A0A3Q0KMI8_SCHMA Loading...

Splicing factor 3B subunit 5

AlphaFold DB , UniProt , Accession A0A3Q0KMI8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>A0A3Q0KMI8_SCHMA|A0A3Q0KMI8
MGDRYNIHTQLEHLQSKYVGTGHADTTKWEWLTNQHRDSCASYLGHFDMLNLFAICENECKARVRFNLLEKMLQPCGPPPERPES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.8	Low	79.3	Confident	181 Å²	181	114.9 Å²	114.9	89%	0.892	58%	0.575	S	S	*	*				0	-31.3	0	-76.9	-174.6	-179.7	0	0	112.5	D3 Y5	M1-D3 PolarHBondContact O-N 3.37Å; M1-Y5 VanDerWaalsContact O-CD2 3.32Å; M1-Y5 WeakPolarHBondContact O-CD2 3.43Å
2	G	76.1	Confident	80.1	Confident	55 Å²	55	115.8 Å²	115.8	57%	0.567	58%	0.575	S	S	*	*	H	α-helix	trans	-60.3	-37.1	176.8	0	0	0	0	0	115.3	R4 Y5 N6	G2-R4 PolarHBondContact O-N 3.25Å; G2-Y5 PolarHBondContact O-N 3.16Å; G2-N6 PolarHBondContact O-N 3.25Å; G2-N6 VanDerWaalsContact O-N 3.1Å
3	D	74.6	Confident	81	Confident	127 Å²	127	116 Å²	116	68%	0.679	57%	0.573	S	S	*	*	H	α-helix	trans	-64.3	-37.5	-176.4	-55	-41.5	0	0	0	113.4	M1 N6 I7	M1-D3 PolarHBondContact O-N 3.37Å; D3-N6 WeakPolarHBondContact O-CB 3.25Å; D3-N6 PolarHBondContact O-N 2.91Å; D3-I7 VanDerWaalsContact O-CG1 3.3Å; D3-I7 WeakPolarHBondContact O-CG1 3.47Å; D3-I7 PolarHBondContact O-N 3.4Å
4	R	72.4	Confident	81.9	Confident	173 Å²	173	113.2 Å²	113.2	65%	0.653	56%	0.561	S	S	*	*	H	α-helix	trans	-65	-44	178	-82.7	-168.2	-88.6	163.3	-6.9	111.9	G2 N6 I7 H8	G2-R4 PolarHBondContact O-N 3.25Å; R4-N6 VanDerWaalsContact C-N 3.29Å; R4-N6 PolarHBondContact O-N 3.36Å; R4-I7 PolarHBondContact O-N 3.1Å; R4-H8 PolarHBondContact O-CD2 3Å; R4-H8 PolarHBondContact O-N 3.05Å; R4-H8 VanDerWaalsContact O-N 3.12Å
5	Y	74.8	Confident	82.6	Confident	174 Å²	174	110 Å²	110	68%	0.682	54%	0.544	S	S	*	.	H	α-helix	trans	-62	-39.5	175.4	-73	-72.6	0	0	0	111.7	M1 G2 I7 H8 T9	M1-Y5 VanDerWaalsContact O-CD2 3.32Å; M1-Y5 WeakPolarHBondContact O-CD2 3.43Å; G2-Y5 PolarHBondContact O-N 3.16Å; Y5-I7 PolarHBondContact O-N 3.49Å; Y5-H8 PolarHBondContact O-N 2.87Å; Y5-T9 PolarHBondContact O-N 3.47Å; Y5-T9 VanDerWaalsContact O-N 3.08Å; Y5-T9 PolarHBondContact O-OG1 3.12Å
6	N	83	Confident	83.2	Confident	86 Å²	86	108.8 Å²	108.8	46%	0.46	55%	0.549	S	S	.	.	H	α-helix	trans	-62	-43.7	176.7	-165.6	-8.6	0	0	0	111.7	G2 D3 R4 H8 T9 Q10	G2-N6 PolarHBondContact O-N 3.25Å; G2-N6 VanDerWaalsContact O-N 3.1Å; D3-N6 WeakPolarHBondContact O-CB 3.25Å; D3-N6 PolarHBondContact O-N 2.91Å; R4-N6 VanDerWaalsContact C-N 3.29Å; R4-N6 PolarHBondContact O-N 3.36Å; N6-H8 PolarHBondContact O-N 3.5Å; N6-T9 PolarHBondContact O-N 3.29Å; N6-Q10 WeakPolarHBondContact O-CB 3.39Å; N6-Q10 VanDerWaalsContact O-CG 3.25Å; N6-Q10 WeakPolarHBondContact O-CG 3.43Å; N6-Q10 PolarHBondContact O-N 2.87Å; N6-Q10 PolarHBondContact OD1-NE2 3.3Å
7	I	81.1	Confident	83.9	Confident	104 Å²	104	110 Å²	110	53%	0.533	55%	0.55	S	S	.	*	H	α-helix	trans	-60.8	-44.7	176.9	-66.8	163.3	0	0	0	111.3	D3 R4 Y5 Q10 L11	D3-I7 VanDerWaalsContact O-CG1 3.3Å; D3-I7 WeakPolarHBondContact O-CG1 3.47Å; D3-I7 PolarHBondContact O-N 3.4Å; R4-I7 PolarHBondContact O-N 3.1Å; Y5-I7 PolarHBondContact O-N 3.49Å; I7-Q10 PolarHBondContact O-N 2.94Å; I7-L11 WeakPolarHBondContact O-CB 3.44Å; I7-L11 PolarHBondContact O-N 3.3Å
8	H	82.5	Confident	84.6	Confident	113 Å²	113	110.8 Å²	110.8	52%	0.523	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-46.1	179.1	-72.1	-63.3	0	0	0	112.1	R4 Y5 N6 Q10 L11 E12	R4-H8 PolarHBondContact O-CD2 3Å; R4-H8 PolarHBondContact O-N 3.05Å; R4-H8 VanDerWaalsContact O-N 3.12Å; Y5-H8 PolarHBondContact O-N 2.87Å; N6-H8 PolarHBondContact O-N 3.5Å; H8-Q10 VanDerWaalsContact C-N 3.35Å; H8-Q10 PolarHBondContact O-N 3.31Å; H8-L11 PolarHBondContact O-N 3Å; H8-E12 WeakPolarHBondContact O-CG 2.98Å; H8-E12 PolarHBondContact O-N 3.37Å
9	T	87	Confident	85.1	Confident	87 Å²	87	112 Å²	112	53%	0.534	56%	0.561	S	S	.	*	H	α-helix	trans	-64.1	-38.4	177.4	-56.2	0	0	0	0	112.4	Y5 N6 L11 H13	Y5-T9 PolarHBondContact O-N 3.47Å; Y5-T9 VanDerWaalsContact O-N 3.08Å; Y5-T9 PolarHBondContact O-OG1 3.12Å; N6-T9 PolarHBondContact O-N 3.29Å; T9-L11 VanDerWaalsContact C-N 3.35Å; T9-H13 WeakPolarHBondContact O-CB 3.38Å; T9-H13 PolarHBondContact O-N 3.2Å
10	Q	87.8	Confident	85.6	Confident	109 Å²	109	107.8 Å²	107.8	51%	0.509	55%	0.547	S	S	.	.	H	α-helix	trans	-64.1	-40.4	174.9	-73.7	176.8	11.8	0	0	111.9	N6 I7 H8 H13 L14	N6-Q10 WeakPolarHBondContact O-CB 3.39Å; N6-Q10 VanDerWaalsContact O-CG 3.25Å; N6-Q10 WeakPolarHBondContact O-CG 3.43Å; N6-Q10 PolarHBondContact O-N 2.87Å; N6-Q10 PolarHBondContact OD1-NE2 3.3Å; I7-Q10 PolarHBondContact O-N 2.94Å; H8-Q10 VanDerWaalsContact C-N 3.35Å; H8-Q10 PolarHBondContact O-N 3.31Å; Q10-H13 WeakPolarHBondContact O-CB 3.47Å; Q10-H13 PolarHBondContact O-N 3.1Å; Q10-L14 WeakPolarHBondContact O-CG 3.49Å; Q10-L14 PolarHBondContact O-N 2.89Å
11	L	89.6	Confident	86.1	Confident	55 Å²	55	104.8 Å²	104.8	29%	0.288	53%	0.534	S	S	.	.	H	α-helix	trans	-66.1	-46.4	177.4	-172.6	71.4	0	0	0	111.6	I7 H8 T9 H13 L14 Q15 H23	I7-L11 WeakPolarHBondContact O-CB 3.44Å; I7-L11 PolarHBondContact O-N 3.3Å; H8-L11 PolarHBondContact O-N 3Å; T9-L11 VanDerWaalsContact C-N 3.35Å; L11-H13 VanDerWaalsContact C-N 3.26Å; L11-H13 PolarHBondContact O-N 2.68Å; L11-L14 PolarHBondContact O-N 2.97Å; L11-L14 VanDerWaalsContact O-N 3.12Å; L11-Q15 WeakPolarHBondContact O-CG 3.37Å; L11-Q15 PolarHBondContact O-N 3.29Å; L11-H23 HydrophobicContact CD2-CB 3.99Å
12	E	89.7	Confident	87.6	Confident	125 Å²	125	97.6 Å²	97.6	58%	0.584	51%	0.506	S	S	*	.	H	α-helix	trans	-59	-40.1	175	-72.8	176.2	174.2	0	0	111.3	H8 L14 Q15 S16	H8-E12 WeakPolarHBondContact O-CG 2.98Å; H8-E12 PolarHBondContact O-N 3.37Å; E12-L14 PolarHBondContact O-N 3.2Å; E12-Q15 PolarHBondContact O-N 2.91Å; E12-S16 PolarHBondContact O-N 3.43Å
13	H	91.5	Very high	88.4	Confident	119 Å²	119	98.6 Å²	98.6	55%	0.551	50%	0.496	S	S	*	.	H	α-helix	trans	-59.7	-46.6	174.2	-177.9	68	0	0	0	111.7	T9 Q10 L11 S16 K17	T9-H13 WeakPolarHBondContact O-CB 3.38Å; T9-H13 PolarHBondContact O-N 3.2Å; Q10-H13 WeakPolarHBondContact O-CB 3.47Å; Q10-H13 PolarHBondContact O-N 3.1Å; L11-H13 VanDerWaalsContact C-N 3.26Å; L11-H13 PolarHBondContact O-N 2.68Å; H13-S16 PolarHBondContact O-N 2.91Å; H13-S16 PolarHBondContact O-OG 3.39Å; H13-K17 PolarHBondContact O-N 3.43Å
14	L	93.5	Very high	89.2	Confident	77 Å²	77	97.5 Å²	97.5	40%	0.403	51%	0.505	S	S	.	.	H	α-helix	trans	-62.7	-44.3	176.7	-71.1	172.6	0	0	0	112.2	Q10 L11 E12 S16 K17 Y18 T21	Q10-L14 WeakPolarHBondContact O-CG 3.49Å; Q10-L14 PolarHBondContact O-N 2.89Å; L11-L14 PolarHBondContact O-N 2.97Å; L11-L14 VanDerWaalsContact O-N 3.12Å; E12-L14 PolarHBondContact O-N 3.2Å; L14-S16 VanDerWaalsContact C-N 3.3Å; L14-S16 PolarHBondContact O-N 2.99Å; L14-K17 PolarHBondContact O-N 3.43Å; L14-Y18 HydrophobicContact CD2-CD2 4.25Å; L14-Y18 HydrophobicContact CD2-CE2 4.26Å; L14-Y18 PolarHBondContact O-N 2.97Å; L14-T21 HydrophobicContact CB-CG2 4.16Å
15	Q	92.5	Very high	90.2	Very high	65 Å²	65	95.6 Å²	95.6	30%	0.304	51%	0.507	S	S	.	.	H	α-helix	trans	-62.5	-35.9	178.3	-72.6	176	-27.8	0	0	112.6	L11 E12 T21 H23	L11-Q15 WeakPolarHBondContact O-CG 3.37Å; L11-Q15 PolarHBondContact O-N 3.29Å; E12-Q15 PolarHBondContact O-N 2.91Å; Q15-T21 HydrophobicContact CG-CG2 4.06Å; Q15-T21 PolarHBondContact NE2-O 2.98Å; Q15-H23 PolarHBondContact NE2-CD2 3.3Å
16	S	91.7	Very high	91.1	Very high	90 Å²	90	88.9 Å²	88.9	63%	0.629	49%	0.485	S	S	*	.	H	α-helix	trans	-69.1	-33.4	175.5	74.8	0	0	0	0	113.2	E12 H13 L14	E12-S16 PolarHBondContact O-N 3.43Å; H13-S16 PolarHBondContact O-N 2.91Å; H13-S16 PolarHBondContact O-OG 3.39Å; L14-S16 VanDerWaalsContact C-N 3.3Å; L14-S16 PolarHBondContact O-N 2.99Å
17	K	95.8	Very high	91.6	Very high	130 Å²	130	87.8 Å²	87.8	57%	0.565	48%	0.481	S	S	*	.	H	α-helix	trans	-85.7	-38.4	-177.2	-172.6	175	179.6	-176.3	0	112.6	H13 L14	H13-K17 PolarHBondContact O-N 3.43Å; L14-K17 PolarHBondContact O-N 3.43Å
18	Y	96.2	Very high	92.3	Very high	125 Å²	125	90.9 Å²	90.9	49%	0.49	49%	0.491	S	S	.	.	S	Bend	trans	-125.2	92.5	-174.4	-55.1	-66.8	0	0	0	109.2	L14 G20 T21	L14-Y18 HydrophobicContact CD2-CD2 4.25Å; L14-Y18 HydrophobicContact CD2-CE2 4.26Å; L14-Y18 PolarHBondContact O-N 2.97Å; Y18-G20 PolarHBondContact O-N 3.25Å; Y18-T21 WeakPolarHBondContact CB-OG1 3.36Å; Y18-T21 WeakPolarHBondContact O-CB 3.47Å; Y18-T21 PolarHBondContact O-N 3.13Å; Y18-T21 VanDerWaalsContact O-N 3.11Å; Y18-T21 PolarHBondContact O-OG1 3.18Å
19	V	94.9	Very high	93	Very high	133 Å²	133	88.4 Å²	88.4	81%	0.806	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.6	130.8	172.8	-179.8	0	0	0	0	108.5
20	G	94.9	Very high	93.4	Very high	28 Å²	28	87.7 Å²	87.7	29%	0.289	47%	0.467	S	S	.	.	T	Hydrogen-bonded Turn	trans	101.9	-8.1	-174.8	0	0	0	0	0	114.8	Y18 G22	Y18-G20 PolarHBondContact O-N 3.25Å; G20-G22 PolarHBondContact O-N 3.32Å; G20-G22 VanDerWaalsContact O-N 3.08Å
21	T	96.1	Very high	93.8	Very high	45 Å²	45	89.8 Å²	89.8	28%	0.276	47%	0.471	S	S	.	.			trans	-61.8	111.1	173.4	-56.8	0	0	0	0	110.9	L14 Q15 Y18	L14-T21 HydrophobicContact CB-CG2 4.16Å; Q15-T21 HydrophobicContact CG-CG2 4.06Å; Q15-T21 PolarHBondContact NE2-O 2.98Å; Y18-T21 WeakPolarHBondContact CB-OG1 3.36Å; Y18-T21 WeakPolarHBondContact O-CB 3.47Å; Y18-T21 PolarHBondContact O-N 3.13Å; Y18-T21 VanDerWaalsContact O-N 3.11Å; Y18-T21 PolarHBondContact O-OG1 3.18Å
22	G	93.1	Very high	94.2	Very high	29 Å²	29	89.7 Å²	89.7	30%	0.299	47%	0.47	S	S	.	.			trans	-78.8	173.3	178.5	0	0	0	0	0	114.4	G20 T26	G20-G22 PolarHBondContact O-N 3.32Å; G20-G22 VanDerWaalsContact O-N 3.08Å; G22-T26 WeakPolarHBondContact CA-OG1 3.46Å
23	H	93.2	Very high	94.6	Very high	76 Å²	76	83.8 Å²	83.8	35%	0.352	44%	0.443	S	S	.	.			trans	-140.8	175.5	173	58.4	95.3	0	0	0	109.8	L11 Q15 D25 T26	L11-H23 HydrophobicContact CD2-CB 3.99Å; Q15-H23 PolarHBondContact NE2-CD2 3.3Å; H23-D25 VanDerWaalsContact CE1-C 3.49Å; H23-D25 PolarHBondContact ND1-N 3.08Å; H23-D25 IonicContact ND1-OD2 3.87Å; H23-D25 PolarHBondContact O-N 3.44Å; H23-D25 VanDerWaalsContact O-N 3.15Å; H23-T26 PolarHBondContact CD2-OG1 3.18Å; H23-T26 VanDerWaalsContact CD2-OG1 3.23Å; H23-T26 PolarHBondContact N-OG1 2.94Å; H23-T26 PolarHBondContact NE2-OG1 3.33Å; H23-T26 WeakPolarHBondContact O-CB 3.48Å; H23-T26 PolarHBondContact O-N 3.43Å; H23-T26 PolarHBondContact O-OG1 3.36Å; H23-T26 VanDerWaalsContact O-OG1 3.12Å
24	A	92.5	Very high	94.9	Very high	105 Å²	105	79.9 Å²	79.9	87%	0.868	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-30.1	-175.6	0	0	0	0	0	113.8
25	D	92.4	Very high	95.1	Very high	133 Å²	133	80.7 Å²	80.7	71%	0.711	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.6	10.6	-179.3	-44.1	-62.7	0	0	0	113.4	H23 T27	H23-D25 VanDerWaalsContact CE1-C 3.49Å; H23-D25 PolarHBondContact ND1-N 3.08Å; H23-D25 IonicContact ND1-OD2 3.87Å; H23-D25 PolarHBondContact O-N 3.44Å; H23-D25 VanDerWaalsContact O-N 3.15Å; D25-T27 PolarHBondContact O-N 3.45Å; D25-T27 VanDerWaalsContact O-N 3.16Å
26	T	93.8	Very high	95.3	Very high	33 Å²	33	81.2 Å²	81.2	20%	0.202	43%	0.43	C	S	.	.			trans	-61.7	120	176.2	-64.6	0	0	0	0	109.9	G22 H23 E30 W31	G22-T26 WeakPolarHBondContact CA-OG1 3.46Å; H23-T26 PolarHBondContact CD2-OG1 3.18Å; H23-T26 VanDerWaalsContact CD2-OG1 3.23Å; H23-T26 PolarHBondContact N-OG1 2.94Å; H23-T26 PolarHBondContact NE2-OG1 3.33Å; H23-T26 WeakPolarHBondContact O-CB 3.48Å; H23-T26 PolarHBondContact O-N 3.43Å; H23-T26 PolarHBondContact O-OG1 3.36Å; H23-T26 VanDerWaalsContact O-OG1 3.12Å; T26-E30 HydrophobicContact CG2-CB 3.78Å; T26-W31 HydrophobicContact CG2-CB 4.28Å
27	T	94.9	Very high	95.6	Very high	62 Å²	62	81 Å²	81	38%	0.38	42%	0.415	S	S	.	.			trans	-68.8	156.8	-179.5	65.2	0	0	0	0	111.1	D25 W29 E30 W31	D25-T27 PolarHBondContact O-N 3.45Å; D25-T27 VanDerWaalsContact O-N 3.16Å; T27-W29 PolarHBondContact O-N 3.18Å; T27-E30 WeakPolarHBondContact CB-OE2 3.29Å; T27-E30 WeakPolarHBondContact CG2-OE2 3.45Å; T27-E30 PolarHBondContact N-OE2 2.72Å; T27-E30 PolarHBondContact O-N 3.01Å; T27-E30 VanDerWaalsContact OG1-CD 3.3Å; T27-E30 VanDerWaalsContact OG1-CG 3.25Å; T27-E30 WeakPolarHBondContact OG1-CG 3.43Å; T27-E30 PolarHBondContact OG1-N 3.39Å; T27-E30 PolarHBondContact OG1-OE2 2.8Å; T27-W31 PolarHBondContact O-N 3.47Å
28	K	95.3	Very high	95.8	Very high	170 Å²	170	79.3 Å²	79.3	74%	0.739	41%	0.412	S	S	*	.	H	α-helix	trans	-53.2	-38.4	172.2	179.4	-179.7	175.3	-176.6	0	112	L32	K28-L32 HydrophobicContact CD-CD1 4.46Å; K28-L32 HydrophobicContact CG-CD1 3.85Å; K28-L32 HydrophobicContact CG-CG 4.36Å; K28-L32 WeakPolarHBondContact O-CB 3.31Å; K28-L32 VanDerWaalsContact O-CG 3.28Å; K28-L32 WeakPolarHBondContact O-CG 3.2Å; K28-L32 PolarHBondContact O-N 3.49Å
29	W	96.3	Very high	95.8	Very high	61 Å²	61	75.1 Å²	75.1	23%	0.231	40%	0.401	C	S	.	.	H	α-helix	trans	-67.3	-43.9	-179.7	178.7	91.3	0	0	0	111.9	T27 T33 G77 P78 P79 P80	T27-W29 PolarHBondContact O-N 3.18Å; W29-T33 VanDerWaalsContact O-CB 3.24Å; W29-T33 WeakPolarHBondContact O-CB 3.17Å; W29-T33 PolarHBondContact O-N 3.5Å; W29-T33 PolarHBondContact O-OG1 2.89Å; W29-G77 PolarHBondContact NE1-O 3.44Å; W29-P78 PolarHBondContact NE1-O 3.3Å; W29-P79 HydrophobicContact CD2-CB 3.84Å; W29-P79 VanDerWaalsContact CE2-CA 3.46Å; W29-P79 HydrophobicContact CE3-CB 3.91Å; W29-P79 HydrophobicContact CH2-CB 3.94Å; W29-P79 HydrophobicContact CH2-CG 4.34Å; W29-P79 HydrophobicContact CZ2-CB 3.83Å; W29-P79 HydrophobicContact CZ2-CG 4.25Å; W29-P79 HydrophobicContact CZ3-CB 3.98Å; W29-P80 HydrophobicContact CB-CG 4.17Å
30	E	95.9	Very high	96	Very high	71 Å²	71	69.4 Å²	69.4	33%	0.332	37%	0.367	S	S	.	.	H	α-helix	trans	-63	-46.9	177.3	-72.3	162.7	143.6	0	0	111.3	T26 T27 T33 N34	T26-E30 HydrophobicContact CG2-CB 3.78Å; T27-E30 WeakPolarHBondContact CB-OE2 3.29Å; T27-E30 WeakPolarHBondContact CG2-OE2 3.45Å; T27-E30 PolarHBondContact N-OE2 2.72Å; T27-E30 PolarHBondContact O-N 3.01Å; T27-E30 VanDerWaalsContact OG1-CD 3.3Å; T27-E30 VanDerWaalsContact OG1-CG 3.25Å; T27-E30 WeakPolarHBondContact OG1-CG 3.43Å; T27-E30 PolarHBondContact OG1-N 3.39Å; T27-E30 PolarHBondContact OG1-OE2 2.8Å; E30-T33 PolarHBondContact O-N 3.42Å; E30-N34 PolarHBondContact O-N 3.47Å; E30-N34 PolarHBondContact O-ND2 3.34Å
31	W	96.4	Very high	96.1	Very high	154 Å²	154	70.4 Å²	70.4	58%	0.583	37%	0.372	S	S	*	.	H	α-helix	trans	-58.5	-51.4	178.1	-179.4	-95.8	0	0	0	112	T26 T27 T33 N34 Q35	T26-W31 HydrophobicContact CG2-CB 4.28Å; T27-W31 PolarHBondContact O-N 3.47Å; W31-T33 VanDerWaalsContact C-N 3.35Å; W31-T33 PolarHBondContact O-N 3.26Å; W31-N34 PolarHBondContact O-N 2.95Å; W31-Q35 PolarHBondContact O-N 2.95Å
32	L	97.7	Very high	96.2	Very high	52 Å²	52	71 Å²	71	27%	0.272	38%	0.379	S	S	.	.	H	α-helix	trans	-63.7	-41.7	179.4	-71.5	175.3	0	0	0	111.3	K28 N34 Q35 H36	K28-L32 HydrophobicContact CD-CD1 4.46Å; K28-L32 HydrophobicContact CG-CD1 3.85Å; K28-L32 HydrophobicContact CG-CG 4.36Å; K28-L32 WeakPolarHBondContact O-CB 3.31Å; K28-L32 VanDerWaalsContact O-CG 3.28Å; K28-L32 WeakPolarHBondContact O-CG 3.2Å; K28-L32 PolarHBondContact O-N 3.49Å; L32-N34 VanDerWaalsContact C-N 3.33Å; L32-N34 PolarHBondContact O-N 2.99Å; L32-Q35 PolarHBondContact O-N 3.45Å; L32-H36 PolarHBondContact O-N 3.3Å; L32-H36 PolarHBondContact O-ND1 3.14Å
33	T	97.4	Very high	96.4	Very high	2 Å²	2	73.3 Å²	73.3	1%	0.012	38%	0.379	C	S	.	.	H	α-helix	trans	-60.3	-43.7	179.1	-63.6	0	0	0	0	111.3	W29 E30 W31 H36 R37 P75	W29-T33 VanDerWaalsContact O-CB 3.24Å; W29-T33 WeakPolarHBondContact O-CB 3.17Å; W29-T33 PolarHBondContact O-N 3.5Å; W29-T33 PolarHBondContact O-OG1 2.89Å; E30-T33 PolarHBondContact O-N 3.42Å; W31-T33 VanDerWaalsContact C-N 3.35Å; W31-T33 PolarHBondContact O-N 3.26Å; T33-H36 PolarHBondContact O-N 3.17Å; T33-R37 WeakPolarHBondContact O-CG 3.43Å; T33-R37 PolarHBondContact O-N 3.35Å; T33-R37 VanDerWaalsContact O-N 3.08Å; T33-P75 HydrophobicContact CG2-CG 4.11Å
34	N	97.4	Very high	96.6	Very high	36 Å²	36	71.6 Å²	71.6	19%	0.193	37%	0.372	C	S	.	.	H	α-helix	trans	-63.1	-47.6	175	-70.1	-27.4	0	0	0	111.3	E30 W31 L32 H36 R37 D38	E30-N34 PolarHBondContact O-N 3.47Å; E30-N34 PolarHBondContact O-ND2 3.34Å; W31-N34 PolarHBondContact O-N 2.95Å; L32-N34 VanDerWaalsContact C-N 3.33Å; L32-N34 PolarHBondContact O-N 2.99Å; N34-H36 VanDerWaalsContact C-N 3.31Å; N34-H36 PolarHBondContact O-N 2.86Å; N34-R37 PolarHBondContact O-N 3.07Å; N34-R37 VanDerWaalsContact O-N 3.12Å; N34-D38 PolarHBondContact O-N 3.31Å
35	Q	98.1	Very high	96.8	Very high	95 Å²	95	69.5 Å²	69.5	44%	0.444	36%	0.361	S	S	.	.	H	α-helix	trans	-56.9	-42.1	177.7	-175.3	-174.2	17.2	0	0	113	W31 L32 D38 S39	W31-Q35 PolarHBondContact O-N 2.95Å; L32-Q35 PolarHBondContact O-N 3.45Å; Q35-D38 PolarHBondContact O-N 3.33Å; Q35-S39 WeakPolarHBondContact O-CB 3.01Å; Q35-S39 PolarHBondContact O-N 2.98Å; Q35-S39 PolarHBondContact O-OG 2.77Å
36	H	98.1	Very high	97.1	Very high	76 Å²	76	68.2 Å²	68.2	35%	0.352	35%	0.35	S	S	.	.	H	α-helix	trans	-69.3	-37.5	179.3	-73.8	69.7	0	0	0	111.5	L32 T33 N34 S39 C40 P75 C76	L32-H36 PolarHBondContact O-N 3.3Å; L32-H36 PolarHBondContact O-ND1 3.14Å; T33-H36 PolarHBondContact O-N 3.17Å; N34-H36 VanDerWaalsContact C-N 3.31Å; N34-H36 PolarHBondContact O-N 2.86Å; H36-S39 PolarHBondContact O-N 3.09Å; H36-C40 PolarHBondContact O-N 2.92Å; H36-C40 PolarHBondContact O-SG 2.92Å; H36-P75 HydrophobicContact CB-CB 3.54Å; H36-P75 HydrophobicContact CB-CG 3.68Å; H36-C76 PolarHBondContact ND1-SG 3.16Å
37	R	98.2	Very high	97.2	Very high	85 Å²	85	74 Å²	74	32%	0.321	37%	0.373	S	S	.	.	H	α-helix	trans	-65.4	-43.7	174.5	-73.8	173.6	176.9	160	1.9	111.4	T33 N34 S39 C40 A41 M72 L73 P75	T33-R37 WeakPolarHBondContact O-CG 3.43Å; T33-R37 PolarHBondContact O-N 3.35Å; T33-R37 VanDerWaalsContact O-N 3.08Å; N34-R37 PolarHBondContact O-N 3.07Å; N34-R37 VanDerWaalsContact O-N 3.12Å; R37-S39 VanDerWaalsContact C-N 3.33Å; R37-S39 PolarHBondContact O-N 3.32Å; R37-C40 PolarHBondContact O-N 2.9Å; R37-A41 WeakPolarHBondContact O-CB 3.43Å; R37-A41 PolarHBondContact O-N 3.04Å; R37-M72 HydrophobicContact CB-CE 4.16Å; R37-M72 HydrophobicContact CG-CE 4.45Å; R37-M72 PolarHBondContact NE-O 3.36Å; R37-L73 PolarHBondContact NH2-O 3.33Å; R37-P75 HydrophobicContact CG-CG 4.28Å
38	D	98.1	Very high	97.4	Very high	95 Å²	95	75.2 Å²	75.2	51%	0.508	38%	0.377	S	S	.	.	H	α-helix	trans	-60.6	-44.6	175.6	-68.7	-13	0	0	0	110.9	N34 Q35 C40 A41 S42	N34-D38 PolarHBondContact O-N 3.31Å; Q35-D38 PolarHBondContact O-N 3.33Å; D38-C40 PolarHBondContact O-N 3.34Å; D38-A41 PolarHBondContact O-N 3.41Å; D38-S42 PolarHBondContact O-N 3.01Å; D38-S42 PolarHBondContact O-OG 2.92Å
39	S	98	Very high	97.5	Very high	37 Å²	37	70 Å²	70	26%	0.259	36%	0.356	S	S	.	.	H	α-helix	trans	-60.2	-48.1	176.2	-57.9	0	0	0	0	111.5	Q35 H36 R37 A41 S42 Y43	Q35-S39 WeakPolarHBondContact O-CB 3.01Å; Q35-S39 PolarHBondContact O-N 2.98Å; Q35-S39 PolarHBondContact O-OG 2.77Å; H36-S39 PolarHBondContact O-N 3.09Å; R37-S39 VanDerWaalsContact C-N 3.33Å; R37-S39 PolarHBondContact O-N 3.32Å; S39-A41 VanDerWaalsContact C-N 3.33Å; S39-A41 PolarHBondContact O-N 3.15Å; S39-S42 PolarHBondContact O-N 3.16Å; S39-Y43 VanDerWaalsContact O-CD1 3.26Å; S39-Y43 WeakPolarHBondContact O-CD1 3.23Å; S39-Y43 WeakPolarHBondContact O-CD2 3.41Å; S39-Y43 PolarHBondContact O-N 3.19Å
40	C	97.8	Very high	97.6	Very high	12 Å²	12	67.1 Å²	67.1	8%	0.081	35%	0.345	C	S	.	.	H	α-helix	trans	-60.3	-42	176.4	-67.3	0	0	0	0	111.9	H36 R37 D38 Y43 L44 M72	H36-C40 PolarHBondContact O-N 2.92Å; H36-C40 PolarHBondContact O-SG 2.92Å; R37-C40 PolarHBondContact O-N 2.9Å; D38-C40 PolarHBondContact O-N 3.34Å; C40-Y43 PolarHBondContact O-N 3.47Å; C40-L44 VanDerWaalsContact O-CG 3.3Å; C40-L44 WeakPolarHBondContact O-CG 3.43Å; C40-L44 PolarHBondContact O-N 3.23Å; C40-M72 HydrophobicContact CB-CG 3.92Å; C40-M72 HydrophobicContact CB-SD 4.4Å
41	A	97.8	Very high	97.7	Very high	49 Å²	49	66 Å²	66	41%	0.405	34%	0.341	S	S	.	.	H	α-helix	trans	-63.5	-43.3	176.7	0	0	0	0	0	111.8	R37 D38 S39 L44 G45 M72	R37-A41 WeakPolarHBondContact O-CB 3.43Å; R37-A41 PolarHBondContact O-N 3.04Å; D38-A41 PolarHBondContact O-N 3.41Å; S39-A41 VanDerWaalsContact C-N 3.33Å; S39-A41 PolarHBondContact O-N 3.15Å; A41-L44 PolarHBondContact O-N 3Å; A41-G45 PolarHBondContact O-N 3.37Å; A41-M72 HydrophobicContact CB-CE 4.47Å
42	S	98	Very high	97.8	Very high	58 Å²	58	62.8 Å²	62.8	41%	0.406	34%	0.335	S	S	.	.	H	α-helix	trans	-60.1	-45.9	173.2	-65.9	0	0	0	0	111.6	D38 S39 L44 G45 H46	D38-S42 PolarHBondContact O-N 3.01Å; D38-S42 PolarHBondContact O-OG 2.92Å; S39-S42 PolarHBondContact O-N 3.16Å; S42-L44 VanDerWaalsContact C-N 3.28Å; S42-L44 PolarHBondContact O-N 3.12Å; S42-G45 PolarHBondContact O-N 3.08Å; S42-G45 VanDerWaalsContact O-N 3.14Å; S42-H46 WeakPolarHBondContact O-CB 3.42Å; S42-H46 PolarHBondContact O-CD2 3.47Å; S42-H46 PolarHBondContact O-N 3.29Å
43	Y	97.8	Very high	97.8	Very high	78 Å²	78	62.7 Å²	62.7	31%	0.306	33%	0.333	S	S	.	.	H	α-helix	trans	-61.3	-36.5	178.4	-59.3	-20.8	0	0	0	112.8	S39 C40 M49 F53 L68	S39-Y43 VanDerWaalsContact O-CD1 3.26Å; S39-Y43 WeakPolarHBondContact O-CD1 3.23Å; S39-Y43 WeakPolarHBondContact O-CD2 3.41Å; S39-Y43 PolarHBondContact O-N 3.19Å; C40-Y43 PolarHBondContact O-N 3.47Å; Y43-M49 HydrophobicContact CD1-CE 3.95Å; Y43-M49 HydrophobicContact CE1-CE 3.87Å; Y43-F53 AromaticContact CD1-CE2 3.65Å; Y43-F53 HydrophobicContact CD1-CE2 3.65Å; Y43-F53 AromaticContact CD1-CZ 3.97Å; Y43-F53 HydrophobicContact CD1-CZ 3.97Å; Y43-F53 AromaticContact CD2-CE2 3.76Å; Y43-F53 HydrophobicContact CD2-CE2 3.76Å; Y43-F53 HydrophobicContact CD2-CZ 4.15Å; Y43-F53 HydrophobicContact CE1-CE2 4.24Å; Y43-F53 HydrophobicContact CE1-CZ 4.09Å; Y43-F53 HydrophobicContact CE2-CE2 4.33Å; Y43-F53 HydrophobicContact CE2-CZ 4.26Å; Y43-F53 HydrophobicContact CG-CD2 4.39Å; Y43-F53 AromaticContact CG-CE2 3.4Å; Y43-F53 HydrophobicContact CG-CE2 3.4Å; Y43-F53 HydrophobicContact CG-CZ 4.02Å; Y43-L68 HydrophobicContact CD2-CD2 4.21Å
44	L	97.3	Very high	97.8	Very high	40 Å²	40	63 Å²	63	21%	0.209	34%	0.336	C	S	.	.	H	α-helix	trans	-72	-35.1	175.3	-72.7	168.4	0	0	0	112.6	C40 A41 S42 R65 L68 L69 M72	C40-L44 VanDerWaalsContact O-CG 3.3Å; C40-L44 WeakPolarHBondContact O-CG 3.43Å; C40-L44 PolarHBondContact O-N 3.23Å; A41-L44 PolarHBondContact O-N 3Å; S42-L44 VanDerWaalsContact C-N 3.28Å; S42-L44 PolarHBondContact O-N 3.12Å; L44-R65 HydrophobicContact CD2-CB 4.01Å; L44-R65 HydrophobicContact CD2-CG 3.78Å; L44-L68 HydrophobicContact CD1-CB 4.29Å; L44-L68 HydrophobicContact CD2-CB 3.94Å; L44-L68 HydrophobicContact CD2-CD1 3.91Å; L44-L68 HydrophobicContact CG-CB 4.09Å; L44-L68 HydrophobicContact CG-CD1 4.09Å; L44-L69 HydrophobicContact CD1-CD2 3.61Å; L44-L69 HydrophobicContact CD1-CG 3.95Å; L44-M72 HydrophobicContact CD1-SD 4.46Å
45	G	97.1	Very high	97.8	Very high	61 Å²	61	67.7 Å²	67.7	63%	0.629	36%	0.359	S	S	*	.	H	α-helix	trans	-80	-29.6	-178.3	0	0	0	0	0	114.8	A41 S42	A41-G45 PolarHBondContact O-N 3.37Å; S42-G45 PolarHBondContact O-N 3.08Å; S42-G45 VanDerWaalsContact O-N 3.14Å
46	H	98.1	Very high	97.8	Very high	105 Å²	105	67.8 Å²	67.8	49%	0.486	37%	0.369	S	S	.	.			trans	-94	109.3	-179.7	-69.2	-67	0	0	0	111.2	S42 D48 M49 L50	S42-H46 WeakPolarHBondContact O-CB 3.42Å; S42-H46 PolarHBondContact O-CD2 3.47Å; S42-H46 PolarHBondContact O-N 3.29Å; H46-D48 VanDerWaalsContact C-N 3.3Å; H46-D48 WeakPolarHBondContact CB-OD1 3.24Å; H46-D48 PolarHBondContact O-N 3.49Å; H46-M49 HydrophobicContact CB-CB 3.97Å; H46-M49 HydrophobicContact CB-CG 3.95Å; H46-M49 PolarHBondContact O-N 2.87Å; H46-L50 PolarHBondContact O-N 2.89Å
47	F	96.6	Very high	97.8	Very high	156 Å²	156	68.6 Å²	68.6	68%	0.684	37%	0.373	S	S	*	.	H	α-helix	trans	-63	-35	-172.7	67.2	-91.6	0	0	0	113.3	N51	F47-N51 WeakPolarHBondContact O-CB 3.5Å; F47-N51 PolarHBondContact O-N 3.26Å; F47-N51 PolarHBondContact O-ND2 2.82Å; F47-N51 VanDerWaalsContact O-ND2 3.1Å; F47-N51 PolarHBondContact O-OD1 2.75Å
48	D	97.9	Very high	97.8	Very high	86 Å²	86	71.6 Å²	71.6	46%	0.46	40%	0.396	S	S	.	.	H	α-helix	trans	-67.4	-44.6	177.2	57.5	-34.2	0	0	0	111.3	H46 N51 L52	H46-D48 VanDerWaalsContact C-N 3.3Å; H46-D48 WeakPolarHBondContact CB-OD1 3.24Å; H46-D48 PolarHBondContact O-N 3.49Å; D48-N51 WeakPolarHBondContact O-CB 3.41Å; D48-N51 PolarHBondContact O-N 2.95Å; D48-L52 WeakPolarHBondContact O-CB 3.26Å; D48-L52 PolarHBondContact O-N 3.18Å
49	M	97.7	Very high	97.8	Very high	60 Å²	60	71.4 Å²	71.4	30%	0.296	39%	0.392	S	S	.	.	H	α-helix	trans	-63.8	-45.2	174.2	-69.5	-65.5	-74.5	0	0	111.7	Y43 H46 N51 L52 F53	Y43-M49 HydrophobicContact CD1-CE 3.95Å; Y43-M49 HydrophobicContact CE1-CE 3.87Å; H46-M49 HydrophobicContact CB-CB 3.97Å; H46-M49 HydrophobicContact CB-CG 3.95Å; H46-M49 PolarHBondContact O-N 2.87Å; M49-N51 VanDerWaalsContact C-N 3.28Å; M49-N51 PolarHBondContact O-N 3.29Å; M49-L52 WeakPolarHBondContact O-CB 3.49Å; M49-L52 PolarHBondContact O-N 3.04Å; M49-L52 HydrophobicContact SD-CD2 4.49Å; M49-F53 HydrophobicContact CB-CE2 4.31Å; M49-F53 HydrophobicContact CE-CE2 4.18Å; M49-F53 HydrophobicContact CE-CZ 3.75Å; M49-F53 WeakPolarHBondContact O-CD2 3.45Å; M49-F53 WeakPolarHBondContact O-CG 3.3Å; M49-F53 PolarHBondContact O-N 3.32Å
50	L	97.8	Very high	97.7	Very high	2 Å²	2	73.3 Å²	73.3	1%	0.01	40%	0.404	C	S	.	.	H	α-helix	trans	-61	-39.4	175.8	-177.1	66.9	0	0	0	111.9	H46 A54 V64 R65 L68	H46-L50 PolarHBondContact O-N 2.89Å; L50-A54 WeakPolarHBondContact O-CB 3.46Å; L50-A54 PolarHBondContact O-N 3.05Å; L50-V64 HydrophobicContact CD1-CB 4.23Å; L50-V64 HydrophobicContact CD1-CG1 3.78Å; L50-R65 HydrophobicContact CD1-CG 3.88Å; L50-R65 HydrophobicContact CD2-CG 3.78Å; L50-R65 VanDerWaalsContact CD2-CZ 3.45Å; L50-R65 HydrophobicContact CG-CG 4.49Å; L50-L68 HydrophobicContact CD1-CD1 4.23Å
51	N	97.8	Very high	97.7	Very high	47 Å²	47	77.6 Å²	77.6	25%	0.251	42%	0.421	S	S	.	.	H	α-helix	trans	-65.3	-43.3	175.7	-68.5	-21.8	0	0	0	111.4	F47 D48 M49 F53 A54 I55 K61	F47-N51 WeakPolarHBondContact O-CB 3.5Å; F47-N51 PolarHBondContact O-N 3.26Å; F47-N51 PolarHBondContact O-ND2 2.82Å; F47-N51 VanDerWaalsContact O-ND2 3.1Å; F47-N51 PolarHBondContact O-OD1 2.75Å; D48-N51 WeakPolarHBondContact O-CB 3.41Å; D48-N51 PolarHBondContact O-N 2.95Å; M49-N51 VanDerWaalsContact C-N 3.28Å; M49-N51 PolarHBondContact O-N 3.29Å; N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 3.08Å; N51-A54 PolarHBondContact O-N 3.46Å; N51-I55 VanDerWaalsContact O-CG1 3.25Å; N51-I55 WeakPolarHBondContact O-CG1 3.4Å; N51-I55 PolarHBondContact O-N 3.12Å; N51-K61 WeakPolarHBondContact OD1-CD 3.36Å; N51-K61 WeakPolarHBondContact OD1-CE 3.42Å; N51-K61 PolarHBondContact OD1-NZ 3.19Å
52	L	98.2	Very high	97.7	Very high	87 Å²	87	78.5 Å²	78.5	46%	0.455	43%	0.429	S	S	.	.	H	α-helix	trans	-56.4	-49.7	176.6	179.3	65.5	0	0	0	110.5	D48 M49 A54 I55 C56	D48-L52 WeakPolarHBondContact O-CB 3.26Å; D48-L52 PolarHBondContact O-N 3.18Å; M49-L52 WeakPolarHBondContact O-CB 3.49Å; M49-L52 PolarHBondContact O-N 3.04Å; M49-L52 HydrophobicContact SD-CD2 4.49Å; L52-A54 PolarHBondContact O-N 3.23Å; L52-I55 PolarHBondContact O-N 3.16Å; L52-C56 WeakPolarHBondContact O-CB 3.24Å; L52-C56 PolarHBondContact O-N 2.86Å; L52-C56 PolarHBondContact O-SG 3.06Å
53	F	97.9	Very high	97.7	Very high	50 Å²	50	81.7 Å²	81.7	22%	0.219	43%	0.432	C	S	.	.	H	α-helix	trans	-64	-41.9	178.2	-61.1	-41.4	0	0	0	113	Y43 M49 N51 I55 C56 E57 V64	Y43-F53 AromaticContact CD1-CE2 3.65Å; Y43-F53 HydrophobicContact CD1-CE2 3.65Å; Y43-F53 AromaticContact CD1-CZ 3.97Å; Y43-F53 HydrophobicContact CD1-CZ 3.97Å; Y43-F53 AromaticContact CD2-CE2 3.76Å; Y43-F53 HydrophobicContact CD2-CE2 3.76Å; Y43-F53 HydrophobicContact CD2-CZ 4.15Å; Y43-F53 HydrophobicContact CE1-CE2 4.24Å; Y43-F53 HydrophobicContact CE1-CZ 4.09Å; Y43-F53 HydrophobicContact CE2-CE2 4.33Å; Y43-F53 HydrophobicContact CE2-CZ 4.26Å; Y43-F53 HydrophobicContact CG-CD2 4.39Å; Y43-F53 AromaticContact CG-CE2 3.4Å; Y43-F53 HydrophobicContact CG-CE2 3.4Å; Y43-F53 HydrophobicContact CG-CZ 4.02Å; M49-F53 HydrophobicContact CB-CE2 4.31Å; M49-F53 HydrophobicContact CE-CE2 4.18Å; M49-F53 HydrophobicContact CE-CZ 3.75Å; M49-F53 WeakPolarHBondContact O-CD2 3.45Å; M49-F53 WeakPolarHBondContact O-CG 3.3Å; M49-F53 PolarHBondContact O-N 3.32Å; N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 3.08Å; F53-I55 VanDerWaalsContact C-N 3.31Å; F53-I55 PolarHBondContact O-N 3.45Å; F53-C56 PolarHBondContact O-N 3.06Å; F53-E57 WeakPolarHBondContact O-CB 3.33Å; F53-E57 WeakPolarHBondContact O-CG 3.28Å; F53-E57 PolarHBondContact O-N 3.29Å; F53-V64 HydrophobicContact CB-CG1 3.97Å
54	A	98.1	Very high	97.7	Very high	9 Å²	9	78.1 Å²	78.1	7%	0.074	42%	0.418	C	S	.	.	H	α-helix	trans	-60.8	-39	175.9	0	0	0	0	0	112.9	L50 N51 L52 N58 E59 K61 V64	L50-A54 WeakPolarHBondContact O-CB 3.46Å; L50-A54 PolarHBondContact O-N 3.05Å; N51-A54 PolarHBondContact O-N 3.46Å; L52-A54 PolarHBondContact O-N 3.23Å; A54-N58 PolarHBondContact O-N 3.15Å; A54-N58 VanDerWaalsContact O-N 3.16Å; A54-E59 PolarHBondContact O-N 3.11Å; A54-E59 VanDerWaalsContact O-N 3.12Å; A54-K61 HydrophobicContact CB-CG 3.93Å; A54-V64 HydrophobicContact CB-CG2 4.13Å
55	I	98.1	Very high	97.7	Very high	133 Å²	133	81.9 Å²	81.9	68%	0.682	43%	0.43	S	S	*	.	H	α-helix	trans	-68.9	-47.7	175.6	-67.1	164.4	0	0	0	110.4	N51 L52 F53 E57 N58	N51-I55 VanDerWaalsContact O-CG1 3.25Å; N51-I55 WeakPolarHBondContact O-CG1 3.4Å; N51-I55 PolarHBondContact O-N 3.12Å; L52-I55 PolarHBondContact O-N 3.16Å; F53-I55 VanDerWaalsContact C-N 3.31Å; F53-I55 PolarHBondContact O-N 3.45Å; I55-E57 PolarHBondContact O-N 3.47Å; I55-N58 PolarHBondContact O-N 2.73Å
56	C	98	Very high	97.8	Very high	98 Å²	98	84 Å²	84	66%	0.662	42%	0.422	S	S	*	.	H	α-helix	trans	-64.6	-39	-178.2	-70.3	0	0	0	0	113.2	L52 F53 N58	L52-C56 WeakPolarHBondContact O-CB 3.24Å; L52-C56 PolarHBondContact O-N 2.86Å; L52-C56 PolarHBondContact O-SG 3.06Å; F53-C56 PolarHBondContact O-N 3.06Å; C56-N58 VanDerWaalsContact C-N 3.31Å
57	E	97.3	Very high	97.7	Very high	92 Å²	92	80.7 Å²	80.7	43%	0.43	41%	0.408	S	S	.	.	H	α-helix	trans	-83	-8	178.4	-65.7	-173.5	178.3	0	0	112.8	F53 I55 E59	F53-E57 WeakPolarHBondContact O-CB 3.33Å; F53-E57 WeakPolarHBondContact O-CG 3.28Å; F53-E57 PolarHBondContact O-N 3.29Å; I55-E57 PolarHBondContact O-N 3.47Å; E57-E59 HydrophobicContact CB-CB 4.26Å; E57-E59 HydrophobicContact CB-CG 4.37Å; E57-E59 PolarHBondContact O-N 3.33Å
58	N	98.1	Very high	97.8	Very high	149 Å²	149	73.9 Å²	73.9	80%	0.797	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.9	42.9	-172.4	-170.9	44.3	0	0	0	112.5	A54 I55 C56	A54-N58 PolarHBondContact O-N 3.15Å; A54-N58 VanDerWaalsContact O-N 3.16Å; I55-N58 PolarHBondContact O-N 2.73Å; C56-N58 VanDerWaalsContact C-N 3.31Å
59	E	97.8	Very high	97.8	Very high	91 Å²	91	74.7 Å²	74.7	43%	0.425	38%	0.382	S	S	.	.			trans	-125.2	155.1	-175.8	-82.1	-70.2	-178.5	0	0	110.9	A54 E57 R63 V64	A54-E59 PolarHBondContact O-N 3.11Å; A54-E59 VanDerWaalsContact O-N 3.12Å; E57-E59 HydrophobicContact CB-CB 4.26Å; E57-E59 HydrophobicContact CB-CG 4.37Å; E57-E59 PolarHBondContact O-N 3.33Å; E59-R63 HydrophobicContact CB-CB 4.37Å; E59-R63 HydrophobicContact CB-CG 4.44Å; E59-R63 HydrophobicContact CG-CG 4.38Å; E59-V64 HydrophobicContact CB-CG2 4.03Å
60	C	97.4	Very high	97.7	Very high	77 Å²	77	77.2 Å²	77.2	52%	0.52	39%	0.393	S	S	.	.			trans	-67.8	147.2	176.8	76.4	0	0	0	0	110.5	A62 R63 V64	C60-A62 PolarHBondContact O-N 2.83Å; C60-R63 WeakPolarHBondContact O-CA 3.44Å; C60-R63 WeakPolarHBondContact O-CB 3.25Å; C60-R63 PolarHBondContact O-N 3.4Å; C60-R63 PolarHBondContact SG-N 3.37Å; C60-R63 VanDerWaalsContact SG-N 3.36Å; C60-V64 PolarHBondContact O-N 3.46Å; C60-V64 VanDerWaalsContact O-N 3.1Å
61	K	97.3	Very high	97.7	Very high	101 Å²	101	82.4 Å²	82.4	44%	0.439	42%	0.416	S	S	.	.	H	α-helix	trans	-55.3	-32.3	-179.2	-57.6	-177.3	-169	-173.7	0	112.7	N51 A54 R65	N51-K61 WeakPolarHBondContact OD1-CD 3.36Å; N51-K61 WeakPolarHBondContact OD1-CE 3.42Å; N51-K61 PolarHBondContact OD1-NZ 3.19Å; A54-K61 HydrophobicContact CB-CG 3.93Å; K61-R65 WeakPolarHBondContact O-CB 3.39Å; K61-R65 VanDerWaalsContact O-CG 3.29Å; K61-R65 WeakPolarHBondContact O-CG 3.42Å; K61-R65 PolarHBondContact O-N 3.01Å
62	A	97.7	Very high	97.6	Very high	68 Å²	68	82.7 Å²	82.7	56%	0.562	42%	0.416	S	S	*	.	H	α-helix	trans	-66.1	-41.1	176.3	0	0	0	0	0	112.1	C60 R65 F66	C60-A62 PolarHBondContact O-N 2.83Å; A62-R65 PolarHBondContact O-N 2.9Å; A62-F66 WeakPolarHBondContact O-CB 3.49Å; A62-F66 PolarHBondContact O-N 3.12Å
63	R	97.9	Very high	97.5	Very high	125 Å²	125	84.8 Å²	84.8	47%	0.472	43%	0.427	S	S	.	.	H	α-helix	trans	-63.4	-47.3	175.1	-173.4	79.4	-158.6	-149.2	3.1	111.1	E59 C60 R65 F66 N67	E59-R63 HydrophobicContact CB-CB 4.37Å; E59-R63 HydrophobicContact CB-CG 4.44Å; E59-R63 HydrophobicContact CG-CG 4.38Å; C60-R63 WeakPolarHBondContact O-CA 3.44Å; C60-R63 WeakPolarHBondContact O-CB 3.25Å; C60-R63 PolarHBondContact O-N 3.4Å; C60-R63 PolarHBondContact SG-N 3.37Å; C60-R63 VanDerWaalsContact SG-N 3.36Å; R63-R65 VanDerWaalsContact C-N 3.33Å; R63-R65 PolarHBondContact O-N 3.37Å; R63-F66 WeakPolarHBondContact O-CB 3.38Å; R63-F66 PolarHBondContact O-N 2.95Å; R63-N67 PolarHBondContact NE-OD1 3.17Å; R63-N67 PolarHBondContact O-N 3.36Å; R63-N67 PolarHBondContact O-OD1 2.95Å
64	V	97.9	Very high	97.3	Very high	3 Å²	3	87.5 Å²	87.5	2%	0.018	44%	0.44	C	S	.	.	H	α-helix	trans	-60.9	-43.5	177.8	179	0	0	0	0	111.2	L50 F53 A54 E59 C60 F66 N67 L68	L50-V64 HydrophobicContact CD1-CB 4.23Å; L50-V64 HydrophobicContact CD1-CG1 3.78Å; F53-V64 HydrophobicContact CB-CG1 3.97Å; A54-V64 HydrophobicContact CB-CG2 4.13Å; E59-V64 HydrophobicContact CB-CG2 4.03Å; C60-V64 PolarHBondContact O-N 3.46Å; C60-V64 VanDerWaalsContact O-N 3.1Å; V64-F66 PolarHBondContact O-N 2.74Å; V64-N67 PolarHBondContact O-N 2.96Å; V64-L68 HydrophobicContact CG1-CD1 3.98Å; V64-L68 HydrophobicContact CG1-CG 4.33Å; V64-L68 WeakPolarHBondContact O-CB 3.44Å; V64-L68 VanDerWaalsContact O-CG 3.31Å; V64-L68 WeakPolarHBondContact O-CG 3.4Å; V64-L68 PolarHBondContact O-N 3.5Å
65	R	97.6	Very high	97.3	Very high	120 Å²	120	88.8 Å²	88.8	45%	0.453	45%	0.448	S	S	.	.	H	α-helix	trans	-58	-46.6	174.3	-78.1	178.2	169.8	144	2	112.3	L44 L50 K61 A62 R63 L68 L69	L44-R65 HydrophobicContact CD2-CB 4.01Å; L44-R65 HydrophobicContact CD2-CG 3.78Å; L50-R65 HydrophobicContact CD1-CG 3.88Å; L50-R65 HydrophobicContact CD2-CG 3.78Å; L50-R65 VanDerWaalsContact CD2-CZ 3.45Å; L50-R65 HydrophobicContact CG-CG 4.49Å; K61-R65 WeakPolarHBondContact O-CB 3.39Å; K61-R65 VanDerWaalsContact O-CG 3.29Å; K61-R65 WeakPolarHBondContact O-CG 3.42Å; K61-R65 PolarHBondContact O-N 3.01Å; A62-R65 PolarHBondContact O-N 2.9Å; R63-R65 VanDerWaalsContact C-N 3.33Å; R63-R65 PolarHBondContact O-N 3.37Å; R65-L68 PolarHBondContact O-N 3.4Å; R65-L69 WeakPolarHBondContact O-CG 3.5Å; R65-L69 PolarHBondContact O-N 3.23Å
66	F	97.9	Very high	97.2	Very high	106 Å²	106	84.5 Å²	84.5	47%	0.465	43%	0.43	S	S	.	.	H	α-helix	trans	-60.1	-50.7	177.8	-179.9	-98.1	0	0	0	111.2	A62 R63 V64 L68 L69 E70	A62-F66 WeakPolarHBondContact O-CB 3.49Å; A62-F66 PolarHBondContact O-N 3.12Å; R63-F66 WeakPolarHBondContact O-CB 3.38Å; R63-F66 PolarHBondContact O-N 2.95Å; V64-F66 PolarHBondContact O-N 2.74Å; F66-L68 VanDerWaalsContact C-N 3.31Å; F66-L68 PolarHBondContact O-N 3.19Å; F66-L69 PolarHBondContact O-N 3.03Å; F66-E70 HydrophobicContact CD1-CG 4.3Å; F66-E70 HydrophobicContact CE1-CG 3.92Å; F66-E70 WeakPolarHBondContact CE1-OE1 3.44Å; F66-E70 WeakPolarHBondContact CE1-OE2 3.45Å; F66-E70 HydrophobicContact CE2-CG 4.34Å; F66-E70 HydrophobicContact CZ-CG 3.92Å; F66-E70 VanDerWaalsContact CZ-OE1 3.23Å; F66-E70 WeakPolarHBondContact CZ-OE1 3.35Å; F66-E70 WeakPolarHBondContact O-CG 3.42Å; F66-E70 PolarHBondContact O-N 3.4Å
67	N	97.3	Very high	97.1	Very high	35 Å²	35	81 Å²	81	19%	0.187	41%	0.41	C	S	.	.	H	α-helix	trans	-59	-40.7	178.4	-65.6	-12.4	0	0	0	112.1	R63 V64 K71	R63-N67 PolarHBondContact NE-OD1 3.17Å; R63-N67 PolarHBondContact O-N 3.36Å; R63-N67 PolarHBondContact O-OD1 2.95Å; V64-N67 PolarHBondContact O-N 2.96Å; N67-K71 WeakPolarHBondContact O-CB 3.3Å; N67-K71 VanDerWaalsContact O-CG 3.24Å; N67-K71 WeakPolarHBondContact O-CG 3.32Å; N67-K71 PolarHBondContact O-N 3.46Å; N67-K71 VanDerWaalsContact O-N 3.08Å
68	L	97.5	Very high	97	Very high	13 Å²	13	81.3 Å²	81.3	7%	0.068	42%	0.42	C	S	.	.	H	α-helix	trans	-66.1	-41.4	177.4	-74.7	173	0	0	0	112	Y43 L44 L50 V64 R65 F66 K71 M72	Y43-L68 HydrophobicContact CD2-CD2 4.21Å; L44-L68 HydrophobicContact CD1-CB 4.29Å; L44-L68 HydrophobicContact CD2-CB 3.94Å; L44-L68 HydrophobicContact CD2-CD1 3.91Å; L44-L68 HydrophobicContact CG-CB 4.09Å; L44-L68 HydrophobicContact CG-CD1 4.09Å; L50-L68 HydrophobicContact CD1-CD1 4.23Å; V64-L68 HydrophobicContact CG1-CD1 3.98Å; V64-L68 HydrophobicContact CG1-CG 4.33Å; V64-L68 WeakPolarHBondContact O-CB 3.44Å; V64-L68 VanDerWaalsContact O-CG 3.31Å; V64-L68 WeakPolarHBondContact O-CG 3.4Å; V64-L68 PolarHBondContact O-N 3.5Å; R65-L68 PolarHBondContact O-N 3.4Å; F66-L68 VanDerWaalsContact C-N 3.31Å; F66-L68 PolarHBondContact O-N 3.19Å; L68-K71 PolarHBondContact O-N 3.29Å; L68-M72 WeakPolarHBondContact O-CG 3.43Å; L68-M72 PolarHBondContact O-N 3.08Å
69	L	97.6	Very high	96.7	Very high	102 Å²	102	77.8 Å²	77.8	53%	0.534	41%	0.405	S	S	.	.	H	α-helix	trans	-65.7	-42.6	176.3	-73.1	170.5	0	0	0	111.8	L44 R65 F66 K71 M72	L44-L69 HydrophobicContact CD1-CD2 3.61Å; L44-L69 HydrophobicContact CD1-CG 3.95Å; R65-L69 WeakPolarHBondContact O-CG 3.5Å; R65-L69 PolarHBondContact O-N 3.23Å; F66-L69 PolarHBondContact O-N 3.03Å; L69-K71 VanDerWaalsContact C-N 3.32Å; L69-K71 PolarHBondContact O-N 3Å; L69-M72 HydrophobicContact CD2-SD 4.21Å; L69-M72 WeakPolarHBondContact O-CB 3.47Å; L69-M72 PolarHBondContact O-N 3.44Å; L69-M72 VanDerWaalsContact O-N 3.16Å
70	E	97.4	Very high	96.4	Very high	114 Å²	114	77.4 Å²	77.4	53%	0.533	41%	0.41	S	S	.	.	H	α-helix	trans	-62	-39.9	176.1	-72.6	-164.7	126.1	0	0	112.1	F66 M72 L73	F66-E70 HydrophobicContact CD1-CG 4.3Å; F66-E70 HydrophobicContact CE1-CG 3.92Å; F66-E70 WeakPolarHBondContact CE1-OE1 3.44Å; F66-E70 WeakPolarHBondContact CE1-OE2 3.45Å; F66-E70 HydrophobicContact CE2-CG 4.34Å; F66-E70 HydrophobicContact CZ-CG 3.92Å; F66-E70 VanDerWaalsContact CZ-OE1 3.23Å; F66-E70 WeakPolarHBondContact CZ-OE1 3.35Å; F66-E70 WeakPolarHBondContact O-CG 3.42Å; F66-E70 PolarHBondContact O-N 3.4Å; E70-M72 PolarHBondContact O-N 3.12Å; E70-M72 VanDerWaalsContact O-N 3.15Å; E70-L73 PolarHBondContact O-N 2.95Å
71	K	96.5	Very high	95.9	Very high	111 Å²	111	82.8 Å²	82.8	48%	0.483	43%	0.428	S	S	.	.	H	α-helix	trans	-60	-22.7	176.3	-77.3	171.6	-178.2	177.5	0	113.3	N67 L68 L69 L73 P75	N67-K71 WeakPolarHBondContact O-CB 3.3Å; N67-K71 VanDerWaalsContact O-CG 3.24Å; N67-K71 WeakPolarHBondContact O-CG 3.32Å; N67-K71 PolarHBondContact O-N 3.46Å; N67-K71 VanDerWaalsContact O-N 3.08Å; L68-K71 PolarHBondContact O-N 3.29Å; L69-K71 VanDerWaalsContact C-N 3.32Å; L69-K71 PolarHBondContact O-N 3Å; K71-L73 VanDerWaalsContact C-N 3.25Å; K71-L73 PolarHBondContact O-N 2.97Å; K71-P75 WeakPolarHBondContact O-CA 3.25Å; K71-P75 WeakPolarHBondContact O-CB 3.45Å; K71-P75 WeakPolarHBondContact O-CD 3.47Å
72	M	96.7	Very high	95	Very high	53 Å²	53	88.8 Å²	88.8	26%	0.261	45%	0.448	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.4	-19.3	-177.8	-62.5	-173.3	76.3	0	0	113.9	R37 C40 A41 L44 L68 L69 E70	R37-M72 HydrophobicContact CB-CE 4.16Å; R37-M72 HydrophobicContact CG-CE 4.45Å; R37-M72 PolarHBondContact NE-O 3.36Å; C40-M72 HydrophobicContact CB-CG 3.92Å; C40-M72 HydrophobicContact CB-SD 4.4Å; A41-M72 HydrophobicContact CB-CE 4.47Å; L44-M72 HydrophobicContact CD1-SD 4.46Å; L68-M72 WeakPolarHBondContact O-CG 3.43Å; L68-M72 PolarHBondContact O-N 3.08Å; L69-M72 HydrophobicContact CD2-SD 4.21Å; L69-M72 WeakPolarHBondContact O-CB 3.47Å; L69-M72 PolarHBondContact O-N 3.44Å; L69-M72 VanDerWaalsContact O-N 3.16Å; E70-M72 PolarHBondContact O-N 3.12Å; E70-M72 VanDerWaalsContact O-N 3.15Å
73	L	95.3	Very high	93.7	Very high	131 Å²	131	90.9 Å²	90.9	69%	0.686	46%	0.456	S	S	*	.	S	Bend	trans	-61.5	-57.5	-177.6	-177.3	63.3	0	0	0	111.3	R37 E70 K71	R37-L73 PolarHBondContact NH2-O 3.33Å; E70-L73 PolarHBondContact O-N 2.95Å; K71-L73 VanDerWaalsContact C-N 3.25Å; K71-L73 PolarHBondContact O-N 2.97Å
74	Q	94.7	Very high	91.7	Very high	106 Å²	106	94.5 Å²	94.5	50%	0.495	48%	0.478	S	S	.	.	S	Bend	trans	-143.5	70.2	179.6	-71.1	-179.8	14.2	0	0	110.6	C76 G77	Q74-C76 PolarHBondContact O-N 3.49Å; Q74-G77 PolarHBondContact O-N 3.37Å; Q74-G77 VanDerWaalsContact O-N 3.13Å
75	P	97.1	Very high	89.3	Confident	37 Å²	37	103.2 Å²	103.2	24%	0.24	54%	0.539	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.8	-25.5	-174.8	25.7	-35.2	0	0	0	113.3	T33 H36 R37 K71	T33-P75 HydrophobicContact CG2-CG 4.11Å; H36-P75 HydrophobicContact CB-CB 3.54Å; H36-P75 HydrophobicContact CB-CG 3.68Å; R37-P75 HydrophobicContact CG-CG 4.28Å; K71-P75 WeakPolarHBondContact O-CA 3.25Å; K71-P75 WeakPolarHBondContact O-CB 3.45Å; K71-P75 WeakPolarHBondContact O-CD 3.47Å
76	C	96.6	Very high	88.9	Confident	43 Å²	43	102.4 Å²	102.4	29%	0.291	54%	0.543	S	S	.	.	T	Hydrogen-bonded Turn	trans	-106.8	14.9	179.9	-56.5	0	0	0	0	112.9	H36 Q74	H36-C76 PolarHBondContact ND1-SG 3.16Å; Q74-C76 PolarHBondContact O-N 3.49Å
77	G	95.6	Very high	88.5	Confident	25 Å²	25	102.2 Å²	102.2	26%	0.258	55%	0.547	S	S	.	.			trans	74.2	-172.6	-172.9	0	0	0	0	0	113.5	W29 Q74	W29-G77 PolarHBondContact NE1-O 3.44Å; Q74-G77 PolarHBondContact O-N 3.37Å; Q74-G77 VanDerWaalsContact O-N 3.13Å
78	P	94.8	Very high	88	Confident	98 Å²	98	105.9 Å²	105.9	64%	0.636	57%	0.567	S	S	*	*	S	Bend	trans	-63.4	149.8	-179.9	27	-34.4	0	0	0	111.5	W29	W29-P78 PolarHBondContact NE1-O 3.3Å
79	P	92.6	Very high	87.4	Confident	75 Å²	75	111.4 Å²	111.4	49%	0.487	60%	0.597	S	S	.	*	P	Polyproline II helix	trans	-62	147.2	175.6	26.6	-33.5	0	0	0	111	W29	W29-P79 HydrophobicContact CD2-CB 3.84Å; W29-P79 VanDerWaalsContact CE2-CA 3.46Å; W29-P79 HydrophobicContact CE3-CB 3.91Å; W29-P79 HydrophobicContact CH2-CB 3.94Å; W29-P79 HydrophobicContact CH2-CG 4.34Å; W29-P79 HydrophobicContact CZ2-CB 3.83Å; W29-P79 HydrophobicContact CZ2-CG 4.25Å; W29-P79 HydrophobicContact CZ3-CB 3.98Å
80	P	91	Very high	86.8	Confident	82 Å²	82	111.9 Å²	111.9	53%	0.532	60%	0.601	S	S	.	*	P	Polyproline II helix	trans	-61.3	152.5	172.7	28.4	-34.5	0	0	0	110.2	W29 R82	W29-P80 HydrophobicContact CB-CG 4.17Å; P80-R82 PolarHBondContact O-N 3.1Å
81	E	87.2	Confident	86.1	Confident	191 Å²	191	111.8 Å²	111.8	89%	0.893	61%	0.605	S	S	*	*	P	Polyproline II helix	trans	-56.7	130.3	171.3	-67.5	179.1	177.8	0	0	109.1
82	R	77.5	Confident	85.3	Confident	226 Å²	226	111.9 Å²	111.9	85%	0.853	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-63.7	129.6	176.7	-73.1	-177.2	-73.7	177.8	-2.4	107.3	P80 E84	P80-R82 PolarHBondContact O-N 3.1Å; R82-E84 PolarHBondContact O-N 3.42Å
83	P	71.5	Confident	84.4	Confident	112 Å²	112	116.4 Å²	116.4	73%	0.727	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-58.8	119.4	172.4	23.3	-30	0	0	0	107.8	S85	P83-S85 PolarHBondContact O-N 3.33Å; P83-S85 PolarHBondContact O-OG 2.82Å
84	E	56.5	Low	83.5	Confident	202 Å²	202	115.2 Å²	115.2	94%	0.944	64%	0.637	S	S	*	*			trans	-56.7	114.6	169.7	-63.5	-171.4	173	0	0	107.1	R82	R82-E84 PolarHBondContact O-N 3.42Å
85	S	47.4	Very low	82.5	Confident	185 Å²	185	116 Å²	116	100%	1.294	65%	0.65	S	S	*	*			trans	-107.4	0	173.1	-58.5	0	0	0	0	109.2	P83	P83-S85 PolarHBondContact O-N 3.33Å; P83-S85 PolarHBondContact O-OG 2.82Å

Retrieved 85 of 85 residues in 186.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).