A0A3Q0KLM8_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KLM8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 106 aa.

						>A0A3Q0KLM8_SCHMA|A0A3Q0KLM8
MNVKFHGNGVLLDHLIKQLDVIMRFQELTQNDRSQIDHEANIIRSDAQICAISNPANPVTGDISQTAHLRKNASEPPNFSISSGCGSKTGRLVVTEVFCYHRHNSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.3	Very low	47.7	Very low	233 Å²	233	127.4 Å²	127.4	100%	1.148	69%	0.692	S	S	*	*				0	106.2	0	-166.7	179.3	-86.2	0	0	106.8	V3	M1-V3 HydrophobicContact CG-CG2 4.43Å
2	N	33.5	Very low	49.8	Very low	151 Å²	151	125.6 Å²	125.6	81%	0.807	68%	0.681	S	S	*	*			trans	-100.8	90.8	-170.4	-150.3	6	0	0	0	108	K4	N2-K4 PolarHBondContact O-N 3.04Å
3	V	33.6	Very low	51.6	Low	94 Å²	94	121.8 Å²	121.8	57%	0.57	66%	0.66	S	S	*	*			trans	-80.2	100.1	-176.5	-172.2	0	0	0	0	107.9	M1 F5	M1-V3 HydrophobicContact CG-CG2 4.43Å; V3-F5 HydrophobicContact CB-CE2 4.41Å; V3-F5 HydrophobicContact CG1-CE2 4.13Å; V3-F5 HydrophobicContact CG1-CZ 4.12Å; V3-F5 PolarHBondContact O-N 3.34Å
4	K	37.6	Very low	53.1	Low	165 Å²	165	120.6 Å²	120.6	72%	0.717	65%	0.648	S	S	*	*			trans	-77.6	106.6	174.3	-71.8	-176.3	176.8	-178	0	109.4	N2 H6	N2-K4 PolarHBondContact O-N 3.04Å; K4-H6 VanDerWaalsContact C-N 3.29Å; K4-H6 PolarHBondContact O-N 3.17Å
5	F	43.2	Very low	54.4	Low	157 Å²	157	118.3 Å²	118.3	69%	0.689	63%	0.634	S	S	*	*			trans	-78.1	75	169.9	-67.3	-84.1	0	0	0	110.4	V3	V3-F5 HydrophobicContact CB-CE2 4.41Å; V3-F5 HydrophobicContact CG1-CE2 4.13Å; V3-F5 HydrophobicContact CG1-CZ 4.12Å; V3-F5 PolarHBondContact O-N 3.34Å
6	H	45.6	Very low	56.2	Low	169 Å²	169	117.1 Å²	117.1	78%	0.782	63%	0.626	S	S	*	*			trans	-100.8	0.4	178.4	-102.3	-54.9	0	0	0	115.1	K4	K4-H6 VanDerWaalsContact C-N 3.29Å; K4-H6 PolarHBondContact O-N 3.17Å
7	G	51.9	Low	57.4	Low	51 Å²	51	117.1 Å²	117.1	53%	0.526	62%	0.619	S	S	.	*	S	Bend	trans	-100.4	-21.4	178.1	0	0	0	0	0	115.7
8	N	56.3	Low	58.3	Low	101 Å²	101	115.8 Å²	115.8	54%	0.54	61%	0.609	S	S	.	*	H	α-helix	trans	-80.5	-26	-167	-70.8	-2.9	0	0	0	114.2	L12	N8-L12 VanDerWaalsContact O-CB 3.3Å; N8-L12 WeakPolarHBondContact O-CB 3.28Å; N8-L12 PolarHBondContact O-N 3.36Å
9	G	57.5	Low	59.5	Low	54 Å²	54	115.4 Å²	115.4	56%	0.557	61%	0.607	S	S	*	*	H	α-helix	trans	-66.8	-40.5	-178.4	0	0	0	0	0	113.2	L12 D13	G9-L12 PolarHBondContact O-N 2.67Å; G9-D13 WeakPolarHBondContact O-CB 3.41Å; G9-D13 PolarHBondContact O-N 3.23Å
10	V	65.1	Low	60.6	Low	113 Å²	113	113.1 Å²	113.1	69%	0.685	60%	0.595	S	S	*	*	H	α-helix	trans	-71.1	-39.5	179.4	-179.5	0	0	0	0	111.1	D13 H14	V10-D13 PolarHBondContact O-N 2.96Å; V10-H14 WeakPolarHBondContact O-CB 3.38Å; V10-H14 PolarHBondContact O-N 2.97Å
11	L	67	Low	61.3	Low	113 Å²	113	112.3 Å²	112.3	59%	0.592	60%	0.595	S	S	*	*	H	α-helix	trans	-65.3	-41.9	176.7	-160.4	81.3	0	0	0	111.1	H14 L15	L11-H14 PolarHBondContact O-N 2.99Å; L11-L15 VanDerWaalsContact O-CG 3.31Å; L11-L15 WeakPolarHBondContact O-CG 3.4Å; L11-L15 PolarHBondContact O-N 3.42Å
12	L	73	Confident	63.3	Low	106 Å²	106	105.6 Å²	105.6	56%	0.555	56%	0.562	S	S	*	*	H	α-helix	trans	-64.9	-44.7	176.9	-175.1	63.7	0	0	0	111.8	N8 G9 H14 L15 I16	N8-L12 VanDerWaalsContact O-CB 3.3Å; N8-L12 WeakPolarHBondContact O-CB 3.28Å; N8-L12 PolarHBondContact O-N 3.36Å; G9-L12 PolarHBondContact O-N 2.67Å; L12-H14 VanDerWaalsContact C-N 3.3Å; L12-H14 PolarHBondContact O-N 3Å; L12-L15 PolarHBondContact O-N 3.47Å; L12-I16 HydrophobicContact CD1-CD1 4.48Å; L12-I16 HydrophobicContact CG-CD1 4.08Å; L12-I16 VanDerWaalsContact O-CG1 3.29Å; L12-I16 WeakPolarHBondContact O-CG1 3.31Å; L12-I16 PolarHBondContact O-N 3.44Å
13	D	73.8	Confident	65.3	Low	77 Å²	77	103.8 Å²	103.8	41%	0.412	55%	0.551	S	S	.	*	H	α-helix	trans	-60.9	-39.5	175.4	-178.4	66	0	0	0	111.9	G9 V10 I16 K17	G9-D13 WeakPolarHBondContact O-CB 3.41Å; G9-D13 PolarHBondContact O-N 3.23Å; V10-D13 PolarHBondContact O-N 2.96Å; D13-I16 PolarHBondContact O-N 3.3Å; D13-K17 WeakPolarHBondContact O-CG 3.44Å; D13-K17 PolarHBondContact O-N 3.45Å; D13-K17 IonicContact OD1-NZ 2.67Å; D13-K17 VanDerWaalsContact OD2-CE 3.28Å; D13-K17 WeakPolarHBondContact OD2-CE 3.3Å; D13-K17 IonicContact OD2-NZ 3.27Å; D13-K17 PolarHBondContact OD2-NZ 3.49Å
14	H	72	Confident	67.1	Low	105 Å²	105	106.2 Å²	106.2	49%	0.486	55%	0.55	S	S	.	.	H	α-helix	trans	-65.9	-42.3	176.3	-164.9	61.3	0	0	0	112.5	V10 L11 L12 K17 Q18	V10-H14 WeakPolarHBondContact O-CB 3.38Å; V10-H14 PolarHBondContact O-N 2.97Å; L11-H14 PolarHBondContact O-N 2.99Å; L12-H14 VanDerWaalsContact C-N 3.3Å; L12-H14 PolarHBondContact O-N 3Å; H14-K17 PolarHBondContact O-N 3.25Å; H14-Q18 PolarHBondContact NE2-NE2 3Å; H14-Q18 WeakPolarHBondContact O-CG 3.49Å; H14-Q18 PolarHBondContact O-N 3.43Å
15	L	73.2	Confident	68.5	Low	86 Å²	86	104.9 Å²	104.9	45%	0.45	54%	0.544	S	S	.	.	H	α-helix	trans	-64.4	-39.9	176.3	-71.6	169.8	0	0	0	112	L11 L12 Q18 L19	L11-L15 VanDerWaalsContact O-CG 3.31Å; L11-L15 WeakPolarHBondContact O-CG 3.4Å; L11-L15 PolarHBondContact O-N 3.42Å; L12-L15 PolarHBondContact O-N 3.47Å; L15-Q18 PolarHBondContact O-N 2.96Å; L15-L19 WeakPolarHBondContact O-CG 3.44Å; L15-L19 PolarHBondContact O-N 3.39Å
16	I	82	Confident	69.6	Low	98 Å²	98	102.5 Å²	102.5	50%	0.503	54%	0.535	S	S	.	.	H	α-helix	trans	-61.7	-44.8	175.3	-69.9	166.6	0	0	0	110.6	L12 D13 Q18 L19 D20	L12-I16 HydrophobicContact CD1-CD1 4.48Å; L12-I16 HydrophobicContact CG-CD1 4.08Å; L12-I16 VanDerWaalsContact O-CG1 3.29Å; L12-I16 WeakPolarHBondContact O-CG1 3.31Å; L12-I16 PolarHBondContact O-N 3.44Å; D13-I16 PolarHBondContact O-N 3.3Å; I16-Q18 VanDerWaalsContact C-N 3.34Å; I16-Q18 PolarHBondContact O-N 3.28Å; I16-L19 PolarHBondContact O-N 2.72Å; I16-D20 PolarHBondContact O-N 3.46Å
17	K	77.5	Confident	70.7	Confident	117 Å²	117	99.9 Å²	99.9	51%	0.509	52%	0.523	S	S	.	.	H	α-helix	trans	-62.6	-39	176.8	-74.8	169.3	177.7	164.3	0	112.5	D13 H14 L19 D20 V21	D13-K17 WeakPolarHBondContact O-CG 3.44Å; D13-K17 PolarHBondContact O-N 3.45Å; D13-K17 IonicContact OD1-NZ 2.67Å; D13-K17 VanDerWaalsContact OD2-CE 3.28Å; D13-K17 WeakPolarHBondContact OD2-CE 3.3Å; D13-K17 IonicContact OD2-NZ 3.27Å; D13-K17 PolarHBondContact OD2-NZ 3.49Å; H14-K17 PolarHBondContact O-N 3.25Å; K17-L19 VanDerWaalsContact C-N 3.35Å; K17-D20 PolarHBondContact O-N 3.33Å; K17-V21 WeakPolarHBondContact O-CG2 3.42Å; K17-V21 PolarHBondContact O-N 3.04Å
18	Q	72.9	Confident	71.2	Confident	95 Å²	95	102.4 Å²	102.4	44%	0.444	52%	0.524	S	S	.	.	H	α-helix	trans	-64.5	-39.4	175.5	-73.8	-176.7	-14.7	0	0	112	H14 L15 I16 V21 I22	H14-Q18 PolarHBondContact NE2-NE2 3Å; H14-Q18 WeakPolarHBondContact O-CG 3.49Å; H14-Q18 PolarHBondContact O-N 3.43Å; L15-Q18 PolarHBondContact O-N 2.96Å; I16-Q18 VanDerWaalsContact C-N 3.34Å; I16-Q18 PolarHBondContact O-N 3.28Å; Q18-V21 PolarHBondContact O-N 3.04Å; Q18-I22 WeakPolarHBondContact O-CG1 3.29Å; Q18-I22 PolarHBondContact O-N 3.35Å
19	L	81.8	Confident	71.6	Confident	107 Å²	107	100.2 Å²	100.2	56%	0.56	51%	0.514	S	S	*	.	H	α-helix	trans	-65.5	-40.6	176.5	-74.4	168.9	0	0	0	112.6	L15 I16 K17 V21 I22 M23	L15-L19 WeakPolarHBondContact O-CG 3.44Å; L15-L19 PolarHBondContact O-N 3.39Å; I16-L19 PolarHBondContact O-N 2.72Å; K17-L19 VanDerWaalsContact C-N 3.35Å; L19-V21 VanDerWaalsContact C-N 3.33Å; L19-V21 PolarHBondContact O-N 3.42Å; L19-I22 PolarHBondContact O-N 3.06Å; L19-M23 WeakPolarHBondContact O-CG 3.5Å; L19-M23 PolarHBondContact O-N 3.27Å
20	D	81.4	Confident	72.1	Confident	69 Å²	69	104 Å²	104	37%	0.369	52%	0.517	S	S	.	.	H	α-helix	trans	-60	-42.2	176.1	-177.4	41.2	0	0	0	111.7	I16 K17 I22 M23 R24	I16-D20 PolarHBondContact O-N 3.46Å; K17-D20 PolarHBondContact O-N 3.33Å; D20-I22 PolarHBondContact O-N 2.96Å; D20-M23 PolarHBondContact O-N 3.19Å; D20-R24 WeakPolarHBondContact O-CG 3.38Å; D20-R24 PolarHBondContact O-N 3.21Å; D20-R24 IonicContact OD1-CZ 3.26Å; D20-R24 IonicContact OD1-NE 3.59Å; D20-R24 PolarHBondContact OD1-NE 3.19Å; D20-R24 IonicContact OD1-NH2 2.72Å; D20-R24 IonicContact OD2-CZ 3.83Å; D20-R24 VanDerWaalsContact OD2-CZ 3.26Å; D20-R24 IonicContact OD2-NE 3.22Å; D20-R24 PolarHBondContact OD2-NE 3.47Å; D20-R24 IonicContact OD2-NH2 3.86Å; D20-R24 PolarHBondContact OD2-NH2 3.22Å
21	V	75.8	Confident	72	Confident	97 Å²	97	103.2 Å²	103.2	59%	0.588	51%	0.51	S	S	*	.	H	α-helix	trans	-62.6	-42.1	176	174.6	0	0	0	0	111.7	K17 Q18 L19 R24 F25	K17-V21 WeakPolarHBondContact O-CG2 3.42Å; K17-V21 PolarHBondContact O-N 3.04Å; Q18-V21 PolarHBondContact O-N 3.04Å; L19-V21 VanDerWaalsContact C-N 3.33Å; L19-V21 PolarHBondContact O-N 3.42Å; V21-R24 PolarHBondContact O-N 3.43Å; V21-F25 WeakPolarHBondContact O-CB 3.34Å; V21-F25 PolarHBondContact O-N 3.05Å
22	I	74.5	Confident	71.9	Confident	92 Å²	92	102 Å²	102	47%	0.472	50%	0.503	S	S	.	.	H	α-helix	trans	-65.6	-42	178.6	-67.6	168.3	0	0	0	110.9	Q18 L19 D20 F25 Q26	Q18-I22 WeakPolarHBondContact O-CG1 3.29Å; Q18-I22 PolarHBondContact O-N 3.35Å; L19-I22 PolarHBondContact O-N 3.06Å; D20-I22 PolarHBondContact O-N 2.96Å; I22-F25 PolarHBondContact O-N 2.98Å; I22-Q26 WeakPolarHBondContact O-CG 3.32Å; I22-Q26 PolarHBondContact O-N 3.28Å
23	M	76.1	Confident	71.2	Confident	113 Å²	113	105.8 Å²	105.8	56%	0.557	51%	0.51	S	S	*	.	H	α-helix	trans	-60.8	-47.2	177.2	-75.5	-175.8	60	0	0	111.6	L19 D20 F25 Q26 E27	L19-M23 WeakPolarHBondContact O-CG 3.5Å; L19-M23 PolarHBondContact O-N 3.27Å; D20-M23 PolarHBondContact O-N 3.19Å; M23-F25 VanDerWaalsContact C-N 3.3Å; M23-F25 PolarHBondContact O-N 3.12Å; M23-Q26 WeakPolarHBondContact O-CB 3.49Å; M23-Q26 PolarHBondContact O-N 3.36Å; M23-Q26 VanDerWaalsContact O-N 3.12Å; M23-E27 PolarHBondContact O-N 3.23Å
24	R	70.3	Confident	70.6	Confident	146 Å²	146	105.2 Å²	105.2	55%	0.551	51%	0.513	S	S	*	.	H	α-helix	trans	-61.9	-37.4	176.8	-66.9	178.7	-163.7	-161.7	6	112.5	D20 V21 Q26 E27 L28	D20-R24 WeakPolarHBondContact O-CG 3.38Å; D20-R24 PolarHBondContact O-N 3.21Å; D20-R24 IonicContact OD1-CZ 3.26Å; D20-R24 IonicContact OD1-NE 3.59Å; D20-R24 PolarHBondContact OD1-NE 3.19Å; D20-R24 IonicContact OD1-NH2 2.72Å; D20-R24 IonicContact OD2-CZ 3.83Å; D20-R24 VanDerWaalsContact OD2-CZ 3.26Å; D20-R24 IonicContact OD2-NE 3.22Å; D20-R24 PolarHBondContact OD2-NE 3.47Å; D20-R24 IonicContact OD2-NH2 3.86Å; D20-R24 PolarHBondContact OD2-NH2 3.22Å; V21-R24 PolarHBondContact O-N 3.43Å; R24-Q26 VanDerWaalsContact C-N 3.35Å; R24-E27 PolarHBondContact O-N 3.05Å; R24-L28 WeakPolarHBondContact O-CG 3.4Å; R24-L28 PolarHBondContact O-N 3.33Å
25	F	68.4	Low	69.8	Low	136 Å²	136	106.1 Å²	106.1	60%	0.596	52%	0.517	S	S	*	.	H	α-helix	trans	-65.6	-38.1	175.4	-172.6	-96.9	0	0	0	112.2	V21 I22 M23 L28 T29	V21-F25 WeakPolarHBondContact O-CB 3.34Å; V21-F25 PolarHBondContact O-N 3.05Å; I22-F25 PolarHBondContact O-N 2.98Å; M23-F25 VanDerWaalsContact C-N 3.3Å; M23-F25 PolarHBondContact O-N 3.12Å; F25-L28 PolarHBondContact O-N 3.03Å; F25-T29 HydrophobicContact CD1-CG2 4.2Å; F25-T29 HydrophobicContact CE1-CG2 3.79Å; F25-T29 HydrophobicContact CZ-CG2 3.98Å; F25-T29 WeakPolarHBondContact O-CG2 3.49Å; F25-T29 PolarHBondContact O-N 3.5Å; F25-T29 PolarHBondContact O-OG1 3.03Å
26	Q	65.2	Low	69.2	Low	107 Å²	107	106.3 Å²	106.3	50%	0.5	52%	0.517	S	S	.	.	H	α-helix	trans	-65.8	-41.6	174.7	-73.5	-178.2	-8.1	0	0	112.1	I22 M23 R24 T29 Q30	I22-Q26 WeakPolarHBondContact O-CG 3.32Å; I22-Q26 PolarHBondContact O-N 3.28Å; M23-Q26 WeakPolarHBondContact O-CB 3.49Å; M23-Q26 PolarHBondContact O-N 3.36Å; M23-Q26 VanDerWaalsContact O-N 3.12Å; R24-Q26 VanDerWaalsContact C-N 3.35Å; Q26-T29 WeakPolarHBondContact CA-OG1 3.46Å; Q26-T29 PolarHBondContact O-N 3.1Å; Q26-T29 PolarHBondContact O-OG1 3.04Å; Q26-Q30 WeakPolarHBondContact O-CB 3.45Å; Q26-Q30 WeakPolarHBondContact O-CG 3.38Å; Q26-Q30 PolarHBondContact O-N 3.38Å
27	E	68.9	Low	68.1	Low	115 Å²	115	106.2 Å²	106.2	54%	0.537	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-43.6	175.7	-72.4	175.9	-179.4	0	0	112.1	M23 R24 Q30 N31	M23-E27 PolarHBondContact O-N 3.23Å; R24-E27 PolarHBondContact O-N 3.05Å; E27-Q30 PolarHBondContact O-N 3.44Å; E27-N31 PolarHBondContact O-N 2.92Å
28	L	62.3	Low	67.4	Low	104 Å²	104	106.4 Å²	106.4	55%	0.545	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-47.1	176	-71.9	170.6	0	0	0	111.6	R24 F25 Q30 N31 D32	R24-L28 WeakPolarHBondContact O-CG 3.4Å; R24-L28 PolarHBondContact O-N 3.33Å; F25-L28 PolarHBondContact O-N 3.03Å; L28-Q30 VanDerWaalsContact C-N 3.31Å; L28-Q30 PolarHBondContact O-N 3.41Å; L28-N31 PolarHBondContact O-N 3Å; L28-D32 PolarHBondContact O-N 3.49Å
29	T	65.7	Low	66.6	Low	54 Å²	54	107.2 Å²	107.2	33%	0.331	52%	0.524	S	S	.	.	H	α-helix	trans	-68.5	-28.2	179.6	53.3	0	0	0	0	113.4	F25 Q26 R33	F25-T29 HydrophobicContact CD1-CG2 4.2Å; F25-T29 HydrophobicContact CE1-CG2 3.79Å; F25-T29 HydrophobicContact CZ-CG2 3.98Å; F25-T29 WeakPolarHBondContact O-CG2 3.49Å; F25-T29 PolarHBondContact O-N 3.5Å; F25-T29 PolarHBondContact O-OG1 3.03Å; Q26-T29 WeakPolarHBondContact CA-OG1 3.46Å; Q26-T29 PolarHBondContact O-N 3.1Å; Q26-T29 PolarHBondContact O-OG1 3.04Å; T29-R33 PolarHBondContact O-N 3.06Å
30	Q	67.2	Low	65.5	Low	133 Å²	133	103.7 Å²	103.7	62%	0.621	51%	0.511	S	S	*	.	H	α-helix	trans	-71.3	-39.4	171.1	-75.1	-175.7	9.2	0	0	112.1	Q26 E27 L28 R33 S34	Q26-Q30 WeakPolarHBondContact O-CB 3.45Å; Q26-Q30 WeakPolarHBondContact O-CG 3.38Å; Q26-Q30 PolarHBondContact O-N 3.38Å; E27-Q30 PolarHBondContact O-N 3.44Å; L28-Q30 VanDerWaalsContact C-N 3.31Å; L28-Q30 PolarHBondContact O-N 3.41Å; Q30-R33 PolarHBondContact O-N 3.35Å; Q30-S34 PolarHBondContact O-N 2.89Å
31	N	63.5	Low	64.4	Low	98 Å²	98	104 Å²	104	52%	0.524	51%	0.512	S	S	.	.	H	α-helix	trans	-65.1	-39	173.3	-78.6	-25.5	0	0	0	112	E27 L28 S34 Q35	E27-N31 PolarHBondContact O-N 2.92Å; L28-N31 PolarHBondContact O-N 3Å; N31-S34 PolarHBondContact O-N 3.19Å; N31-S34 PolarHBondContact O-OG 3.38Å; N31-Q35 PolarHBondContact O-N 2.96Å
32	D	63.6	Low	63.5	Low	86 Å²	86	102 Å²	102	46%	0.46	50%	0.498	S	S	.	.	H	α-helix	trans	-65.5	-40.4	175.1	-71.2	-13.7	0	0	0	111.2	L28 Q35 I36	L28-D32 PolarHBondContact O-N 3.49Å; D32-Q35 PolarHBondContact O-N 3.5Å; D32-I36 VanDerWaalsContact O-CG1 3.25Å; D32-I36 WeakPolarHBondContact O-CG1 3.25Å; D32-I36 PolarHBondContact O-N 3Å
33	R	59.4	Low	62.6	Low	186 Å²	186	102.3 Å²	102.3	70%	0.702	50%	0.499	S	S	*	.	H	α-helix	trans	-61.8	-43	172.9	-83	-175.2	179.6	-173.4	1.3	112.2	T29 Q30 Q35 I36 D37	T29-R33 PolarHBondContact O-N 3.06Å; Q30-R33 PolarHBondContact O-N 3.35Å; R33-Q35 VanDerWaalsContact C-N 3.3Å; R33-Q35 PolarHBondContact O-N 3.35Å; R33-I36 PolarHBondContact O-N 3.11Å; R33-D37 WeakPolarHBondContact O-CB 3.48Å; R33-D37 PolarHBondContact O-N 3.41Å
34	S	60.6	Low	61.7	Low	66 Å²	66	103.8 Å²	103.8	46%	0.462	50%	0.499	S	S	.	.	H	α-helix	trans	-66.2	-35.1	179.3	75.1	0	0	0	0	111.9	Q30 N31 H38	Q30-S34 PolarHBondContact O-N 2.89Å; N31-S34 PolarHBondContact O-N 3.19Å; N31-S34 PolarHBondContact O-OG 3.38Å; S34-H38 VanDerWaalsContact O-CB 3.24Å; S34-H38 WeakPolarHBondContact O-CB 3.48Å; S34-H38 PolarHBondContact O-N 3.42Å
35	Q	56.6	Low	60.8	Low	123 Å²	123	99.6 Å²	99.6	58%	0.575	49%	0.492	S	S	*	.	H	α-helix	trans	-65.1	-46.8	170.6	-84.4	-172.3	-9.6	0	0	112.3	N31 D32 R33 D37 H38 E39	N31-Q35 PolarHBondContact O-N 2.96Å; D32-Q35 PolarHBondContact O-N 3.5Å; R33-Q35 VanDerWaalsContact C-N 3.3Å; R33-Q35 PolarHBondContact O-N 3.35Å; Q35-D37 VanDerWaalsContact C-N 3.32Å; Q35-D37 PolarHBondContact O-N 3.43Å; Q35-H38 WeakPolarHBondContact O-CB 3.33Å; Q35-H38 PolarHBondContact O-N 2.95Å; Q35-E39 WeakPolarHBondContact O-CG 3.46Å; Q35-E39 PolarHBondContact O-N 3.39Å
36	I	58.7	Low	60	Low	90 Å²	90	96.6 Å²	96.6	46%	0.462	48%	0.482	S	S	.	.	H	α-helix	trans	-60.5	-43.7	177.3	-68.6	164.8	0	0	0	110.7	D32 R33 H38 E39 A40	D32-I36 VanDerWaalsContact O-CG1 3.25Å; D32-I36 WeakPolarHBondContact O-CG1 3.25Å; D32-I36 PolarHBondContact O-N 3Å; R33-I36 PolarHBondContact O-N 3.11Å; I36-H38 VanDerWaalsContact C-N 3.34Å; I36-E39 PolarHBondContact O-N 3.02Å; I36-A40 VanDerWaalsContact O-CB 3.26Å; I36-A40 WeakPolarHBondContact O-CB 3.45Å; I36-A40 PolarHBondContact O-N 3.16Å
37	D	59.1	Low	59.2	Low	97 Å²	97	94.2 Å²	94.2	52%	0.519	48%	0.481	S	S	.	.	H	α-helix	trans	-65.1	-39.5	177.4	-74.7	-24.5	0	0	0	111.5	R33 Q35 A40 N41	R33-D37 WeakPolarHBondContact O-CB 3.48Å; R33-D37 PolarHBondContact O-N 3.41Å; Q35-D37 VanDerWaalsContact C-N 3.32Å; Q35-D37 PolarHBondContact O-N 3.43Å; D37-A40 PolarHBondContact O-N 3.26Å; D37-N41 WeakPolarHBondContact O-CB 3.26Å; D37-N41 PolarHBondContact O-N 3.36Å; D37-N41 PolarHBondContact O-ND2 2.85Å
38	H	64	Low	58.1	Low	121 Å²	121	95 Å²	95	56%	0.56	48%	0.484	S	S	*	.	H	α-helix	trans	-63.2	-48.1	175.3	-175.8	66.8	0	0	0	111.7	S34 Q35 I36 A40 N41 I42	S34-H38 VanDerWaalsContact O-CB 3.24Å; S34-H38 WeakPolarHBondContact O-CB 3.48Å; S34-H38 PolarHBondContact O-N 3.42Å; Q35-H38 WeakPolarHBondContact O-CB 3.33Å; Q35-H38 PolarHBondContact O-N 2.95Å; I36-H38 VanDerWaalsContact C-N 3.34Å; H38-A40 PolarHBondContact O-N 2.85Å; H38-N41 WeakPolarHBondContact O-CB 3.42Å; H38-N41 PolarHBondContact O-N 3.46Å; H38-I42 WeakPolarHBondContact O-CG1 3.24Å; H38-I42 PolarHBondContact O-N 2.86Å
39	E	55.2	Low	57.2	Low	111 Å²	111	95 Å²	95	52%	0.519	48%	0.484	S	S	.	.	H	α-helix	trans	-63.7	-41.2	177	-72.3	-173.5	175.9	0	0	111.9	Q35 I36 N41 I42 I43	Q35-E39 WeakPolarHBondContact O-CG 3.46Å; Q35-E39 PolarHBondContact O-N 3.39Å; I36-E39 PolarHBondContact O-N 3.02Å; E39-N41 VanDerWaalsContact C-N 3.27Å; E39-N41 PolarHBondContact O-N 2.95Å; E39-I42 PolarHBondContact O-N 2.91Å; E39-I43 WeakPolarHBondContact O-CG1 3.47Å; E39-I43 PolarHBondContact O-N 3.28Å
40	A	58.2	Low	55.8	Low	33 Å²	33	95.6 Å²	95.6	27%	0.273	49%	0.49	S	S	.	.	H	α-helix	trans	-63.3	-33.6	175.2	0	0	0	0	0	112.5	I36 D37 H38 R44	I36-A40 VanDerWaalsContact O-CB 3.26Å; I36-A40 WeakPolarHBondContact O-CB 3.45Å; I36-A40 PolarHBondContact O-N 3.16Å; D37-A40 PolarHBondContact O-N 3.26Å; H38-A40 PolarHBondContact O-N 2.85Å; A40-R44 WeakPolarHBondContact O-CB 3.33Å; A40-R44 PolarHBondContact O-N 2.93Å; A40-R44 PolarHBondContact O-NE 3.2Å
41	N	58.8	Low	54.5	Low	76 Å²	76	91 Å²	91	41%	0.406	47%	0.474	S	S	.	.	H	α-helix	trans	-71.6	-37.1	174.1	-75.2	-22.7	0	0	0	112.1	D37 H38 E39 R44 S45	D37-N41 WeakPolarHBondContact O-CB 3.26Å; D37-N41 PolarHBondContact O-N 3.36Å; D37-N41 PolarHBondContact O-ND2 2.85Å; H38-N41 WeakPolarHBondContact O-CB 3.42Å; H38-N41 PolarHBondContact O-N 3.46Å; E39-N41 VanDerWaalsContact C-N 3.27Å; E39-N41 PolarHBondContact O-N 2.95Å; N41-R44 PolarHBondContact O-N 3.27Å; N41-R44 VanDerWaalsContact OD1-CZ 3.22Å; N41-R44 PolarHBondContact OD1-NH1 3.01Å; N41-R44 PolarHBondContact OD1-NH2 3.45Å; N41-S45 WeakPolarHBondContact O-CB 3.49Å; N41-S45 PolarHBondContact O-N 2.92Å; N41-S45 PolarHBondContact O-OG 2.87Å
42	I	57.2	Low	53.5	Low	55 Å²	55	93.1 Å²	93.1	28%	0.282	48%	0.484	S	S	.	.	H	α-helix	trans	-62.5	-49.4	172.7	-68.1	169.2	0	0	0	109.7	H38 E39 R44 S45 D46	H38-I42 WeakPolarHBondContact O-CG1 3.24Å; H38-I42 PolarHBondContact O-N 2.86Å; E39-I42 PolarHBondContact O-N 2.91Å; I42-R44 VanDerWaalsContact C-N 3.31Å; I42-R44 PolarHBondContact O-N 3.31Å; I42-S45 PolarHBondContact O-N 3.37Å; I42-S45 VanDerWaalsContact O-N 3.13Å; I42-D46 PolarHBondContact O-N 3.2Å
43	I	56.6	Low	52.2	Low	98 Å²	98	92.5 Å²	92.5	50%	0.503	49%	0.486	S	S	.	.	H	α-helix	trans	-60	-42	-180	-66.5	165.7	0	0	0	111.2	E39 D46 A47	E39-I43 WeakPolarHBondContact O-CG1 3.47Å; E39-I43 PolarHBondContact O-N 3.28Å; I43-D46 PolarHBondContact O-N 2.95Å; I43-A47 WeakPolarHBondContact O-CB 3.39Å; I43-A47 PolarHBondContact O-N 3.49Å
44	R	55.8	Low	51.1	Low	145 Å²	145	87.7 Å²	87.7	55%	0.547	48%	0.475	S	S	.	.	H	α-helix	trans	-63.2	-42.8	175.3	-85.7	-176.6	-87.6	153.2	-5.9	112.4	A40 N41 I42 A47 Q48	A40-R44 WeakPolarHBondContact O-CB 3.33Å; A40-R44 PolarHBondContact O-N 2.93Å; A40-R44 PolarHBondContact O-NE 3.2Å; N41-R44 PolarHBondContact O-N 3.27Å; N41-R44 VanDerWaalsContact OD1-CZ 3.22Å; N41-R44 PolarHBondContact OD1-NH1 3.01Å; N41-R44 PolarHBondContact OD1-NH2 3.45Å; I42-R44 VanDerWaalsContact C-N 3.31Å; I42-R44 PolarHBondContact O-N 3.31Å; R44-A47 PolarHBondContact O-N 3.49Å; R44-Q48 WeakPolarHBondContact O-CG 3.12Å; R44-Q48 PolarHBondContact O-N 2.97Å; R44-Q48 VanDerWaalsContact O-N 3.07Å
45	S	51.3	Low	50.2	Low	58 Å²	58	90.5 Å²	90.5	41%	0.406	49%	0.491	S	S	.	.	H	α-helix	trans	-63.7	-44.2	177	-57.1	0	0	0	0	111.3	N41 I42 A47 Q48 I49	N41-S45 WeakPolarHBondContact O-CB 3.49Å; N41-S45 PolarHBondContact O-N 2.92Å; N41-S45 PolarHBondContact O-OG 2.87Å; I42-S45 PolarHBondContact O-N 3.37Å; I42-S45 VanDerWaalsContact O-N 3.13Å; S45-A47 PolarHBondContact O-N 3.19Å; S45-Q48 WeakPolarHBondContact O-CB 3.45Å; S45-Q48 PolarHBondContact O-N 2.91Å; S45-I49 VanDerWaalsContact O-CG1 3.29Å; S45-I49 WeakPolarHBondContact O-CG1 3.39Å; S45-I49 PolarHBondContact O-N 3.42Å
46	D	51.2	Low	49.5	Very low	72 Å²	72	88.7 Å²	88.7	39%	0.385	50%	0.498	S	S	.	.	H	α-helix	trans	-63.2	-42	177.4	-79	-3	0	0	0	111.3	I42 I43 Q48 I49 C50	I42-D46 PolarHBondContact O-N 3.2Å; I43-D46 PolarHBondContact O-N 2.95Å; D46-Q48 VanDerWaalsContact C-N 3.32Å; D46-Q48 PolarHBondContact O-N 3.27Å; D46-I49 PolarHBondContact O-N 2.97Å; D46-C50 WeakPolarHBondContact O-CB 3.46Å; D46-C50 PolarHBondContact O-N 3.27Å; D46-C50 PolarHBondContact O-SG 2.95Å; D46-C50 VanDerWaalsContact O-SG 3.34Å
47	A	50.2	Low	48.6	Very low	58 Å²	58	90.4 Å²	90.4	48%	0.479	51%	0.507	S	S	.	.	H	α-helix	trans	-62.1	-38.4	175.6	0	0	0	0	0	112.5	I43 R44 S45 A51	I43-A47 WeakPolarHBondContact O-CB 3.39Å; I43-A47 PolarHBondContact O-N 3.49Å; R44-A47 PolarHBondContact O-N 3.49Å; S45-A47 PolarHBondContact O-N 3.19Å; A47-A51 WeakPolarHBondContact O-CB 3.41Å; A47-A51 PolarHBondContact O-N 3.48Å
48	Q	45.4	Very low	47.5	Very low	131 Å²	131	89.9 Å²	89.9	61%	0.612	51%	0.509	S	S	*	.	H	α-helix	trans	-66.7	-42.7	174.3	-73.3	178	-14.6	0	0	111.9	R44 S45 D46 C50 A51 I52	R44-Q48 WeakPolarHBondContact O-CG 3.12Å; R44-Q48 PolarHBondContact O-N 2.97Å; R44-Q48 VanDerWaalsContact O-N 3.07Å; S45-Q48 WeakPolarHBondContact O-CB 3.45Å; S45-Q48 PolarHBondContact O-N 2.91Å; D46-Q48 VanDerWaalsContact C-N 3.32Å; D46-Q48 PolarHBondContact O-N 3.27Å; Q48-C50 VanDerWaalsContact C-N 3.34Å; Q48-A51 PolarHBondContact O-N 3.43Å; Q48-I52 WeakPolarHBondContact O-CG1 3.42Å; Q48-I52 PolarHBondContact O-N 2.89Å; Q48-I52 VanDerWaalsContact O-N 3.12Å
49	I	42.3	Very low	46.5	Very low	105 Å²	105	89.7 Å²	89.7	54%	0.538	52%	0.516	S	S	.	.	H	α-helix	trans	-62.4	-44	176.5	-68.1	165.4	0	0	0	110.2	S45 D46 A51 I52 S53	S45-I49 VanDerWaalsContact O-CG1 3.29Å; S45-I49 WeakPolarHBondContact O-CG1 3.39Å; S45-I49 PolarHBondContact O-N 3.42Å; D46-I49 PolarHBondContact O-N 2.97Å; I49-A51 VanDerWaalsContact C-N 3.33Å; I49-A51 PolarHBondContact O-N 3.44Å; I49-I52 PolarHBondContact O-N 3.48Å; I49-S53 PolarHBondContact O-N 2.83Å; I49-S53 VanDerWaalsContact O-N 3.15Å; I49-S53 PolarHBondContact O-OG 2.84Å
50	C	37.5	Very low	45.8	Very low	66 Å²	66	90 Å²	90	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-40.2	175.5	-73	0	0	0	0	112.3	D46 Q48 I52 S53	D46-C50 WeakPolarHBondContact O-CB 3.46Å; D46-C50 PolarHBondContact O-N 3.27Å; D46-C50 PolarHBondContact O-SG 2.95Å; D46-C50 VanDerWaalsContact O-SG 3.34Å; Q48-C50 VanDerWaalsContact C-N 3.34Å; C50-I52 VanDerWaalsContact C-N 3.35Å; C50-I52 PolarHBondContact O-N 2.92Å; C50-S53 WeakPolarHBondContact CA-OG 3.45Å; C50-S53 PolarHBondContact O-N 2.89Å; C50-S53 PolarHBondContact O-OG 3.13Å
51	A	39.6	Very low	44.8	Very low	36 Å²	36	90.8 Å²	90.8	30%	0.298	54%	0.537	S	S	.	.	H	α-helix	trans	-65.6	-33.7	177.4	0	0	0	0	0	113.3	A47 Q48 I49 V59	A47-A51 WeakPolarHBondContact O-CB 3.41Å; A47-A51 PolarHBondContact O-N 3.48Å; Q48-A51 PolarHBondContact O-N 3.43Å; I49-A51 VanDerWaalsContact C-N 3.33Å; I49-A51 PolarHBondContact O-N 3.44Å; A51-V59 HydrophobicContact CB-CG2 3.97Å
52	I	41.8	Very low	43.7	Very low	142 Å²	142	91.6 Å²	91.6	73%	0.728	54%	0.541	S	S	*	.	H	α-helix	trans	-72.7	-34.2	177.2	-64.8	163.3	0	0	0	111.2	Q48 I49 C50 N54	Q48-I52 WeakPolarHBondContact O-CG1 3.42Å; Q48-I52 PolarHBondContact O-N 2.89Å; Q48-I52 VanDerWaalsContact O-N 3.12Å; I49-I52 PolarHBondContact O-N 3.48Å; C50-I52 VanDerWaalsContact C-N 3.35Å; C50-I52 PolarHBondContact O-N 2.92Å; I52-N54 VanDerWaalsContact C-N 3.27Å; I52-N54 PolarHBondContact O-N 2.97Å
53	S	36.4	Very low	42.7	Very low	73 Å²	73	96.3 Å²	96.3	51%	0.51	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.4	-7.9	-176.5	61.3	0	0	0	0	115.3	I49 C50	I49-S53 PolarHBondContact O-N 2.83Å; I49-S53 VanDerWaalsContact O-N 3.15Å; I49-S53 PolarHBondContact O-OG 2.84Å; C50-S53 WeakPolarHBondContact CA-OG 3.45Å; C50-S53 PolarHBondContact O-N 2.89Å; C50-S53 PolarHBondContact O-OG 3.13Å
54	N	37	Very low	41.7	Very low	86 Å²	86	95.2 Å²	95.2	46%	0.46	57%	0.567	S	S	.	*			trans	-133.5	78.5	-179.1	-120.3	-15.4	0	0	0	111.3	I52 A56 N57	I52-N54 VanDerWaalsContact C-N 3.27Å; I52-N54 PolarHBondContact O-N 2.97Å; N54-A56 PolarHBondContact O-N 3.35Å; N54-N57 PolarHBondContact O-N 3.49Å
55	P	40.7	Very low	40.7	Very low	124 Å²	124	95.2 Å²	95.2	81%	0.805	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	-7	-175.9	26.5	-33.4	0	0	0	114.1
56	A	43.3	Very low	39.9	Very low	86 Å²	86	98 Å²	98	71%	0.711	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	-9.3	177.4	0	0	0	0	0	114.3	N54	N54-A56 PolarHBondContact O-N 3.35Å
57	N	38.1	Very low	39.1	Very low	125 Å²	125	98.4 Å²	98.4	67%	0.668	60%	0.601	S	S	*	*	S	Bend	trans	-138.9	88.3	174.7	-101.8	-20.8	0	0	0	108.7	N54 V59	N54-N57 PolarHBondContact O-N 3.49Å; N57-V59 PolarHBondContact O-N 3.05Å
58	P	37.4	Very low	38.2	Very low	86 Å²	86	103.3 Å²	103.3	56%	0.558	61%	0.614	S	S	*	*			trans	-58	133.6	166.9	25.6	-30.1	0	0	0	107.1	T60	P58-T60 HydrophobicContact CB-CG2 4.38Å; P58-T60 PolarHBondContact O-N 2.8Å; P58-T60 PolarHBondContact O-OG1 3.44Å
59	V	43.4	Very low	37.7	Very low	117 Å²	117	104.3 Å²	104.3	71%	0.709	62%	0.622	S	S	*	*			trans	-69.2	68.3	165.3	-177	0	0	0	0	107.2	A51 N57	A51-V59 HydrophobicContact CB-CG2 3.97Å; N57-V59 PolarHBondContact O-N 3.05Å
60	T	39.7	Very low	37.3	Very low	119 Å²	119	110.6 Å²	110.6	73%	0.73	64%	0.639	S	S	*	*			trans	-93	17	160.3	36	0	0	0	0	110.1	P58 D62	P58-T60 HydrophobicContact CB-CG2 4.38Å; P58-T60 PolarHBondContact O-N 2.8Å; P58-T60 PolarHBondContact O-OG1 3.44Å; T60-D62 PolarHBondContact O-N 2.95Å
61	G	37.8	Very low	37.1	Very low	48 Å²	48	117.2 Å²	117.2	50%	0.495	66%	0.66	S	S	.	*	S	Bend	trans	-68.1	89.7	160.2	0	0	0	0	0	108	I63	G61-I63 PolarHBondContact O-N 3.1Å; G61-I63 VanDerWaalsContact O-N 3.1Å
62	D	34.3	Very low	36.7	Very low	93 Å²	93	122 Å²	122	50%	0.497	68%	0.681	S	S	.	*			trans	-29.8	112.9	165.2	-162	-7.4	0	0	0	110.2	T60 S64 Q65	T60-D62 PolarHBondContact O-N 2.95Å; D62-S64 PolarHBondContact O-N 2.81Å; D62-S64 WeakPolarHBondContact OD1-CB 3.5Å; D62-S64 PolarHBondContact OD1-N 3.36Å; D62-S64 PolarHBondContact OD1-OG 2.74Å; D62-Q65 HydrophobicContact CB-CG 4.3Å; D62-Q65 PolarHBondContact O-N 3.42Å
63	I	38	Very low	36.5	Very low	154 Å²	154	120.2 Å²	120.2	79%	0.79	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-56.7	-13.5	174.3	-62.5	168.5	0	0	0	110	G61 Q65 T66	G61-I63 PolarHBondContact O-N 3.1Å; G61-I63 VanDerWaalsContact O-N 3.1Å; I63-Q65 VanDerWaalsContact C-N 3.35Å; I63-T66 PolarHBondContact O-OG1 3.34Å
64	S	34.7	Very low	36.6	Very low	76 Å²	76	122 Å²	122	53%	0.531	70%	0.701	S	S	.	*	G	3₁₀ helix	trans	-69	-19.7	169.5	-48	0	0	0	0	115	D62 T66 A67	D62-S64 PolarHBondContact O-N 2.81Å; D62-S64 WeakPolarHBondContact OD1-CB 3.5Å; D62-S64 PolarHBondContact OD1-N 3.36Å; D62-S64 PolarHBondContact OD1-OG 2.74Å; S64-T66 PolarHBondContact O-N 3.25Å; S64-A67 WeakPolarHBondContact O-CB 3.29Å; S64-A67 PolarHBondContact O-N 3.33Å
65	Q	33.9	Very low	36.6	Very low	144 Å²	144	126.1 Å²	126.1	67%	0.673	72%	0.717	S	S	*	*	G	3₁₀ helix	trans	-79.3	-14.2	-177.4	-75.7	-170.7	11.2	0	0	114.4	D62 I63 A67	D62-Q65 HydrophobicContact CB-CG 4.3Å; D62-Q65 PolarHBondContact O-N 3.42Å; I63-Q65 VanDerWaalsContact C-N 3.35Å; Q65-A67 PolarHBondContact O-N 3.03Å
66	T	35.3	Very low	36.6	Very low	118 Å²	118	125.9 Å²	125.9	72%	0.724	72%	0.715	S	S	*	*	G	3₁₀ helix	trans	-72.7	-2.7	168.4	21.2	0	0	0	0	113.9	I63 S64	I63-T66 PolarHBondContact O-OG1 3.34Å; S64-T66 PolarHBondContact O-N 3.25Å
67	A	34.4	Very low	36.5	Very low	79 Å²	79	126 Å²	126	65%	0.653	71%	0.708	S	S	*	*	G	3₁₀ helix	trans	-91.5	-0.5	179.4	0	0	0	0	0	114.9	S64 Q65 L69	S64-A67 WeakPolarHBondContact O-CB 3.29Å; S64-A67 PolarHBondContact O-N 3.33Å; Q65-A67 PolarHBondContact O-N 3.03Å; A67-L69 PolarHBondContact O-N 3.46Å; A67-L69 VanDerWaalsContact O-N 3.16Å
68	H	30.8	Very low	36.1	Very low	162 Å²	162	127.6 Å²	127.6	75%	0.75	72%	0.717	S	S	*	*			trans	-89.1	55.5	171.9	-68.1	-50	0	0	0	112.1	R70	H68-R70 PolarHBondContact O-N 2.86Å
69	L	36.3	Very low	36.1	Very low	151 Å²	151	129.2 Å²	129.2	79%	0.791	72%	0.716	S	S	*	*			trans	-66.3	104.5	161.1	-78.5	167.5	0	0	0	107.9	A67 K71	A67-L69 PolarHBondContact O-N 3.46Å; A67-L69 VanDerWaalsContact O-N 3.16Å; L69-K71 PolarHBondContact O-N 3.15Å
70	R	32.8	Very low	35.4	Very low	237 Å²	237	129.4 Å²	129.4	89%	0.894	72%	0.722	S	S	*	*			trans	-52.8	133.9	-178.2	-76.1	177.5	171.5	173.6	-2.3	111	H68 N72	H68-R70 PolarHBondContact O-N 2.86Å; R70-N72 PolarHBondContact O-N 3.25Å
71	K	33.2	Very low	35.3	Very low	205 Å²	205	129.3 Å²	129.3	89%	0.891	72%	0.716	S	S	*	*	S	Bend	trans	-60.7	8.7	179.5	-104.7	-179.6	177.4	180	0	117.1	L69	L69-K71 PolarHBondContact O-N 3.15Å
72	N	31.6	Very low	35	Very low	136 Å²	136	132.5 Å²	132.5	73%	0.727	73%	0.731	S	S	*	*			trans	-118.1	92.6	-172	-65.5	-7.2	0	0	0	110.6	R70 S74	R70-N72 PolarHBondContact O-N 3.25Å; N72-S74 PolarHBondContact O-N 3.24Å
73	A	37.6	Very low	35	Very low	106 Å²	106	133.4 Å²	133.4	88%	0.876	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67	101.4	166.5	0	0	0	0	0	109.2
74	S	39.4	Very low	34.6	Very low	111 Å²	111	129 Å²	129	78%	0.776	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-169.2	-13	160.8	15.7	0	0	0	0	115.2	N72	N72-S74 PolarHBondContact O-N 3.24Å
75	E	35.8	Very low	34.6	Very low	172 Å²	172	129.9 Å²	129.9	80%	0.804	74%	0.742	S	S	*	*	S	Bend	trans	-131.9	139.2	177	-69.8	-178.6	165.4	0	0	111.3
76	P	40.2	Very low	34.4	Very low	118 Å²	118	126.4 Å²	126.4	77%	0.766	75%	0.745	S	S	*	*			trans	-61	128.6	170.9	25.6	-30.8	0	0	0	108.2	N78	P76-N78 PolarHBondContact O-N 2.93Å; P76-N78 VanDerWaalsContact O-N 3.1Å
77	P	41.3	Very low	34.2	Very low	88 Å²	88	125.9 Å²	125.9	57%	0.571	75%	0.746	S	S	*	*			trans	-65.9	119.1	-177.1	27.5	-33.9	0	0	0	109.1	F79	P77-F79 HydrophobicContact CB-CD2 3.83Å; P77-F79 HydrophobicContact CB-CE1 4.31Å; P77-F79 HydrophobicContact CB-CE2 3.3Å; P77-F79 HydrophobicContact CB-CZ 3.57Å; P77-F79 HydrophobicContact CG-CD2 3.9Å; P77-F79 HydrophobicContact CG-CE2 3.27Å; P77-F79 HydrophobicContact CG-CZ 3.94Å; P77-F79 PolarHBondContact O-N 3.12Å; P77-F79 VanDerWaalsContact O-N 3.11Å
78	N	30.2	Very low	34.2	Very low	159 Å²	159	130.4 Å²	130.4	85%	0.85	75%	0.751	S	S	*	*			trans	-80.5	90.9	176.5	-152	-1.4	0	0	0	108.1	P76	P76-N78 PolarHBondContact O-N 2.93Å; P76-N78 VanDerWaalsContact O-N 3.1Å
79	F	37.9	Very low	34.4	Very low	121 Å²	121	129 Å²	129	53%	0.531	75%	0.754	S	S	.	*			trans	-90	110.7	177.9	-66.7	-67.8	0	0	0	110.6	P77 I81	P77-F79 HydrophobicContact CB-CD2 3.83Å; P77-F79 HydrophobicContact CB-CE1 4.31Å; P77-F79 HydrophobicContact CB-CE2 3.3Å; P77-F79 HydrophobicContact CB-CZ 3.57Å; P77-F79 HydrophobicContact CG-CD2 3.9Å; P77-F79 HydrophobicContact CG-CE2 3.27Å; P77-F79 HydrophobicContact CG-CZ 3.94Å; P77-F79 PolarHBondContact O-N 3.12Å; P77-F79 VanDerWaalsContact O-N 3.11Å; F79-I81 PolarHBondContact O-N 3.42Å
80	S	29	Very low	34.3	Very low	120 Å²	120	125.1 Å²	125.1	84%	0.839	75%	0.751	S	S	*	*			trans	-83.8	101.4	163.9	-69.1	0	0	0	0	108.8	S82	S80-S82 PolarHBondContact O-N 3.23Å
81	I	37.1	Very low	34.4	Very low	117 Å²	117	122.4 Å²	122.4	60%	0.6	74%	0.741	S	S	*	*			trans	-83.9	108.5	172.6	-53.1	174.4	0	0	0	107.2	F79 S83	F79-I81 PolarHBondContact O-N 3.42Å; I81-S83 PolarHBondContact O-N 3.07Å
82	S	31	Very low	34.7	Very low	116 Å²	116	119 Å²	119	81%	0.811	73%	0.731	S	S	*	*			trans	-70.9	97.2	168.4	64.1	0	0	0	0	108.5	S80 G84	S80-S82 PolarHBondContact O-N 3.23Å; S82-G84 VanDerWaalsContact C-N 3.32Å; S82-G84 PolarHBondContact O-N 3.28Å
83	S	34.8	Very low	35	Very low	112 Å²	112	117.3 Å²	117.3	78%	0.783	73%	0.725	S	S	*	*			trans	-69.9	87.2	175.9	59.4	0	0	0	0	110.5	I81	I81-S83 PolarHBondContact O-N 3.07Å
84	G	29.9	Very low	35	Very low	62 Å²	62	116.1 Å²	116.1	64%	0.639	71%	0.707	S	S	*	*			trans	-97.7	53	170.1	0	0	0	0	0	112.4	S82	S82-G84 VanDerWaalsContact C-N 3.32Å; S82-G84 PolarHBondContact O-N 3.28Å
85	C	33.5	Very low	35	Very low	93 Å²	93	115.4 Å²	115.4	63%	0.628	70%	0.698	S	S	*	*	S	Bend	trans	-165.9	124.2	154.2	-160.9	0	0	0	0	107.7
86	G	30.2	Very low	35.1	Very low	71 Å²	71	113.4 Å²	113.4	73%	0.732	69%	0.689	S	S	*	*			trans	-66.2	136.2	-163	0	0	0	0	0	115.2
87	S	31.2	Very low	34.9	Very low	108 Å²	108	111.4 Å²	111.4	76%	0.755	68%	0.675	S	S	*	*			trans	56	117	143.4	-134.6	0	0	0	0	116.2
88	K	34.1	Very low	34.6	Very low	173 Å²	173	114.1 Å²	114.1	75%	0.752	68%	0.678	S	S	*	*			cis	-165.9	142	42.1	-73.5	177.8	177	170.8	0	109.5
89	T	36.5	Very low	34.8	Very low	133 Å²	133	111 Å²	111	82%	0.816	67%	0.667	S	S	*	*	S	Bend	trans	57.3	106.9	142.7	57.7	0	0	0	0	119.5
90	G	33.5	Very low	34.7	Very low	70 Å²	70	113.3 Å²	113.3	72%	0.722	67%	0.674	S	S	*	*	S	Bend	trans	97.9	-12.6	142.3	0	0	0	0	0	118.7
91	R	34.7	Very low	35.1	Very low	180 Å²	180	114.1 Å²	114.1	68%	0.679	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.4	-5.6	-166	-138.4	172.6	179.9	-174.9	-2.3	116.4
92	L	38.7	Very low	35.2	Very low	134 Å²	134	119.5 Å²	119.5	70%	0.702	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.5	-3.9	179.5	-101.5	149.3	0	0	0	114.2
93	V	39.3	Very low	35.7	Very low	99 Å²	99	122.1 Å²	122.1	60%	0.6	68%	0.676	S	S	*	*	S	Bend	trans	-83.7	-19	-177.3	-177	0	0	0	0	112.3	V97	V93-V97 HydrophobicContact CG1-CG2 4.14Å; V93-V97 VanDerWaalsContact O-CG2 3.32Å; V93-V97 WeakPolarHBondContact O-CG2 3.35Å
94	V	37.7	Very low	35.7	Very low	82 Å²	82	122 Å²	122	50%	0.497	67%	0.666	S	S	.	*	H	α-helix	trans	-79	-30.9	-168.3	-174.2	0	0	0	0	112.9	F98	V94-F98 HydrophobicContact CG1-CD2 4.41Å; V94-F98 PolarHBondContact O-N 3.29Å
95	T	38.7	Very low	36	Very low	96 Å²	96	123.5 Å²	123.5	59%	0.589	67%	0.667	S	S	*	*	H	α-helix	trans	-74.3	-31	-175.6	-39	0	0	0	0	112.9
96	E	36.9	Very low	36	Very low	129 Å²	129	132.1 Å²	132.1	60%	0.603	69%	0.694	S	S	*	*	H	α-helix	trans	-84.6	-27.8	179.1	-68.3	-164.1	154.1	0	0	113.5
97	V	37.3	Very low	36.3	Very low	77 Å²	77	135.2 Å²	135.2	47%	0.467	69%	0.692	S	S	.	*	H	α-helix	trans	-73.9	-31.8	179.1	177.9	0	0	0	0	112	V93 C99 Y100	V93-V97 HydrophobicContact CG1-CG2 4.14Å; V93-V97 VanDerWaalsContact O-CG2 3.32Å; V93-V97 WeakPolarHBondContact O-CG2 3.35Å; V97-C99 VanDerWaalsContact C-N 3.35Å; V97-C99 PolarHBondContact O-N 2.71Å; V97-Y100 PolarHBondContact O-N 3.32Å
98	F	34.3	Very low	36.6	Very low	145 Å²	145	136.6 Å²	136.6	64%	0.636	69%	0.689	S	S	*	*	H	α-helix	trans	-68.9	-30.3	179.6	-113.2	-87	0	0	0	113.6	V94	V94-F98 HydrophobicContact CG1-CD2 4.41Å; V94-F98 PolarHBondContact O-N 3.29Å
99	C	35.4	Very low	36.7	Very low	94 Å²	94	134.6 Å²	134.6	64%	0.635	69%	0.685	S	S	*	*	H	α-helix	trans	-76.1	-28	177.5	-72.7	0	0	0	0	113	V97	V97-C99 VanDerWaalsContact C-N 3.35Å; V97-C99 PolarHBondContact O-N 2.71Å
100	Y	35.5	Very low	36.7	Very low	169 Å²	169	134.7 Å²	134.7	66%	0.663	68%	0.678	S	S	*	*	H	α-helix	trans	-73.3	-32	179.8	-162.3	-97.2	0	0	0	113	V97 N104	V97-Y100 PolarHBondContact O-N 3.32Å; Y100-N104 WeakPolarHBondContact CE1-ND2 3.49Å; Y100-N104 PolarHBondContact O-ND2 3.01Å
101	H	36.4	Very low	36.9	Very low	137 Å²	137	138.8 Å²	138.8	63%	0.634	68%	0.675	S	S	*	*	H	α-helix	trans	-78.3	-29	-179.6	-96.8	-65	0	0	0	114.1	H103	H101-H103 VanDerWaalsContact C-N 3.35Å
102	R	39.1	Very low	37.1	Very low	229 Å²	229	136 Å²	136	86%	0.864	67%	0.674	S	S	*	*	H	α-helix	trans	-75	-23.5	-179	-167.6	171	176.1	151.9	-1.5	113.4
103	H	41.3	Very low	37	Very low	171 Å²	171	136.1 Å²	136.1	79%	0.792	67%	0.673	S	S	*	*	H	α-helix	trans	-91.6	-12.6	-179.2	-114.1	-73	0	0	0	114.7	H101	H101-H103 VanDerWaalsContact C-N 3.35Å
104	N	36.6	Very low	36.8	Very low	109 Å²	109	139 Å²	139	58%	0.583	68%	0.678	S	S	*	*	S	Bend	trans	-108	2.8	-178.2	-78	-44.8	0	0	0	114.1	Y100 K106	Y100-N104 WeakPolarHBondContact CE1-ND2 3.49Å; Y100-N104 PolarHBondContact O-ND2 3.01Å; N104-K106 PolarHBondContact O-N 3.21Å
105	S	34.8	Very low	36.7	Very low	94 Å²	94	143.8 Å²	143.8	66%	0.657	69%	0.693	S	S	*	*			trans	-96.7	80.5	174.5	-176.1	0	0	0	0	110.7
106	K	34.6	Very low	36.5	Very low	275 Å²	275	148.1 Å²	148.1	100%	1.196	70%	0.703	S	S	*	*			trans	79.5	0	175.8	-64.4	-177.7	176.7	178.2	0	117.5	N104	N104-K106 PolarHBondContact O-N 3.21Å

Retrieved 106 of 106 residues in 144.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).