A0A3Q0KMQ2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KMQ2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 38 aa.

						>A0A3Q0KMQ2_SCHMA|A0A3Q0KMQ2
MVKHLMKSLNMKHLIVIYFKYLIYKHENYDNLMMMYTK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.8	Confident	85.6	Confident	218 Å²	218	127.3 Å²	127.3	100%	1.074	64%	0.637	S	S	*	*				0	-54.1	0	-150	163.6	178.2	0	112.9	K3 H4 L5	M1-K3 PolarHBondContact O-N 3.16Å; M1-H4 PolarHBondContact O-N 3.32Å; M1-H4 VanDerWaalsContact O-N 3.16Å; M1-L5 PolarHBondContact O-N 3.13Å
2	V	82.8	Confident	86.3	Confident	105 Å²	105	127.8 Å²	127.8	64%	0.636	63%	0.632	S	S	*	*	H	α-helix	trans	-55.6	-44.2	-177	-177	0	0	0	114.4	H4 L5 M6	V2-H4 VanDerWaalsContact C-N 3.28Å; V2-H4 PolarHBondContact O-N 3.26Å; V2-L5 PolarHBondContact O-N 3.05Å; V2-L5 VanDerWaalsContact O-N 3.13Å; V2-M6 HydrophobicContact CG1-CE 4.03Å; V2-M6 HydrophobicContact CG1-SD 4.33Å; V2-M6 PolarHBondContact O-N 3.44Å
3	K	83.4	Confident	87	Confident	187 Å²	187	126.5 Å²	126.5	81%	0.813	62%	0.623	S	S	*	*	H	α-helix	trans	-56.9	-38.1	178.7	-69.5	-175.3	178.4	-179.1	113.2	M1 K7	M1-K3 PolarHBondContact O-N 3.16Å; K3-K7 PolarHBondContact O-N 2.99Å; K3-K7 VanDerWaalsContact O-N 3.08Å
4	H	85.5	Confident	87.5	Confident	145 Å²	145	123.9 Å²	123.9	67%	0.671	61%	0.612	S	S	*	*	H	α-helix	trans	-70.4	-37.9	-180	-166.1	-16.4	0	0	111.4	M1 V2 K7 S8	M1-H4 PolarHBondContact O-N 3.32Å; M1-H4 VanDerWaalsContact O-N 3.16Å; V2-H4 VanDerWaalsContact C-N 3.28Å; V2-H4 PolarHBondContact O-N 3.26Å; H4-K7 PolarHBondContact O-N 3.23Å; H4-S8 PolarHBondContact O-N 3.45Å
5	L	84.2	Confident	88.1	Confident	119 Å²	119	121.9 Å²	121.9	62%	0.623	60%	0.604	S	S	*	*	H	α-helix	trans	-66.4	-43.8	178.4	-156.4	126.9	0	0	111.1	M1 V2 K7 S8 L9	M1-L5 PolarHBondContact O-N 3.13Å; V2-L5 PolarHBondContact O-N 3.05Å; V2-L5 VanDerWaalsContact O-N 3.13Å; L5-K7 VanDerWaalsContact C-N 3.34Å; L5-K7 PolarHBondContact O-N 2.99Å; L5-S8 PolarHBondContact O-N 3.33Å; L5-L9 HydrophobicContact CD2-CD1 4.11Å; L5-L9 WeakPolarHBondContact O-CG 3.48Å; L5-L9 PolarHBondContact O-N 3.08Å
6	M	85.5	Confident	88.5	Confident	123 Å²	123	118.9 Å²	118.9	61%	0.606	59%	0.593	S	S	*	*	H	α-helix	trans	-60.4	-41.4	172.9	-71.5	-178.8	169.3	0	112.3	V2 S8 L9 N10	V2-M6 HydrophobicContact CG1-CE 4.03Å; V2-M6 HydrophobicContact CG1-SD 4.33Å; V2-M6 PolarHBondContact O-N 3.44Å; M6-S8 PolarHBondContact O-N 3.36Å; M6-L9 PolarHBondContact O-N 3.48Å; M6-N10 WeakPolarHBondContact O-CB 3.48Å; M6-N10 PolarHBondContact O-N 2.88Å
7	K	86.7	Confident	88.9	Confident	146 Å²	146	116.9 Å²	116.9	64%	0.635	58%	0.584	S	S	*	*	H	α-helix	trans	-62.2	-42.4	175.7	-172	178.2	-180	-179	111.9	K3 H4 L5 N10 M11	K3-K7 PolarHBondContact O-N 2.99Å; K3-K7 VanDerWaalsContact O-N 3.08Å; H4-K7 PolarHBondContact O-N 3.23Å; L5-K7 VanDerWaalsContact C-N 3.34Å; L5-K7 PolarHBondContact O-N 2.99Å; K7-N10 PolarHBondContact O-N 3.23Å; K7-M11 WeakPolarHBondContact O-CG 3.4Å; K7-M11 PolarHBondContact O-N 3.5Å
8	S	87.2	Confident	89.4	Confident	55 Å²	55	118.3 Å²	118.3	39%	0.385	58%	0.583	S	S	.	*	H	α-helix	trans	-63.4	-43.8	177.3	-174.8	0	0	0	111.7	H4 L5 M6 N10 M11 K12	H4-S8 PolarHBondContact O-N 3.45Å; L5-S8 PolarHBondContact O-N 3.33Å; M6-S8 PolarHBondContact O-N 3.36Å; S8-N10 VanDerWaalsContact C-N 3.33Å; S8-N10 PolarHBondContact O-N 2.85Å; S8-M11 PolarHBondContact O-N 3.28Å; S8-K12 WeakPolarHBondContact O-CG 3.42Å; S8-K12 PolarHBondContact O-N 3.48Å
9	L	90	Very high	89.8	Confident	101 Å²	101	118.3 Å²	118.3	53%	0.529	58%	0.579	S	S	.	*	H	α-helix	trans	-61.1	-42.1	174	-71.9	172.5	0	0	111.7	L5 M6 M11 K12 H13	L5-L9 HydrophobicContact CD2-CD1 4.11Å; L5-L9 WeakPolarHBondContact O-CG 3.48Å; L5-L9 PolarHBondContact O-N 3.08Å; M6-L9 PolarHBondContact O-N 3.48Å; L9-M11 PolarHBondContact O-N 3.02Å; L9-K12 PolarHBondContact O-N 3.33Å; L9-H13 WeakPolarHBondContact O-CB 3.39Å; L9-H13 PolarHBondContact O-N 2.88Å
10	N	90.6	Very high	90.1	Very high	95 Å²	95	119.7 Å²	119.7	51%	0.508	58%	0.582	S	S	.	*	H	α-helix	trans	-62.9	-42.5	177.8	-162.6	44.4	0	0	111.8	M6 K7 S8 K12 H13 L14	M6-N10 WeakPolarHBondContact O-CB 3.48Å; M6-N10 PolarHBondContact O-N 2.88Å; K7-N10 PolarHBondContact O-N 3.23Å; S8-N10 VanDerWaalsContact C-N 3.33Å; S8-N10 PolarHBondContact O-N 2.85Å; N10-K12 PolarHBondContact O-N 2.97Å; N10-H13 PolarHBondContact O-N 3.48Å; N10-L14 WeakPolarHBondContact O-CG 3.49Å; N10-L14 PolarHBondContact O-N 3.48Å
11	M	91.3	Very high	90.3	Very high	106 Å²	106	120.4 Å²	120.4	52%	0.522	58%	0.58	S	S	.	*	H	α-helix	trans	-63	-42.8	175.6	-67.7	-62.1	-72.9	0	111.8	K7 S8 L9 H13 L14 I15	K7-M11 WeakPolarHBondContact O-CG 3.4Å; K7-M11 PolarHBondContact O-N 3.5Å; S8-M11 PolarHBondContact O-N 3.28Å; L9-M11 PolarHBondContact O-N 3.02Å; M11-H13 VanDerWaalsContact C-N 3.33Å; M11-H13 PolarHBondContact O-N 3.29Å; M11-L14 PolarHBondContact O-N 3.3Å; M11-L14 HydrophobicContact SD-CD1 4.35Å; M11-I15 WeakPolarHBondContact O-CG1 3.48Å; M11-I15 PolarHBondContact O-N 3.48Å; M11-I15 VanDerWaalsContact O-N 3.09Å
12	K	93.8	Very high	91.3	Very high	133 Å²	133	113.3 Å²	113.3	58%	0.578	55%	0.546	S	S	*	.	H	α-helix	trans	-61.7	-41.7	173.9	-72.5	-179.4	178.3	-175.3	111.7	S8 L9 N10 I15 V16	S8-K12 WeakPolarHBondContact O-CG 3.42Å; S8-K12 PolarHBondContact O-N 3.48Å; L9-K12 PolarHBondContact O-N 3.33Å; N10-K12 PolarHBondContact O-N 2.97Å; K12-I15 PolarHBondContact O-N 3.46Å; K12-V16 WeakPolarHBondContact O-CG2 3.49Å; K12-V16 PolarHBondContact O-N 2.93Å
13	H	94.8	Very high	91.8	Very high	111 Å²	111	112.9 Å²	112.9	51%	0.514	54%	0.539	S	S	.	.	H	α-helix	trans	-65	-42.3	178.8	-166.7	73.4	0	0	112	L9 N10 M11 I15 V16 I17	L9-H13 WeakPolarHBondContact O-CB 3.39Å; L9-H13 PolarHBondContact O-N 2.88Å; N10-H13 PolarHBondContact O-N 3.48Å; M11-H13 VanDerWaalsContact C-N 3.33Å; M11-H13 PolarHBondContact O-N 3.29Å; H13-I15 VanDerWaalsContact C-N 3.32Å; H13-I15 PolarHBondContact O-N 2.95Å; H13-V16 PolarHBondContact O-N 3.26Å; H13-I17 VanDerWaalsContact CD2-CD1 3.42Å; H13-I17 WeakPolarHBondContact CD2-CD1 3.33Å; H13-I17 WeakPolarHBondContact NE2-CD1 3.36Å; H13-I17 WeakPolarHBondContact O-CG1 3.4Å; H13-I17 PolarHBondContact O-N 3.04Å
14	L	94.8	Very high	92.3	Very high	91 Å²	91	111.5 Å²	111.5	48%	0.476	53%	0.529	S	S	.	.	H	α-helix	trans	-59.7	-42	174.5	-74.3	170	0	0	112	N10 M11 V16 I17 Y18	N10-L14 WeakPolarHBondContact O-CG 3.49Å; N10-L14 PolarHBondContact O-N 3.48Å; M11-L14 PolarHBondContact O-N 3.3Å; M11-L14 HydrophobicContact SD-CD1 4.35Å; L14-V16 PolarHBondContact O-N 3.36Å; L14-I17 PolarHBondContact O-N 3.49Å; L14-Y18 WeakPolarHBondContact O-CB 3.41Å; L14-Y18 PolarHBondContact O-N 3.33Å
15	I	95.8	Very high	92.7	Very high	94 Å²	94	108.8 Å²	108.8	48%	0.482	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-44.5	175.4	-68.4	164.6	0	0	110.6	M11 K12 H13 Y18 F19	M11-I15 WeakPolarHBondContact O-CG1 3.48Å; M11-I15 PolarHBondContact O-N 3.48Å; M11-I15 VanDerWaalsContact O-N 3.09Å; K12-I15 PolarHBondContact O-N 3.46Å; H13-I15 VanDerWaalsContact C-N 3.32Å; H13-I15 PolarHBondContact O-N 2.95Å; I15-Y18 WeakPolarHBondContact O-CB 3.32Å; I15-Y18 PolarHBondContact O-N 3.09Å; I15-F19 HydrophobicContact CG2-CD2 3.7Å; I15-F19 HydrophobicContact CG2-CE2 3.53Å; I15-F19 VanDerWaalsContact O-CD2 3.22Å; I15-F19 WeakPolarHBondContact O-CD2 3.22Å; I15-F19 PolarHBondContact O-N 3.49Å
16	V	95.3	Very high	93.1	Very high	73 Å²	73	108.7 Å²	108.7	44%	0.442	51%	0.512	S	S	.	.	H	α-helix	trans	-63.5	-43.1	177.6	172.8	0	0	0	111.9	K12 H13 L14 Y18 F19 K20	K12-V16 WeakPolarHBondContact O-CG2 3.49Å; K12-V16 PolarHBondContact O-N 2.93Å; H13-V16 PolarHBondContact O-N 3.26Å; L14-V16 PolarHBondContact O-N 3.36Å; V16-Y18 VanDerWaalsContact C-N 3.3Å; V16-Y18 PolarHBondContact O-N 3.41Å; V16-F19 PolarHBondContact O-N 2.91Å; V16-K20 HydrophobicContact CG1-CD 4.48Å; V16-K20 WeakPolarHBondContact O-CG 3.5Å; V16-K20 PolarHBondContact O-N 3.39Å
17	I	95.7	Very high	93.4	Very high	85 Å²	85	107.9 Å²	107.9	44%	0.436	51%	0.507	S	S	.	.	H	α-helix	trans	-59.9	-44.1	175.3	-70.3	169.7	0	0	110.3	H13 L14 F19 K20 Y21	H13-I17 VanDerWaalsContact CD2-CD1 3.42Å; H13-I17 WeakPolarHBondContact CD2-CD1 3.33Å; H13-I17 WeakPolarHBondContact NE2-CD1 3.36Å; H13-I17 WeakPolarHBondContact O-CG1 3.4Å; H13-I17 PolarHBondContact O-N 3.04Å; L14-I17 PolarHBondContact O-N 3.49Å; I17-F19 PolarHBondContact O-N 3.18Å; I17-K20 PolarHBondContact O-N 3.06Å; I17-Y21 WeakPolarHBondContact O-CB 3.41Å; I17-Y21 PolarHBondContact O-N 3.43Å
18	Y	96.5	Very high	93.4	Very high	142 Å²	142	104.5 Å²	104.5	56%	0.557	50%	0.496	S	S	*	.	H	α-helix	trans	-61.1	-44.7	179.4	-177	-105	0	0	112.2	L14 I15 V16 Y21 L22	L14-Y18 WeakPolarHBondContact O-CB 3.41Å; L14-Y18 PolarHBondContact O-N 3.33Å; I15-Y18 WeakPolarHBondContact O-CB 3.32Å; I15-Y18 PolarHBondContact O-N 3.09Å; V16-Y18 VanDerWaalsContact C-N 3.3Å; V16-Y18 PolarHBondContact O-N 3.41Å; Y18-Y21 PolarHBondContact O-N 2.98Å; Y18-L22 HydrophobicContact CD1-CD1 3.94Å; Y18-L22 HydrophobicContact CE1-CD1 3.43Å; Y18-L22 VanDerWaalsContact CE1-CD1 3.43Å; Y18-L22 HydrophobicContact CE1-CG 4.14Å; Y18-L22 WeakPolarHBondContact O-CG 3.34Å; Y18-L22 PolarHBondContact O-N 3.41Å
19	F	97	Very high	93.5	Very high	119 Å²	119	108.7 Å²	108.7	52%	0.522	50%	0.504	S	S	.	.	H	α-helix	trans	-63.3	-42.7	175.4	-82.8	-68.5	0	0	112.9	I15 V16 I17 Y21 L22 I23	I15-F19 HydrophobicContact CG2-CD2 3.7Å; I15-F19 HydrophobicContact CG2-CE2 3.53Å; I15-F19 VanDerWaalsContact O-CD2 3.22Å; I15-F19 WeakPolarHBondContact O-CD2 3.22Å; I15-F19 PolarHBondContact O-N 3.49Å; V16-F19 PolarHBondContact O-N 2.91Å; I17-F19 PolarHBondContact O-N 3.18Å; F19-Y21 VanDerWaalsContact C-N 3.31Å; F19-Y21 PolarHBondContact O-N 3.43Å; F19-L22 PolarHBondContact O-N 2.93Å; F19-I23 WeakPolarHBondContact O-CG1 3.34Å; F19-I23 PolarHBondContact O-N 2.98Å
20	K	95.7	Very high	93.3	Very high	145 Å²	145	107.8 Å²	107.8	63%	0.63	50%	0.5	S	S	*	.	H	α-helix	trans	-60.8	-41.5	175.7	-74.9	-177.7	175.7	-173.1	111.9	V16 I17 I23 Y24	V16-K20 HydrophobicContact CG1-CD 4.48Å; V16-K20 WeakPolarHBondContact O-CG 3.5Å; V16-K20 PolarHBondContact O-N 3.39Å; I17-K20 PolarHBondContact O-N 3.06Å; K20-I23 PolarHBondContact O-N 3.23Å; K20-Y24 WeakPolarHBondContact O-CB 3.45Å; K20-Y24 PolarHBondContact O-N 3.18Å
21	Y	95.8	Very high	93.1	Very high	135 Å²	135	107.8 Å²	107.8	53%	0.529	50%	0.5	S	S	.	.	H	α-helix	trans	-63	-41.9	175.9	175	-99.9	0	0	112	I17 Y18 F19 Y24 K25	I17-Y21 WeakPolarHBondContact O-CB 3.41Å; I17-Y21 PolarHBondContact O-N 3.43Å; Y18-Y21 PolarHBondContact O-N 2.98Å; F19-Y21 VanDerWaalsContact C-N 3.31Å; F19-Y21 PolarHBondContact O-N 3.43Å; Y21-Y24 PolarHBondContact O-N 3.29Å; Y21-K25 HydrophobicContact CE1-CD 4.35Å; Y21-K25 WeakPolarHBondContact O-CB 3.48Å; Y21-K25 PolarHBondContact O-N 3.32Å
22	L	94.6	Very high	92.9	Very high	69 Å²	69	105.9 Å²	105.9	36%	0.361	49%	0.491	S	S	.	.	H	α-helix	trans	-63.3	-44.3	175.6	-76	178.1	0	0	112.4	Y18 F19 K25 H26	Y18-L22 HydrophobicContact CD1-CD1 3.94Å; Y18-L22 HydrophobicContact CE1-CD1 3.43Å; Y18-L22 VanDerWaalsContact CE1-CD1 3.43Å; Y18-L22 HydrophobicContact CE1-CG 4.14Å; Y18-L22 WeakPolarHBondContact O-CG 3.34Å; Y18-L22 PolarHBondContact O-N 3.41Å; F19-L22 PolarHBondContact O-N 2.93Å; L22-K25 PolarHBondContact O-N 3.01Å; L22-H26 WeakPolarHBondContact O-CB 3.42Å; L22-H26 PolarHBondContact O-N 3.04Å
23	I	93.9	Very high	92.6	Very high	96 Å²	96	105.8 Å²	105.8	49%	0.492	50%	0.495	S	S	.	.	H	α-helix	trans	-59.9	-50.5	176.9	-69	161.2	0	0	110	F19 K20 K25 H26 E27	F19-I23 WeakPolarHBondContact O-CG1 3.34Å; F19-I23 PolarHBondContact O-N 2.98Å; K20-I23 PolarHBondContact O-N 3.23Å; I23-K25 VanDerWaalsContact C-N 3.29Å; I23-K25 PolarHBondContact O-N 2.96Å; I23-H26 WeakPolarHBondContact O-CB 3.44Å; I23-H26 PolarHBondContact O-N 2.9Å; I23-H26 VanDerWaalsContact O-N 3.1Å; I23-E27 HydrophobicContact CG2-CG 4.32Å; I23-E27 WeakPolarHBondContact O-CG 3.4Å; I23-E27 PolarHBondContact O-N 2.87Å
24	Y	94.1	Very high	92.1	Very high	158 Å²	158	105.9 Å²	105.9	62%	0.62	50%	0.497	S	S	*	.	H	α-helix	trans	-58.2	-42.1	178.4	-179.2	-94.8	0	0	112.4	K20 Y21 N28	K20-Y24 WeakPolarHBondContact O-CB 3.45Å; K20-Y24 PolarHBondContact O-N 3.18Å; Y21-Y24 PolarHBondContact O-N 3.29Å; Y24-N28 WeakPolarHBondContact O-CB 3.15Å; Y24-N28 PolarHBondContact O-N 3.3Å
25	K	92.5	Very high	91.6	Very high	88 Å²	88	108.4 Å²	108.4	38%	0.383	51%	0.508	S	S	.	.	H	α-helix	trans	-64.3	-44	177	-174.4	172.2	179.7	175.7	111	Y21 L22 I23 N28 Y29	Y21-K25 HydrophobicContact CE1-CD 4.35Å; Y21-K25 WeakPolarHBondContact O-CB 3.48Å; Y21-K25 PolarHBondContact O-N 3.32Å; L22-K25 PolarHBondContact O-N 3.01Å; I23-K25 VanDerWaalsContact C-N 3.29Å; I23-K25 PolarHBondContact O-N 2.96Å; K25-N28 PolarHBondContact O-N 3.31Å; K25-Y29 HydrophobicContact CD-CE2 4.25Å; K25-Y29 HydrophobicContact CG-CD2 3.93Å; K25-Y29 HydrophobicContact CG-CE2 3.68Å; K25-Y29 WeakPolarHBondContact O-CD2 3.33Å; K25-Y29 PolarHBondContact O-N 3.36Å
26	H	93.6	Very high	91	Very high	118 Å²	118	113.1 Å²	113.1	55%	0.546	52%	0.521	S	S	.	.	H	α-helix	trans	-61.6	-50.5	178.1	-168.3	-74.8	0	0	111.5	L22 I23 N28 Y29 D30	L22-H26 WeakPolarHBondContact O-CB 3.42Å; L22-H26 PolarHBondContact O-N 3.04Å; I23-H26 WeakPolarHBondContact O-CB 3.44Å; I23-H26 PolarHBondContact O-N 2.9Å; I23-H26 VanDerWaalsContact O-N 3.1Å; H26-N28 VanDerWaalsContact C-N 3.26Å; H26-N28 PolarHBondContact O-N 3.04Å; H26-Y29 WeakPolarHBondContact O-CB 3.37Å; H26-Y29 PolarHBondContact O-N 3.4Å; H26-D30 IonicContact CE1-OD1 3.66Å; H26-D30 IonicContact CE1-OD2 3.05Å; H26-D30 PolarHBondContact CE1-OD2 2.86Å; H26-D30 IonicContact ND1-OD1 3.93Å; H26-D30 IonicContact ND1-OD2 2.78Å; H26-D30 PolarHBondContact ND1-OD2 3.35Å; H26-D30 PolarHBondContact O-N 3.5Å
27	E	91.1	Very high	90.4	Very high	106 Å²	106	114.9 Å²	114.9	50%	0.495	53%	0.532	S	S	.	.	H	α-helix	trans	-58	-39.3	177.2	-70.3	179.2	119.4	0	111.7	I23 D30 N31	I23-E27 HydrophobicContact CG2-CG 4.32Å; I23-E27 WeakPolarHBondContact O-CG 3.4Å; I23-E27 PolarHBondContact O-N 2.87Å; E27-D30 PolarHBondContact O-N 3.1Å; E27-N31 WeakPolarHBondContact O-CB 3.39Å; E27-N31 PolarHBondContact O-N 2.87Å; E27-N31 PolarHBondContact O-ND2 3.03Å
28	N	88.2	Confident	89.1	Confident	75 Å²	75	121 Å²	121	40%	0.401	56%	0.555	S	S	.	*	H	α-helix	trans	-66.5	-37.3	175.8	-171.2	68.2	0	0	112.7	Y24 K25 H26 L32	Y24-N28 WeakPolarHBondContact O-CB 3.15Å; Y24-N28 PolarHBondContact O-N 3.3Å; K25-N28 PolarHBondContact O-N 3.31Å; H26-N28 VanDerWaalsContact C-N 3.26Å; H26-N28 PolarHBondContact O-N 3.04Å; N28-L32 WeakPolarHBondContact O-CB 3.49Å; N28-L32 VanDerWaalsContact O-CG 3.27Å; N28-L32 WeakPolarHBondContact O-CG 3.46Å; N28-L32 PolarHBondContact O-N 3.07Å
29	Y	87.9	Confident	88.8	Confident	142 Å²	142	120 Å²	120	56%	0.557	56%	0.555	S	S	*	*	H	α-helix	trans	-66.5	-42.4	173.2	-85.1	-71.9	0	0	112.2	K25 H26 N31 L32 M33	K25-Y29 HydrophobicContact CD-CE2 4.25Å; K25-Y29 HydrophobicContact CG-CD2 3.93Å; K25-Y29 HydrophobicContact CG-CE2 3.68Å; K25-Y29 WeakPolarHBondContact O-CD2 3.33Å; K25-Y29 PolarHBondContact O-N 3.36Å; H26-Y29 WeakPolarHBondContact O-CB 3.37Å; H26-Y29 PolarHBondContact O-N 3.4Å; Y29-N31 VanDerWaalsContact C-N 3.34Å; Y29-N31 PolarHBondContact O-N 2.91Å; Y29-L32 PolarHBondContact O-N 3.03Å; Y29-M33 VanDerWaalsContact O-CB 3.32Å; Y29-M33 WeakPolarHBondContact O-CB 3.09Å; Y29-M33 PolarHBondContact O-N 3.35Å
30	D	86.4	Confident	88.3	Confident	82 Å²	82	120 Å²	120	44%	0.439	56%	0.557	S	S	.	*	H	α-helix	trans	-62.3	-43.5	176.3	-68.3	-32.5	0	0	111	H26 E27 M33 M34	H26-D30 IonicContact CE1-OD1 3.66Å; H26-D30 IonicContact CE1-OD2 3.05Å; H26-D30 PolarHBondContact CE1-OD2 2.86Å; H26-D30 IonicContact ND1-OD1 3.93Å; H26-D30 IonicContact ND1-OD2 2.78Å; H26-D30 PolarHBondContact ND1-OD2 3.35Å; H26-D30 PolarHBondContact O-N 3.5Å; E27-D30 PolarHBondContact O-N 3.1Å; D30-M33 PolarHBondContact O-N 3.05Å; D30-M34 WeakPolarHBondContact O-CB 3.27Å; D30-M34 PolarHBondContact O-N 2.78Å
31	N	87	Confident	87.9	Confident	96 Å²	96	118.6 Å²	118.6	51%	0.513	55%	0.553	S	S	.	*	H	α-helix	trans	-63	-43.7	176.6	-73	-24.8	0	0	112.1	E27 Y29 M34 M35	E27-N31 WeakPolarHBondContact O-CB 3.39Å; E27-N31 PolarHBondContact O-N 2.87Å; E27-N31 PolarHBondContact O-ND2 3.03Å; Y29-N31 VanDerWaalsContact C-N 3.34Å; Y29-N31 PolarHBondContact O-N 2.91Å; N31-M34 PolarHBondContact O-N 3.35Å; N31-M35 WeakPolarHBondContact O-CG 3.38Å; N31-M35 PolarHBondContact O-N 3.04Å
32	L	87	Confident	87.4	Confident	65 Å²	65	117.6 Å²	117.6	34%	0.34	55%	0.554	S	S	.	*	H	α-helix	trans	-63.3	-46.7	175.2	-76.7	168.6	0	0	111	N28 Y29 M34 M35 Y36	N28-L32 WeakPolarHBondContact O-CB 3.49Å; N28-L32 VanDerWaalsContact O-CG 3.27Å; N28-L32 WeakPolarHBondContact O-CG 3.46Å; N28-L32 PolarHBondContact O-N 3.07Å; Y29-L32 PolarHBondContact O-N 3.03Å; L32-M34 VanDerWaalsContact C-N 3.27Å; L32-M34 PolarHBondContact O-N 3.4Å; L32-M35 WeakPolarHBondContact O-CB 3.4Å; L32-M35 PolarHBondContact O-N 3.37Å; L32-Y36 HydrophobicContact CB-CE2 4.45Å; L32-Y36 HydrophobicContact CD2-CE2 4.27Å; L32-Y36 WeakPolarHBondContact O-CD2 3.47Å; L32-Y36 PolarHBondContact O-N 3.01Å
33	M	86.5	Confident	87	Confident	132 Å²	132	120.7 Å²	120.7	65%	0.65	57%	0.566	S	S	*	*	H	α-helix	trans	-60.9	-38.5	178.3	-173.9	157.8	175.6	0	111.4	Y29 D30 M35 Y36 T37	Y29-M33 VanDerWaalsContact O-CB 3.32Å; Y29-M33 WeakPolarHBondContact O-CB 3.09Å; Y29-M33 PolarHBondContact O-N 3.35Å; D30-M33 PolarHBondContact O-N 3.05Å; M33-M35 PolarHBondContact O-N 2.96Å; M33-Y36 PolarHBondContact O-N 2.84Å; M33-T37 WeakPolarHBondContact O-CB 3.32Å; M33-T37 PolarHBondContact O-N 2.71Å; M33-T37 PolarHBondContact O-OG1 3.5Å
34	M	83.8	Confident	86.5	Confident	113 Å²	113	122.3 Å²	122.3	56%	0.557	57%	0.571	S	S	*	*	H	α-helix	trans	-65.2	-35.8	174	-165.8	-174.5	-165.1	0	112.6	D30 N31 L32	D30-M34 WeakPolarHBondContact O-CB 3.27Å; D30-M34 PolarHBondContact O-N 2.78Å; N31-M34 PolarHBondContact O-N 3.35Å; L32-M34 VanDerWaalsContact C-N 3.27Å; L32-M34 PolarHBondContact O-N 3.4Å
35	M	84.1	Confident	86	Confident	143 Å²	143	119.8 Å²	119.8	70%	0.704	57%	0.568	S	S	*	*	H	α-helix	trans	-68.2	-38.9	174.6	-75	-174.1	-178.8	0	112.6	N31 L32 M33	N31-M35 WeakPolarHBondContact O-CG 3.38Å; N31-M35 PolarHBondContact O-N 3.04Å; L32-M35 WeakPolarHBondContact O-CB 3.4Å; L32-M35 PolarHBondContact O-N 3.37Å; M33-M35 PolarHBondContact O-N 2.96Å
36	Y	83.6	Confident	85.5	Confident	193 Å²	193	122.2 Å²	122.2	76%	0.757	58%	0.582	S	S	*	*	H	α-helix	trans	-80.9	-14.6	179.5	-70.1	-69.7	0	0	114.3	L32 M33	L32-Y36 HydrophobicContact CB-CE2 4.45Å; L32-Y36 HydrophobicContact CD2-CE2 4.27Å; L32-Y36 WeakPolarHBondContact O-CD2 3.47Å; L32-Y36 PolarHBondContact O-N 3.01Å; M33-Y36 PolarHBondContact O-N 2.84Å
37	T	84	Confident	84.8	Confident	110 Å²	110	122.6 Å²	122.6	68%	0.675	59%	0.585	S	S	*	*	H	α-helix	trans	-93.1	-10.4	179.4	-51	0	0	0	113.1	M33	M33-T37 WeakPolarHBondContact O-CB 3.32Å; M33-T37 PolarHBondContact O-N 2.71Å; M33-T37 PolarHBondContact O-OG1 3.5Å
38	K	68.4	Low	84.3	Confident	214 Å²	214	124.1 Å²	124.1	93%	0.93	59%	0.593	S	S	*	*			trans	-94.4	0	173.5	-75	-179.5	176.5	177.9	110.7

Retrieved 38 of 38 residues in 32.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).