A0A3Q0KM51_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KM51, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 60 aa.

						>A0A3Q0KM51_SCHMA|A0A3Q0KM51
MNNSDNNNKENEKVKSSCAFSGQNYTGNMDRRKCIGASAAQSITIQTCDAFFQIKHHPGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.9	Very low	55.9	Low	243 Å²	243	155.5 Å²	155.5	100%	1.197	81%	0.81	S	S	*	*				0	98.5	0	-89.4	149.7	133.6	0	0	106.9
2	N	45.5	Very low	55.7	Low	166 Å²	166	157.5 Å²	157.5	89%	0.888	81%	0.812	S	S	*	*			trans	-98.8	112.1	-178.4	-73.1	2	0	0	0	108.4
3	N	57.2	Low	55.8	Low	134 Å²	134	156.8 Å²	156.8	72%	0.717	80%	0.8	S	S	*	*			trans	-112.2	90.2	168.7	-156.3	49.1	0	0	0	107.6	D5	N3-D5 PolarHBondContact ND2-OD2 2.9Å
4	S	61.4	Low	56	Low	111 Å²	111	155.1 Å²	155.1	78%	0.776	80%	0.8	S	S	*	*			trans	-101	86.6	174.2	-138.1	0	0	0	0	107.2	N6	S4-N6 PolarHBondContact O-N 3.07Å
5	D	62.8	Low	56	Low	121 Å²	121	158.3 Å²	158.3	65%	0.647	81%	0.805	S	S	*	*			trans	-68.1	113.5	176.2	-76	-49.5	0	0	0	109.9	N3 N7	N3-D5 PolarHBondContact ND2-OD2 2.9Å; D5-N7 PolarHBondContact O-N 3.25Å
6	N	58.6	Low	55.9	Low	156 Å²	156	151.6 Å²	151.6	83%	0.834	78%	0.778	S	S	*	*			trans	-65.7	97.4	177.6	-86.7	-40	0	0	0	111.3	S4 N8	S4-N6 PolarHBondContact O-N 3.07Å; N6-N8 PolarHBondContact O-N 3.41Å
7	N	57.4	Low	56.4	Low	157 Å²	157	150.2 Å²	150.2	84%	0.84	79%	0.785	S	S	*	*			trans	-74.9	58.5	167.9	-85.6	-42.4	0	0	0	112.4	D5 K9	D5-N7 PolarHBondContact O-N 3.25Å; N7-K9 PolarHBondContact O-N 2.96Å
8	N	56.7	Low	56.2	Low	128 Å²	128	146.7 Å²	146.7	68%	0.684	77%	0.773	S	S	*	*			trans	-99.2	51.7	177.5	-153.5	7.8	0	0	0	111.9	N6	N6-N8 PolarHBondContact O-N 3.41Å
9	K	57.9	Low	56.4	Low	200 Å²	200	144.6 Å²	144.6	87%	0.87	78%	0.779	S	S	*	*			trans	-93.9	8	178.7	-102.5	-177.4	173.1	175.8	0	114.3	N7	N7-K9 PolarHBondContact O-N 2.96Å
10	E	57.2	Low	56.6	Low	176 Å²	176	145 Å²	145	82%	0.822	77%	0.774	S	S	*	*	S	Bend	trans	-96.3	6.6	-171.4	-64.6	-169.6	161.1	0	0	115.5
11	N	56.3	Low	56.7	Low	119 Å²	119	141.6 Å²	141.6	64%	0.636	76%	0.761	S	S	*	*			trans	-123.9	29.3	-174.8	-72.9	-63.6	0	0	0	114.8	K13	N11-K13 PolarHBondContact O-N 3.26Å
12	E	53.4	Low	57.3	Low	179 Å²	179	133 Å²	133	84%	0.836	74%	0.736	S	S	*	*			trans	-72.3	78.3	165.2	-162.3	174.3	177.6	0	0	108.9	V14	E12-V14 VanDerWaalsContact C-N 3.31Å; E12-V14 PolarHBondContact O-N 2.85Å
13	K	57.6	Low	57.8	Low	149 Å²	149	132.1 Å²	132.1	65%	0.648	73%	0.726	S	S	*	*			trans	-61.3	96.4	170.7	-71.8	-173.1	179.2	-174.8	0	107.5	N11 K15 N24	N11-K13 PolarHBondContact O-N 3.26Å; K13-K15 PolarHBondContact O-N 2.76Å; K13-N24 PolarHBondContact NZ-OD1 3.14Å
14	V	57.5	Low	57.8	Low	133 Å²	133	131.3 Å²	131.3	81%	0.806	72%	0.722	S	S	*	*			trans	-48.5	108.1	167.5	178.1	0	0	0	0	107.2	E12 S16	E12-V14 VanDerWaalsContact C-N 3.31Å; E12-V14 PolarHBondContact O-N 2.85Å; V14-S16 PolarHBondContact O-N 2.91Å
15	K	55.9	Low	57.5	Low	202 Å²	202	137.1 Å²	137.1	88%	0.878	73%	0.728	S	S	*	*			trans	-65.2	99.4	174.9	-73.8	-178.5	179.7	177.6	0	106.9	K13 S17	K13-K15 PolarHBondContact O-N 2.76Å; K15-S17 PolarHBondContact O-N 2.82Å
16	S	55.7	Low	57.1	Low	52 Å²	52	137.1 Å²	137.1	36%	0.364	73%	0.733	S	S	.	*			trans	-59.3	130.2	172.7	144.6	0	0	0	0	109.1	V14 C18 S21	V14-S16 PolarHBondContact O-N 2.91Å; S16-C18 PolarHBondContact O-N 3.25Å; S16-C18 VanDerWaalsContact O-N 3.12Å; S16-C18 WeakPolarHBondContact OG-CB 3.25Å; S16-C18 PolarHBondContact OG-N 3.24Å; S16-C18 VanDerWaalsContact OG-N 3.14Å; S16-S21 VanDerWaalsContact CB-CB 3.43Å; S16-S21 VanDerWaalsContact CB-OG 3.25Å; S16-S21 WeakPolarHBondContact CB-OG 3.37Å; S16-S21 WeakPolarHBondContact OG-CB 2.97Å; S16-S21 PolarHBondContact OG-OG 2.75Å
17	S	63.9	Low	56.8	Low	128 Å²	128	133.5 Å²	133.5	90%	0.895	73%	0.733	S	S	*	*	S	Bend	trans	-62.5	-11.1	175.8	149.4	0	0	0	0	113.7	K15 A19	K15-S17 PolarHBondContact O-N 2.82Å; S17-A19 PolarHBondContact O-N 3.26Å
18	C	51.8	Low	56.7	Low	86 Å²	86	133.6 Å²	133.6	58%	0.581	73%	0.733	S	S	*	*	S	Bend	trans	-69.3	122.5	173.8	-63	0	0	0	0	110.4	S16 F20 S21	S16-C18 PolarHBondContact O-N 3.25Å; S16-C18 VanDerWaalsContact O-N 3.12Å; S16-C18 WeakPolarHBondContact OG-CB 3.25Å; S16-C18 PolarHBondContact OG-N 3.24Å; S16-C18 VanDerWaalsContact OG-N 3.14Å; C18-F20 PolarHBondContact O-N 2.97Å; C18-S21 PolarHBondContact O-N 3.02Å
19	A	60.7	Low	56.4	Low	107 Å²	107	135.8 Å²	135.8	88%	0.884	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.2	-19.2	179.1	0	0	0	0	0	114.1	S17	S17-A19 PolarHBondContact O-N 3.26Å
20	F	59.7	Low	56.5	Low	152 Å²	152	133.9 Å²	133.9	67%	0.667	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.7	-9.6	177.5	-86.2	-86.2	0	0	0	115.4	C18 G22	C18-F20 PolarHBondContact O-N 2.97Å; F20-G22 VanDerWaalsContact C-N 3.3Å; F20-G22 PolarHBondContact O-N 3.33Å
21	S	59	Low	56.7	Low	74 Å²	74	137.5 Å²	137.5	52%	0.517	75%	0.747	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87	3.3	-169.9	-165.1	0	0	0	0	114.5	S16 C18	S16-S21 VanDerWaalsContact CB-CB 3.43Å; S16-S21 VanDerWaalsContact CB-OG 3.25Å; S16-S21 WeakPolarHBondContact CB-OG 3.37Å; S16-S21 WeakPolarHBondContact OG-CB 2.97Å; S16-S21 PolarHBondContact OG-OG 2.75Å; C18-S21 PolarHBondContact O-N 3.02Å
22	G	56.8	Low	57.2	Low	64 Å²	64	142.5 Å²	142.5	66%	0.66	76%	0.757	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.7	3.8	-172.5	0	0	0	0	0	116.2	F20 N24	F20-G22 VanDerWaalsContact C-N 3.3Å; F20-G22 PolarHBondContact O-N 3.33Å; G22-N24 PolarHBondContact O-N 2.91Å
23	Q	56.6	Low	58	Low	146 Å²	146	143.8 Å²	143.8	68%	0.682	76%	0.759	S	S	*	*			trans	-84.9	103.7	-179.3	-71.6	-175.5	-1.9	0	0	110.7	Y25	Q23-Y25 PolarHBondContact O-N 3.35Å
24	N	56.7	Low	58.5	Low	118 Å²	118	140.6 Å²	140.6	63%	0.631	76%	0.755	S	S	*	*			trans	-57.5	120.2	168.2	-73.7	-65.9	0	0	0	109.2	K13 G22 T26	K13-N24 PolarHBondContact NZ-OD1 3.14Å; G22-N24 PolarHBondContact O-N 2.91Å; N24-T26 PolarHBondContact O-N 3.23Å
25	Y	54.8	Low	59.4	Low	233 Å²	233	141.2 Å²	141.2	91%	0.914	75%	0.753	S	S	*	*			trans	-64	95.4	176.5	-61.1	-86.1	0	0	0	110.7	Q23 G27	Q23-Y25 PolarHBondContact O-N 3.35Å; Y25-G27 PolarHBondContact O-N 3.28Å
26	T	54.7	Low	60.5	Low	120 Å²	120	134.2 Å²	134.2	74%	0.736	74%	0.737	S	S	*	*			trans	-85.1	88.9	169.9	38.5	0	0	0	0	110.5	N24 N28	N24-T26 PolarHBondContact O-N 3.23Å; T26-N28 VanDerWaalsContact C-N 3.32Å; T26-N28 PolarHBondContact O-N 3.3Å
27	G	52.7	Low	61.8	Low	81 Å²	81	136.7 Å²	136.7	84%	0.835	76%	0.761	S	S	*	*	S	Bend	trans	56.2	-31	139	0	0	0	0	0	123.7	Y25	Y25-G27 PolarHBondContact O-N 3.28Å
28	N	54.6	Low	62.7	Low	158 Å²	158	133.5 Å²	133.5	85%	0.845	74%	0.739	S	S	*	*	S	Bend	trans	-166.5	49.8	-170.6	-146.4	-13.5	0	0	0	115.7	T26	T26-N28 VanDerWaalsContact C-N 3.32Å; T26-N28 PolarHBondContact O-N 3.3Å
29	M	51.9	Low	64.1	Low	174 Å²	174	132.9 Å²	132.9	86%	0.857	74%	0.74	S	S	*	*	S	Bend	trans	-140.1	140.4	174.1	-66.3	-157.6	-168.4	0	0	111.6	R31	M29-R31 PolarHBondContact O-N 2.9Å
30	D	58.3	Low	65.1	Low	161 Å²	161	131 Å²	131	86%	0.861	73%	0.725	S	S	*	*			trans	-19.8	115.3	171.5	-104.4	-43.4	0	0	0	113.1	R32	D30-R32 VanDerWaalsContact C-N 3.31Å; D30-R32 PolarHBondContact O-N 3.36Å
31	R	61.9	Low	66.2	Low	251 Å²	251	128.7 Å²	128.7	95%	0.947	72%	0.716	S	S	*	*			trans	-60.6	94.1	176.8	-76.8	-170.2	-173.2	-169.4	3.3	108.8	M29 K33	M29-R31 PolarHBondContact O-N 2.9Å; R31-K33 PolarHBondContact O-N 2.88Å
32	R	67.9	Low	67.5	Low	225 Å²	225	127.2 Å²	127.2	85%	0.849	71%	0.706	S	S	*	*			trans	-63.9	109.2	169.7	-67.8	-173.7	-175.9	-179.1	1.9	108.1	D30 C34	D30-R32 VanDerWaalsContact C-N 3.31Å; D30-R32 PolarHBondContact O-N 3.36Å; R32-C34 PolarHBondContact O-N 3.12Å
33	K	69	Low	68.8	Low	205 Å²	205	130.5 Å²	130.5	89%	0.891	71%	0.707	S	S	*	*			trans	-77.2	107.1	171.4	-169.1	174.5	-177.1	-179.7	0	107.8	R31	R31-K33 PolarHBondContact O-N 2.88Å
34	C	68.5	Low	70.3	Confident	82 Å²	82	128 Å²	128	55%	0.554	70%	0.702	S	S	*	*	P	Polyproline II helix	trans	-76.8	140.1	169.6	-61.9	0	0	0	0	109.1	R32	R32-C34 PolarHBondContact O-N 3.12Å
35	I	76.5	Confident	71.6	Confident	147 Å²	147	126.1 Å²	126.1	75%	0.754	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-81.6	137.8	167.8	-56.2	174	0	0	0	106.8
36	G	79.2	Confident	72.9	Confident	54 Å²	54	120 Å²	120	56%	0.557	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-60.4	159.5	176.3	0	0	0	0	0	112.3	S38 Q41	G36-S38 PolarHBondContact O-N 3.22Å; G36-Q41 PolarHBondContact O-NE2 3.07Å; G36-Q41 VanDerWaalsContact O-NE2 3.07Å
37	A	82.2	Confident	74.3	Confident	105 Å²	105	118 Å²	118	87%	0.868	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-61.1	133.6	173	0	0	0	0	0	109.9
38	S	82.5	Confident	75.9	Confident	60 Å²	60	116.9 Å²	116.9	42%	0.42	64%	0.637	S	S	.	*			trans	-139.7	149.3	175.3	73.2	0	0	0	0	110.7	G36 A40 Q41	G36-S38 PolarHBondContact O-N 3.22Å; S38-A40 PolarHBondContact O-N 2.87Å; S38-Q41 WeakPolarHBondContact O-CB 3.37Å; S38-Q41 PolarHBondContact O-N 2.99Å
39	A	82.6	Confident	77.3	Confident	74 Å²	74	111.3 Å²	111.3	61%	0.612	61%	0.607	S	S	*	*	G	3₁₀ helix	trans	-60.5	-27.2	175.5	0	0	0	0	0	112.2	Q41 S42 I45	A39-Q41 PolarHBondContact O-N 3.42Å; A39-Q41 VanDerWaalsContact O-N 3.14Å; A39-S42 WeakPolarHBondContact O-CB 3.08Å; A39-S42 PolarHBondContact O-N 3.49Å; A39-I45 HydrophobicContact CB-CD1 4.27Å
40	A	80.6	Confident	78.7	Confident	68 Å²	68	106.6 Å²	106.6	56%	0.562	60%	0.595	S	S	*	*	G	3₁₀ helix	trans	-61.3	-18.7	174	0	0	0	0	0	113	S38 S42 Q46	S38-A40 PolarHBondContact O-N 2.87Å; A40-S42 VanDerWaalsContact C-N 3.26Å; A40-Q46 WeakPolarHBondContact O-CG 3.47Å; A40-Q46 PolarHBondContact O-NE2 3.23Å
41	Q	82.6	Confident	80.1	Confident	102 Å²	102	106.8 Å²	106.8	48%	0.477	59%	0.589	S	S	.	*	G	3₁₀ helix	trans	-81.2	-4.2	172.5	-63.9	169.7	14.5	0	0	112.8	G36 S38 A39 I43	G36-Q41 PolarHBondContact O-NE2 3.07Å; G36-Q41 VanDerWaalsContact O-NE2 3.07Å; S38-Q41 WeakPolarHBondContact O-CB 3.37Å; S38-Q41 PolarHBondContact O-N 2.99Å; A39-Q41 PolarHBondContact O-N 3.42Å; A39-Q41 VanDerWaalsContact O-N 3.14Å; Q41-I43 PolarHBondContact O-N 3.14Å
42	S	85.9	Confident	81.4	Confident	44 Å²	44	101.3 Å²	101.3	31%	0.308	57%	0.572	S	S	.	*			trans	-66.8	121.1	172.7	179	0	0	0	0	110.3	A39 A40 T44 I45 Q46	A39-S42 WeakPolarHBondContact O-CB 3.08Å; A39-S42 PolarHBondContact O-N 3.49Å; A40-S42 VanDerWaalsContact C-N 3.26Å; S42-T44 PolarHBondContact O-N 3.16Å; S42-T44 PolarHBondContact OG-N 3.25Å; S42-I45 PolarHBondContact O-N 3.12Å; S42-Q46 PolarHBondContact O-N 3.5Å; S42-Q46 VanDerWaalsContact O-N 3.08Å
43	I	85.5	Confident	82.1	Confident	133 Å²	133	98.7 Å²	98.7	68%	0.682	57%	0.57	S	S	*	*	H	α-helix	trans	-56.6	-42.6	175.9	-62.5	170.2	0	0	0	109.8	Q41 I45 Q46 T47	Q41-I43 PolarHBondContact O-N 3.14Å; I43-I45 PolarHBondContact O-N 3.4Å; I43-Q46 PolarHBondContact O-N 2.72Å; I43-T47 HydrophobicContact CG2-CG2 4.07Å; I43-T47 WeakPolarHBondContact O-CB 3.39Å; I43-T47 VanDerWaalsContact O-CG2 3.29Å; I43-T47 WeakPolarHBondContact O-CG2 3.34Å; I43-T47 PolarHBondContact O-N 2.93Å; I43-T47 PolarHBondContact O-OG1 2.86Å; I43-T47 VanDerWaalsContact O-OG1 3.07Å
44	T	87.4	Confident	82.5	Confident	94 Å²	94	92.9 Å²	92.9	58%	0.577	55%	0.548	S	S	*	.	H	α-helix	trans	-59	-47.3	-179.8	-51.2	0	0	0	0	111.4	S42 T47 C48	S42-T44 PolarHBondContact O-N 3.16Å; S42-T44 PolarHBondContact OG-N 3.25Å; T44-T47 WeakPolarHBondContact CA-OG1 3.41Å; T44-T47 PolarHBondContact O-N 3.48Å; T44-T47 PolarHBondContact O-OG1 2.77Å; T44-C48 PolarHBondContact O-N 3.08Å; T44-C48 PolarHBondContact O-SG 3.32Å
45	I	83.7	Confident	83	Confident	77 Å²	77	97 Å²	97	40%	0.395	56%	0.556	S	S	.	*	H	α-helix	trans	-65	-45.6	-178.7	-62.1	178.6	0	0	0	110.2	A39 S42 I43 T47 C48 D49	A39-I45 HydrophobicContact CB-CD1 4.27Å; S42-I45 PolarHBondContact O-N 3.12Å; I43-I45 PolarHBondContact O-N 3.4Å; I45-T47 VanDerWaalsContact C-N 3.32Å; I45-T47 PolarHBondContact O-N 3.26Å; I45-C48 PolarHBondContact O-N 3.22Å; I45-D49 PolarHBondContact O-N 3.33Å
46	Q	82.1	Confident	82.8	Confident	105 Å²	105	95.8 Å²	95.8	49%	0.491	55%	0.547	S	S	.	.	H	α-helix	trans	-61.4	-38.8	176	-69.6	179.8	40.5	0	0	112.6	A40 S42 I43 D49 A50	A40-Q46 WeakPolarHBondContact O-CG 3.47Å; A40-Q46 PolarHBondContact O-NE2 3.23Å; S42-Q46 PolarHBondContact O-N 3.5Å; S42-Q46 VanDerWaalsContact O-N 3.08Å; I43-Q46 PolarHBondContact O-N 2.72Å; Q46-D49 PolarHBondContact O-N 3.19Å; Q46-A50 WeakPolarHBondContact O-CB 3.29Å; Q46-A50 PolarHBondContact O-N 2.88Å
47	T	85.3	Confident	82.7	Confident	79 Å²	79	101.3 Å²	101.3	49%	0.485	56%	0.558	S	S	.	*	H	α-helix	trans	-68.2	-37.7	176.8	54.1	0	0	0	0	112.2	I43 T44 I45 A50 F51	I43-T47 HydrophobicContact CG2-CG2 4.07Å; I43-T47 WeakPolarHBondContact O-CB 3.39Å; I43-T47 VanDerWaalsContact O-CG2 3.29Å; I43-T47 WeakPolarHBondContact O-CG2 3.34Å; I43-T47 PolarHBondContact O-N 2.93Å; I43-T47 PolarHBondContact O-OG1 2.86Å; I43-T47 VanDerWaalsContact O-OG1 3.07Å; T44-T47 WeakPolarHBondContact CA-OG1 3.41Å; T44-T47 PolarHBondContact O-N 3.48Å; T44-T47 PolarHBondContact O-OG1 2.77Å; I45-T47 VanDerWaalsContact C-N 3.32Å; I45-T47 PolarHBondContact O-N 3.26Å; T47-A50 PolarHBondContact O-N 3.39Å; T47-F51 VanDerWaalsContact O-CB 3.27Å; T47-F51 WeakPolarHBondContact O-CB 3.16Å; T47-F51 PolarHBondContact O-N 2.96Å
48	C	85.4	Confident	82.1	Confident	57 Å²	57	101.2 Å²	101.2	39%	0.385	55%	0.549	S	S	.	.	H	α-helix	trans	-64	-45.5	173.6	-67.6	0	0	0	0	111	T44 I45 A50 F51 F52	T44-C48 PolarHBondContact O-N 3.08Å; T44-C48 PolarHBondContact O-SG 3.32Å; I45-C48 PolarHBondContact O-N 3.22Å; C48-A50 VanDerWaalsContact C-N 3.3Å; C48-A50 PolarHBondContact O-N 3.41Å; C48-F51 PolarHBondContact O-N 3.22Å; C48-F52 WeakPolarHBondContact O-CD2 3.27Å; C48-F52 PolarHBondContact O-N 3.42Å
49	D	83.4	Confident	81.7	Confident	41 Å²	41	101.7 Å²	101.7	22%	0.219	56%	0.562	C	S	.	*	H	α-helix	trans	-57.6	-44.5	176	-72.2	-30.5	0	0	0	111.3	I45 Q46 Q53 I54 H56	I45-D49 PolarHBondContact O-N 3.33Å; Q46-D49 PolarHBondContact O-N 3.19Å; D49-Q53 PolarHBondContact O-N 3.18Å; D49-I54 PolarHBondContact O-N 3.33Å; D49-H56 IonicContact OD1-CD2 3.78Å; D49-H56 IonicContact OD1-CE1 3.86Å; D49-H56 IonicContact OD1-NE2 2.86Å; D49-H56 PolarHBondContact OD1-NE2 3.45Å; D49-H56 IonicContact OD2-CD2 3.48Å; D49-H56 PolarHBondContact OD2-CD2 3.06Å; D49-H56 IonicContact OD2-NE2 3.16Å; D49-H56 PolarHBondContact OD2-NE2 3.29Å; D49-H56 VanDerWaalsContact OD2-NE2 3.16Å
50	A	83	Confident	80.1	Confident	74 Å²	74	111.8 Å²	111.8	61%	0.612	59%	0.593	S	S	*	*	H	α-helix	trans	-67	-43.1	178	0	0	0	0	0	112.8	Q46 T47 C48 F52 Q53	Q46-A50 WeakPolarHBondContact O-CB 3.29Å; Q46-A50 PolarHBondContact O-N 2.88Å; T47-A50 PolarHBondContact O-N 3.39Å; C48-A50 VanDerWaalsContact C-N 3.3Å; C48-A50 PolarHBondContact O-N 3.41Å; A50-F52 VanDerWaalsContact C-N 3.34Å; A50-F52 PolarHBondContact O-N 2.93Å; A50-Q53 PolarHBondContact O-N 3.38Å; A50-Q53 VanDerWaalsContact O-N 3.14Å
51	F	87.5	Confident	80.1	Confident	165 Å²	165	114 Å²	114	72%	0.724	59%	0.594	S	S	*	*	H	α-helix	trans	-62.2	-41.4	-179.5	-174.5	-97.8	0	0	0	112	T47 C48 Q53	T47-F51 VanDerWaalsContact O-CB 3.27Å; T47-F51 WeakPolarHBondContact O-CB 3.16Å; T47-F51 PolarHBondContact O-N 2.96Å; C48-F51 PolarHBondContact O-N 3.22Å; F51-Q53 VanDerWaalsContact C-N 3.27Å; F51-Q53 PolarHBondContact O-N 2.83Å
52	F	89.5	Confident	79.9	Confident	136 Å²	136	114.6 Å²	114.6	60%	0.596	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.7	5.2	177.8	-65.1	-60.8	0	0	0	113.8	C48 A50 I54	C48-F52 WeakPolarHBondContact O-CD2 3.27Å; C48-F52 PolarHBondContact O-N 3.42Å; A50-F52 VanDerWaalsContact C-N 3.34Å; A50-F52 PolarHBondContact O-N 2.93Å; F52-I54 HydrophobicContact CB-CD1 3.77Å; F52-I54 HydrophobicContact CB-CG1 3.74Å; F52-I54 PolarHBondContact O-N 3.21Å
53	Q	82	Confident	79.6	Confident	170 Å²	170	118.6 Å²	118.6	79%	0.794	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	53.5	31.2	-175.7	-58.3	-179.8	51.4	0	0	113.3	D49 A50 F51 K55	D49-Q53 PolarHBondContact O-N 3.18Å; A50-Q53 PolarHBondContact O-N 3.38Å; A50-Q53 VanDerWaalsContact O-N 3.14Å; F51-Q53 VanDerWaalsContact C-N 3.27Å; F51-Q53 PolarHBondContact O-N 2.83Å; Q53-K55 PolarHBondContact O-N 3.07Å
54	I	77.3	Confident	79.2	Confident	84 Å²	84	117.7 Å²	117.7	43%	0.431	61%	0.613	S	S	.	*			trans	-75.3	109.8	179.2	-61.4	172	0	0	0	108.1	D49 F52 H56	D49-I54 PolarHBondContact O-N 3.33Å; F52-I54 HydrophobicContact CB-CD1 3.77Å; F52-I54 HydrophobicContact CB-CG1 3.74Å; F52-I54 PolarHBondContact O-N 3.21Å; I54-H56 PolarHBondContact O-N 3.14Å
55	K	78	Confident	78.7	Confident	169 Å²	169	119.2 Å²	119.2	74%	0.735	62%	0.615	S	S	*	*			trans	-91.5	100.2	172.7	-65.7	-175.9	-178.1	-180	0	109.3	Q53 H57	Q53-K55 PolarHBondContact O-N 3.07Å; K55-H57 PolarHBondContact O-N 3.45Å
56	H	73	Confident	78.4	Confident	120 Å²	120	122 Å²	122	56%	0.556	63%	0.63	S	S	*	*	S	Bend	trans	-66.4	-16.3	171.2	-68.4	-75.9	0	0	0	113	D49 I54	D49-H56 IonicContact OD1-CD2 3.78Å; D49-H56 IonicContact OD1-CE1 3.86Å; D49-H56 IonicContact OD1-NE2 2.86Å; D49-H56 PolarHBondContact OD1-NE2 3.45Å; D49-H56 IonicContact OD2-CD2 3.48Å; D49-H56 PolarHBondContact OD2-CD2 3.06Å; D49-H56 IonicContact OD2-NE2 3.16Å; D49-H56 PolarHBondContact OD2-NE2 3.29Å; D49-H56 VanDerWaalsContact OD2-NE2 3.16Å; I54-H56 PolarHBondContact O-N 3.14Å
57	H	76.8	Confident	78.1	Confident	171 Å²	171	123.2 Å²	123.2	79%	0.792	64%	0.64	S	S	*	*	S	Bend	trans	-127.9	84.9	170.8	-54	90.6	0	0	0	107.9	K55 G59	K55-H57 PolarHBondContact O-N 3.45Å; H57-G59 PolarHBondContact O-N 2.86Å; H57-G59 VanDerWaalsContact O-N 3.12Å
58	P	70.6	Confident	77.6	Confident	103 Å²	103	126.6 Å²	126.6	67%	0.669	65%	0.652	S	S	*	*			trans	-61.3	119.3	167.7	26.7	-30.9	0	0	0	106.7
59	G	72.9	Confident	76.9	Confident	69 Å²	69	132.4 Å²	132.4	71%	0.711	67%	0.674	S	S	*	*			trans	-52	147.5	171.9	0	0	0	0	0	110	H57	H57-G59 PolarHBondContact O-N 2.86Å; H57-G59 VanDerWaalsContact O-N 3.12Å
60	K	49.3	Very low	76.4	Confident	287 Å²	287	140.7 Å²	140.7	100%	1.248	72%	0.715	S	S	*	*			trans	-54.4	0	166	-70.2	-176.9	179.1	176.2	0	110.7

Retrieved 60 of 60 residues in 32.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).