-N 2.95Å
120	L	82.1	Confident	74.5	Confident	117 Å²	117	110 Å²	110	61%	0.613	53%	0.529	S	S	*	.	H	α-helix	trans	-61.4	-39.6	178.1	-68.5	173.6	0	0	0	112.4	F116 I117 I123 W124	F116-L120 VanDerWaalsContact O-CG 3.29Å; F116-L120 WeakPolarHBondContact O-CG 3.49Å; F116-L120 PolarHBondContact O-N 3.36Å; I117-L120 PolarHBondContact O-N 3.08Å; L120-I123 PolarHBondContact O-N 2.78Å; L120-W124 WeakPolarHBondContact O-CB 3.29Å; L120-W124 PolarHBondContact O-N 3.34Å
121	F	82.4	Confident	75.3	Confident	104 Å²	104	110.7 Å²	110.7	46%	0.456	52%	0.521	S	S	.	.	H	α-helix	trans	-65.2	-40.9	176.4	-170.2	-115.1	0	0	0	112.1	I117 W118 I119 W124 I125	I117-F121 WeakPolarHBondContact O-CB 3.38Å; I117-F121 PolarHBondContact O-N 2.84Å; W118-F121 PolarHBondContact O-N 3.03Å; I119-F121 VanDerWaalsContact C-N 3.32Å; I119-F121 PolarHBondContact O-N 2.81Å; F121-W124 HydrophobicContact CD2-CE3 4.21Å; F121-W124 AromaticContact CE2-CE3 3.99Å; F121-W124 HydrophobicContact CE2-CE3 3.99Å; F121-W124 HydrophobicContact CE2-CZ3 4.08Å; F121-W124 PolarHBondContact O-N 3.25Å; F121-I125 HydrophobicContact CD1-CD1 3.53Å; F121-I125 HydrophobicContact CD1-CG1 4.41Å; F121-I125 HydrophobicContact CE1-CD1 3.31Å; F121-I125 HydrophobicContact CE1-CG1 4.22Å; F121-I125 HydrophobicContact CE2-CD1 4.46Å; F121-I125 HydrophobicContact CG-CD1 4.22Å; F121-I125 HydrophobicContact CZ-CD1 3.82Å; F121-I125 HydrophobicContact CZ-CG1 4.28Å; F121-I125 VanDerWaalsContact O-CG1 3.27Å; F121-I125 WeakPolarHBondContact O-CG1 3.41Å; F121-I125 PolarHBondContact O-N 2.79Å
122	S	77.7	Confident	76.2	Confident	42 Å²	42	106.2 Å²	106.2	29%	0.294	50%	0.504	S	S	.	.	H	α-helix	trans	-65.4	-39.6	176.9	68.2	0	0	0	0	113	W118 I119 I125 W126	W118-S122 PolarHBondContact O-N 2.85Å; W118-S122 PolarHBondContact O-OG 2.83Å; I119-S122 PolarHBondContact O-N 2.83Å; I119-S122 PolarHBondContact O-OG 2.83Å; S122-I125 PolarHBondContact O-N 2.91Å; S122-W126 WeakPolarHBondContact O-CB 3.42Å; S122-W126 PolarHBondContact O-N 3.07Å
123	I	80.7	Confident	76.9	Confident	69 Å²	69	104.4 Å²	104.4	35%	0.354	49%	0.494	S	S	.	.	H	α-helix	trans	-64.6	-44.2	174.3	-66.9	167.7	0	0	0	109.9	I119 L120 I125 W126 Y127	I119-I123 HydrophobicContact CG2-CD1 3.85Å; I119-I123 WeakPolarHBondContact O-CG1 3.27Å; I119-I123 PolarHBondContact O-N 2.95Å; L120-I123 PolarHBondContact O-N 2.78Å; I123-I125 PolarHBondContact O-N 2.84Å; I123-W126 WeakPolarHBondContact O-CB 3.22Å; I123-W126 PolarHBondContact O-N 2.87Å; I123-W126 VanDerWaalsContact O-N 3.16Å; I123-Y127 HydrophobicContact CG2-CD2 3.65Å; I123-Y127 HydrophobicContact CG2-CE2 3.44Å; I123-Y127 VanDerWaalsContact CG2-CE2 3.44Å; I123-Y127 WeakPolarHBondContact O-CD2 2.98Å; I123-Y127 PolarHBondContact O-N 3.22Å; I123-Y127 VanDerWaalsContact O-N 3.09Å
124	W	84.8	Confident	77.5	Confident	148 Å²	148	104.1 Å²	104.1	56%	0.561	49%	0.488	S	S	*	.	H	α-helix	trans	-61	-44.2	177.8	179	78	0	0	0	112.3	L120 F121 W126 Y127 N128	L120-W124 WeakPolarHBondContact O-CB 3.29Å; L120-W124 PolarHBondContact O-N 3.34Å; F121-W124 HydrophobicContact CD2-CE3 4.21Å; F121-W124 AromaticContact CE2-CE3 3.99Å; F121-W124 HydrophobicContact CE2-CE3 3.99Å; F121-W124 HydrophobicContact CE2-CZ3 4.08Å; F121-W124 PolarHBondContact O-N 3.25Å; W124-W126 VanDerWaalsContact C-N 3.29Å; W124-W126 PolarHBondContact O-N 3.13Å; W124-Y127 PolarHBondContact O-N 2.86Å; W124-N128 PolarHBondContact NE1-ND2 2.94Å; W124-N128 PolarHBondContact O-N 2.83Å; W124-N128 PolarHBondContact O-ND2 2.78Å
125	I	79.4	Confident	77.8	Confident	33 Å²	33	105.3 Å²	105.3	17%	0.169	49%	0.491	C	S	.	.	H	α-helix	trans	-61.9	-39.8	175.2	-66.5	163.7	0	0	0	110.7	M8 F121 S122 I123 Y127 N128 C129	M8-I125 HydrophobicContact CE-CG2 3.16Å; M8-I125 HydrophobicContact SD-CG2 4.18Å; F121-I125 HydrophobicContact CD1-CD1 3.53Å; F121-I125 HydrophobicContact CD1-CG1 4.41Å; F121-I125 HydrophobicContact CE1-CD1 3.31Å; F121-I125 HydrophobicContact CE1-CG1 4.22Å; F121-I125 HydrophobicContact CE2-CD1 4.46Å; F121-I125 HydrophobicContact CG-CD1 4.22Å; F121-I125 HydrophobicContact CZ-CD1 3.82Å; F121-I125 HydrophobicContact CZ-CG1 4.28Å; F121-I125 VanDerWaalsContact O-CG1 3.27Å; F121-I125 WeakPolarHBondContact O-CG1 3.41Å; F121-I125 PolarHBondContact O-N 2.79Å; S122-I125 PolarHBondContact O-N 2.91Å; I123-I125 PolarHBondContact O-N 2.84Å; I125-Y127 VanDerWaalsContact C-N 3.34Å; I125-Y127 PolarHBondContact O-N 2.68Å; I125-N128 PolarHBondContact O-N 3.19Å; I125-C129 HydrophobicContact CG2-CB 4.5Å; I125-C129 WeakPolarHBondContact O-CB 3.31Å; I125-C129 PolarHBondContact O-N 3.29Å
126	W	76.3	Confident	78.2	Confident	171 Å²	171	108.9 Å²	108.9	65%	0.648	51%	0.508	S	S	*	.	H	α-helix	trans	-63.9	-35.8	178.8	-175.3	29.5	0	0	0	113.4	S122 I123 W124	S122-W126 WeakPolarHBondContact O-CB 3.42Å; S122-W126 PolarHBondContact O-N 3.07Å; I123-W126 WeakPolarHBondContact O-CB 3.22Å; I123-W126 PolarHBondContact O-N 2.87Å; I123-W126 VanDerWaalsContact O-N 3.16Å; W124-W126 VanDerWaalsContact C-N 3.29Å; W124-W126 PolarHBondContact O-N 3.13Å
127	Y	79.9	Confident	78.3	Confident	176 Å²	176	107 Å²	107	69%	0.69	50%	0.502	S	S	*	.	H	α-helix	trans	-79.8	-24.3	178.5	-77.7	-68.6	0	0	0	114.4	I123 W124 I125	I123-Y127 HydrophobicContact CG2-CD2 3.65Å; I123-Y127 HydrophobicContact CG2-CE2 3.44Å; I123-Y127 VanDerWaalsContact CG2-CE2 3.44Å; I123-Y127 WeakPolarHBondContact O-CD2 2.98Å; I123-Y127 PolarHBondContact O-N 3.22Å; I123-Y127 VanDerWaalsContact O-N 3.09Å; W124-Y127 PolarHBondContact O-N 2.86Å; I125-Y127 VanDerWaalsContact C-N 3.34Å; I125-Y127 PolarHBondContact O-N 2.68Å
128	N	78.8	Confident	78.1	Confident	102 Å²	102	107.3 Å²	107.3	55%	0.545	50%	0.5	S	S	.	.	H	α-helix	trans	-108.2	5.6	-173.2	-66.6	-88.6	0	0	0	113.9	W124 I125	W124-N128 PolarHBondContact NE1-ND2 2.94Å; W124-N128 PolarHBondContact O-N 2.83Å; W124-N128 PolarHBondContact O-ND2 2.78Å; I125-N128 PolarHBondContact O-N 3.19Å
129	C	60.6	Low	78.3	Confident	114 Å²	114	104.4 Å²	104.4	77%	0.77	50%	0.497	S	S	*	.			trans	-135.7	0	178.7	-76.4	0	0	0	0	113	I125	I125-C129 HydrophobicContact CG2-CB 4.5Å; I125-C129 WeakPolarHBondContact O-CB 3.31Å; I125-C129 PolarHBondContact O-N 3.29Å

Retrieved 129 of 129 residues in 135.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).