A0A3Q0KN03_SCHMA Loading...

Putative kunitz-type protease inhibitor

AlphaFold DB , UniProt , Accession A0A3Q0KN03, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 136 aa.

						>A0A3Q0KN03_SCHMA|A0A3Q0KN03
MAQEKESLVESHWSDFQPPPSSGIIYKREVIPRHRTLSALLIGLGIIVTLILLLVLSYFMHVYSVVHSHINMQDTLNPICLLPRLTGKCRASFNRWGWNPQTTTCEEFIYGGCDANENNFLTKEECETVCKIKVYI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.5	Low	63.1	Low	245 Å²	245	139.4 Å²	139.4	100%	1.207	73%	0.732	S	S	*	*				0	42.1	0	-62.2	-179.3	-75.3	0	0	111.7
2	A	61.2	Low	63.9	Low	90 Å²	90	139.7 Å²	139.7	74%	0.744	73%	0.726	S	S	*	*			trans	-105.9	-4.8	-172.3	0	0	0	0	0	114.8
3	Q	65.6	Low	64	Low	175 Å²	175	142.6 Å²	142.6	82%	0.818	72%	0.722	S	S	*	*	S	Bend	trans	-91.3	-5.1	-171.2	-63.7	-172.6	-82.7	0	0	114.7
4	E	65.7	Low	64.3	Low	161 Å²	161	139.5 Å²	139.5	75%	0.752	72%	0.72	S	S	*	*	S	Bend	trans	-86.4	-11	-175.2	-164.4	165.3	-174.8	0	0	113.8	S7	E4-S7 PolarHBondContact O-OG 3.45Å
5	K	67.6	Low	65	Low	174 Å²	174	138.5 Å²	138.5	76%	0.757	72%	0.717	S	S	*	*	S	Bend	trans	-86.5	-20.2	-176.5	-66.9	-171.2	178.4	-172.8	0	114.5
6	E	62.6	Low	65.6	Low	152 Å²	152	139.1 Å²	139.1	71%	0.71	71%	0.712	S	S	*	*	H	α-helix	trans	-76.1	-34.1	-177.2	-72.8	178.3	150.1	0	0	112.5	L8 V9	E6-L8 VanDerWaalsContact C-N 3.31Å; E6-L8 PolarHBondContact O-N 2.94Å; E6-V9 PolarHBondContact O-N 3.39Å
7	S	59.8	Low	66.3	Low	81 Å²	81	141.2 Å²	141.2	57%	0.566	72%	0.719	S	S	*	*	H	α-helix	trans	-70	-25.7	178.7	59.1	0	0	0	0	113.8	E4	E4-S7 PolarHBondContact O-OG 3.45Å
8	L	62.6	Low	66.6	Low	128 Å²	128	139.1 Å²	139.1	67%	0.67	72%	0.716	S	S	*	*	H	α-helix	trans	-73.1	-30.1	177.6	-115.7	150.1	0	0	0	112.1	E6 S11	E6-L8 VanDerWaalsContact C-N 3.31Å; E6-L8 PolarHBondContact O-N 2.94Å; L8-S11 PolarHBondContact O-OG 3.22Å
9	V	68	Low	67	Low	87 Å²	87	137.2 Å²	137.2	53%	0.527	71%	0.713	S	S	.	*	H	α-helix	trans	-73.6	-34.4	-177.6	175.5	0	0	0	0	112	E6 S11 H12	E6-V9 PolarHBondContact O-N 3.39Å; V9-S11 VanDerWaalsContact C-N 3.3Å; V9-S11 PolarHBondContact O-N 3.28Å; V9-H12 PolarHBondContact O-N 3.38Å
10	E	62.4	Low	67.1	Low	162 Å²	162	136.6 Å²	136.6	76%	0.757	72%	0.718	S	S	*	*	H	α-helix	trans	-67.2	-29.6	-179.6	-74.4	-177.7	153.7	0	0	113.1	H12	E10-H12 PolarHBondContact O-N 3.34Å
11	S	66	Low	67.1	Low	78 Å²	78	135.5 Å²	135.5	55%	0.545	72%	0.722	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69.9	-16.8	178.6	70.7	0	0	0	0	114.4	L8 V9 S14	L8-S11 PolarHBondContact O-OG 3.22Å; V9-S11 VanDerWaalsContact C-N 3.3Å; V9-S11 PolarHBondContact O-N 3.28Å; S11-S14 PolarHBondContact O-OG 3.31Å
12	H	72.4	Confident	67.7	Low	143 Å²	143	128.8 Å²	128.8	66%	0.662	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.7	-19.6	-173.5	-164.5	59	0	0	0	113.9	V9 E10	V9-H12 PolarHBondContact O-N 3.38Å; E10-H12 PolarHBondContact O-N 3.34Å
13	W	65.9	Low	67.5	Low	178 Å²	178	127.4 Å²	127.4	67%	0.674	69%	0.693	S	S	*	*	G	3₁₀ helix	trans	-80.6	-13.1	-176.3	-71.7	101.6	0	0	0	114.4	D15 F16	W13-D15 VanDerWaalsContact C-N 3.25Å; W13-D15 PolarHBondContact O-N 3.5Å; W13-F16 HydrophobicContact CE3-CB 4.48Å; W13-F16 PolarHBondContact O-N 3.38Å
14	S	68.1	Low	67.1	Low	99 Å²	99	124.6 Å²	124.6	69%	0.692	68%	0.683	S	S	*	*	G	3₁₀ helix	trans	-71.6	-17.1	177.4	43.2	0	0	0	0	114.1	S11	S11-S14 PolarHBondContact O-OG 3.31Å
15	D	74.8	Confident	66.9	Low	125 Å²	125	124 Å²	124	67%	0.668	68%	0.684	S	S	*	*	G	3₁₀ helix	trans	-97.6	-3.1	-179.8	-66.8	-23.1	0	0	0	113.4	W13 Q17	W13-D15 VanDerWaalsContact C-N 3.25Å; W13-D15 PolarHBondContact O-N 3.5Å; D15-Q17 VanDerWaalsContact C-N 3.32Å; D15-Q17 PolarHBondContact O-N 2.88Å
16	F	75.3	Confident	66.9	Low	147 Å²	147	125.2 Å²	125.2	65%	0.645	69%	0.685	S	S	*	*			trans	-78.8	83.5	-179.5	-152.9	-94.1	0	0	0	110.8	W13 P18	W13-F16 HydrophobicContact CE3-CB 4.48Å; W13-F16 PolarHBondContact O-N 3.38Å; F16-P18 WeakPolarHBondContact O-CD 3.41Å
17	Q	77.2	Confident	67	Low	176 Å²	176	126.6 Å²	126.6	82%	0.822	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-66.8	119.7	164.7	-73.2	171.9	-68.2	0	0	108	D15	D15-Q17 VanDerWaalsContact C-N 3.32Å; D15-Q17 PolarHBondContact O-N 2.88Å
18	P	72	Confident	67.4	Low	102 Å²	102	133.2 Å²	133.2	66%	0.662	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-58.5	145	174	24.7	-32.5	0	0	0	109	F16	F16-P18 WeakPolarHBondContact O-CD 3.41Å
19	P	73.5	Confident	67.8	Low	104 Å²	104	134.6 Å²	134.6	68%	0.675	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-56.4	144.9	178.5	24.1	-33.2	0	0	0	109.7	S21	P19-S21 PolarHBondContact O-N 2.91Å; P19-S21 VanDerWaalsContact O-N 3.11Å
20	P	68.8	Low	67.8	Low	125 Å²	125	136.3 Å²	136.3	81%	0.812	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-54.5	124.4	179.9	22	-31.8	0	0	0	108.6	S22	P20-S22 PolarHBondContact O-N 3.11Å
21	S	68.2	Low	67.9	Low	114 Å²	114	134 Å²	134	80%	0.797	71%	0.706	S	S	*	*			trans	-60.2	108.8	174.9	50	0	0	0	0	107.2	P19 G23	P19-S21 PolarHBondContact O-N 2.91Å; P19-S21 VanDerWaalsContact O-N 3.11Å; S21-G23 PolarHBondContact O-N 2.72Å
22	S	64.3	Low	68.1	Low	103 Å²	103	133.1 Å²	133.1	72%	0.72	70%	0.699	S	S	*	*			trans	-59.9	96.3	162.4	53.2	0	0	0	0	105.3	P20 I24	P20-S22 PolarHBondContact O-N 3.11Å; S22-I24 PolarHBondContact O-N 2.77Å
23	G	56.8	Low	68.1	Low	61 Å²	61	137 Å²	137	63%	0.629	71%	0.707	S	S	*	*			trans	-69.7	53.8	-171.1	0	0	0	0	0	112.8	S21 I25	S21-G23 PolarHBondContact O-N 2.72Å; G23-I25 PolarHBondContact O-N 2.84Å
24	I	57.1	Low	68.5	Low	117 Å²	117	135.7 Å²	135.7	60%	0.6	71%	0.709	S	S	*	*			trans	-69.7	82.9	159.1	-49.6	-178.1	0	0	0	104.9	S22 Y26	S22-I24 PolarHBondContact O-N 2.77Å; I24-Y26 HydrophobicContact CG2-CE2 4.26Å; I24-Y26 WeakPolarHBondContact O-CD2 3.41Å; I24-Y26 PolarHBondContact O-N 2.83Å
25	I	61.8	Low	68.8	Low	149 Å²	149	139.7 Å²	139.7	76%	0.764	71%	0.708	S	S	*	*			trans	-62.2	94.4	166.1	-61.7	171.1	0	0	0	104.5	G23 K27	G23-I25 PolarHBondContact O-N 2.84Å; I25-K27 PolarHBondContact O-N 2.83Å
26	Y	66.9	Low	69.1	Low	198 Å²	198	136.9 Å²	136.9	78%	0.776	70%	0.696	S	S	*	*			trans	-58.5	100	159.7	-67.5	-84.2	0	0	0	105.1	I24 R28	I24-Y26 HydrophobicContact CG2-CE2 4.26Å; I24-Y26 WeakPolarHBondContact O-CD2 3.41Å; I24-Y26 PolarHBondContact O-N 2.83Å; Y26-R28 PolarHBondContact O-N 2.79Å
27	K	64.1	Low	69.6	Low	182 Å²	182	134.5 Å²	134.5	79%	0.791	69%	0.689	S	S	*	*			trans	-62.5	95	169.8	-159.7	-177.7	-164.3	-172.7	0	104.3	I25 E29	I25-K27 PolarHBondContact O-N 2.83Å; K27-E29 PolarHBondContact O-N 2.75Å
28	R	68.5	Low	70.1	Confident	219 Å²	219	128.4 Å²	128.4	83%	0.826	67%	0.666	S	S	*	*			trans	-62	98.6	170.2	179.6	-178.6	-71.2	-106	1.7	104.2	Y26 V30	Y26-R28 PolarHBondContact O-N 2.79Å; R28-V30 VanDerWaalsContact C-N 3.26Å; R28-V30 PolarHBondContact O-N 2.84Å
29	E	71.1	Confident	70.9	Confident	157 Å²	157	126.5 Å²	126.5	73%	0.734	66%	0.659	S	S	*	*			trans	-61.7	99.4	169.4	-69.3	-177.5	-179.8	0	0	105.6	K27 I31	K27-E29 PolarHBondContact O-N 2.75Å; E29-I31 PolarHBondContact O-N 2.84Å
30	V	68.8	Low	71.7	Confident	123 Å²	123	127 Å²	127	75%	0.745	66%	0.655	S	S	*	*			trans	-69.8	88.3	170	-179.9	0	0	0	0	105.1	R28 P32	R28-V30 VanDerWaalsContact C-N 3.26Å; R28-V30 PolarHBondContact O-N 2.84Å; V30-P32 VanDerWaalsContact O-CD 3.29Å; V30-P32 WeakPolarHBondContact O-CD 3.29Å; V30-P32 VanDerWaalsContact O-N 3.13Å
31	I	64.7	Low	72.9	Confident	114 Å²	114	126.1 Å²	126.1	59%	0.585	64%	0.643	S	S	*	*			trans	-58.1	117.3	172.4	-62.9	166.5	0	0	0	105.9	E29 R33 T36	E29-I31 PolarHBondContact O-N 2.84Å; I31-R33 PolarHBondContact O-N 3.21Å; I31-T36 HydrophobicContact CG2-CG2 3.86Å
32	P	70.2	Confident	74.1	Confident	60 Å²	60	126 Å²	126	39%	0.39	63%	0.632	S	S	.	*			trans	-64.5	126	-174.9	22	-30.1	0	0	0	109.4	V30 H34 R35	V30-P32 VanDerWaalsContact O-CD 3.29Å; V30-P32 WeakPolarHBondContact O-CD 3.29Å; V30-P32 VanDerWaalsContact O-N 3.13Å; P32-H34 PolarHBondContact O-N 3.44Å; P32-R35 HydrophobicContact CG-CB 4.39Å; P32-R35 HydrophobicContact CG-CG 3.92Å; P32-R35 PolarHBondContact O-N 3.05Å
33	R	72.4	Confident	75.5	Confident	224 Å²	224	122.4 Å²	122.4	85%	0.845	61%	0.612	S	S	*	*	H	α-helix	trans	-48.4	-26	-178.9	-171.4	176.1	-178.6	173	0.6	114.2	I31 T36 L37	I31-R33 PolarHBondContact O-N 3.21Å; R33-T36 PolarHBondContact O-OG1 3.17Å; R33-L37 PolarHBondContact O-N 3.09Å
34	H	73	Confident	77.3	Confident	151 Å²	151	124.5 Å²	124.5	70%	0.699	61%	0.608	S	S	*	*	H	α-helix	trans	-68.4	-37.8	175.3	-165.5	-73.3	0	0	0	113.1	P32 L37 S38	P32-H34 PolarHBondContact O-N 3.44Å; H34-L37 PolarHBondContact O-N 2.92Å; H34-S38 PolarHBondContact O-N 3.23Å; H34-S38 VanDerWaalsContact O-N 3.09Å; H34-S38 PolarHBondContact O-OG 2.89Å
35	R	76	Confident	79.2	Confident	183 Å²	183	120.6 Å²	120.6	69%	0.691	60%	0.596	S	S	*	*	H	α-helix	trans	-67.3	-36.2	178.6	-75	-175.8	-176.5	-178.9	-1	111.9	P32 S38 A39	P32-R35 HydrophobicContact CG-CB 4.39Å; P32-R35 HydrophobicContact CG-CG 3.92Å; P32-R35 PolarHBondContact O-N 3.05Å; R35-S38 PolarHBondContact O-OG 3.36Å; R35-A39 WeakPolarHBondContact O-CB 3.27Å; R35-A39 PolarHBondContact O-N 2.92Å
36	T	79.3	Confident	80.9	Confident	66 Å²	66	118.1 Å²	118.1	41%	0.405	58%	0.584	S	S	.	*	H	α-helix	trans	-71.1	-40.4	176.9	56.5	0	0	0	0	111.5	I31 R33 A39 L40	I31-T36 HydrophobicContact CG2-CG2 3.86Å; R33-T36 PolarHBondContact O-OG1 3.17Å; T36-A39 PolarHBondContact O-N 3.21Å; T36-L40 WeakPolarHBondContact O-CG 3.35Å; T36-L40 PolarHBondContact O-N 2.84Å
37	L	86.3	Confident	82.4	Confident	97 Å²	97	113.2 Å²	113.2	51%	0.508	57%	0.57	S	S	.	*	H	α-helix	trans	-63	-46.7	176.9	-179.3	63.8	0	0	0	111.7	R33 H34 A39 L40 L41	R33-L37 PolarHBondContact O-N 3.09Å; H34-L37 PolarHBondContact O-N 2.92Å; L37-A39 VanDerWaalsContact C-N 3.3Å; L37-A39 PolarHBondContact O-N 3.49Å; L37-L40 PolarHBondContact O-N 3.39Å; L37-L41 HydrophobicContact CD1-CD1 4.4Å; L37-L41 HydrophobicContact CD1-CG 4.33Å; L37-L41 HydrophobicContact CG-CD1 4.13Å; L37-L41 HydrophobicContact CG-CG 4.47Å; L37-L41 WeakPolarHBondContact O-CG 3.35Å; L37-L41 PolarHBondContact O-N 3.23Å
38	S	87.8	Confident	84	Confident	48 Å²	48	108.4 Å²	108.4	34%	0.336	56%	0.556	S	S	.	*	H	α-helix	trans	-60	-40.5	177.2	53.2	0	0	0	0	112.2	H34 R35 L41 I42	H34-S38 PolarHBondContact O-N 3.23Å; H34-S38 VanDerWaalsContact O-N 3.09Å; H34-S38 PolarHBondContact O-OG 2.89Å; R35-S38 PolarHBondContact O-OG 3.36Å; S38-L41 PolarHBondContact O-N 2.97Å; S38-I42 WeakPolarHBondContact O-CD1 3.39Å; S38-I42 VanDerWaalsContact O-CG1 3.25Å; S38-I42 WeakPolarHBondContact O-CG1 3.48Å; S38-I42 PolarHBondContact O-N 2.88Å
39	A	88.8	Confident	85.4	Confident	61 Å²	61	101.6 Å²	101.6	50%	0.504	54%	0.539	S	S	.	.	H	α-helix	trans	-64.1	-40.8	177.4	0	0	0	0	0	112.3	R35 T36 L37 G43	R35-A39 WeakPolarHBondContact O-CB 3.27Å; R35-A39 PolarHBondContact O-N 2.92Å; T36-A39 PolarHBondContact O-N 3.21Å; L37-A39 VanDerWaalsContact C-N 3.3Å; L37-A39 PolarHBondContact O-N 3.49Å; A39-G43 PolarHBondContact O-N 3.36Å
40	L	90.6	Very high	86.7	Confident	116 Å²	116	98.9 Å²	98.9	61%	0.607	53%	0.528	S	S	*	.	H	α-helix	trans	-65.6	-41.9	176.1	-69.5	173.4	0	0	0	112.1	T36 L37 G43 L44	T36-L40 WeakPolarHBondContact O-CG 3.35Å; T36-L40 PolarHBondContact O-N 2.84Å; L37-L40 PolarHBondContact O-N 3.39Å; L40-G43 PolarHBondContact O-N 2.99Å; L40-L44 WeakPolarHBondContact O-CB 3.42Å; L40-L44 VanDerWaalsContact O-CG 3.27Å; L40-L44 WeakPolarHBondContact O-CG 3.25Å; L40-L44 PolarHBondContact O-N 3.38Å
41	L	94.1	Very high	88.1	Confident	105 Å²	105	97.5 Å²	97.5	55%	0.55	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-42.2	178.4	-68	174.7	0	0	0	112.1	L37 S38 G45	L37-L41 HydrophobicContact CD1-CD1 4.4Å; L37-L41 HydrophobicContact CD1-CG 4.33Å; L37-L41 HydrophobicContact CG-CD1 4.13Å; L37-L41 HydrophobicContact CG-CG 4.47Å; L37-L41 WeakPolarHBondContact O-CG 3.35Å; L37-L41 PolarHBondContact O-N 3.23Å; S38-L41 PolarHBondContact O-N 2.97Å; L41-G45 PolarHBondContact O-N 3.42Å
42	I	93.5	Very high	89.7	Confident	111 Å²	111	96.8 Å²	96.8	57%	0.569	51%	0.513	S	S	*	.	H	α-helix	trans	-63.6	-45.9	175.1	-65.8	164.1	0	0	0	110.2	S38 L44 G45 I46	S38-I42 WeakPolarHBondContact O-CD1 3.39Å; S38-I42 VanDerWaalsContact O-CG1 3.25Å; S38-I42 WeakPolarHBondContact O-CG1 3.48Å; S38-I42 PolarHBondContact O-N 2.88Å; I42-L44 PolarHBondContact O-N 3.04Å; I42-G45 PolarHBondContact O-N 3.28Å; I42-I46 HydrophobicContact CG2-CD1 3.99Å; I42-I46 WeakPolarHBondContact O-CG1 3.33Å; I42-I46 PolarHBondContact O-N 2.94Å
43	G	93.4	Very high	91	Very high	29 Å²	29	98.8 Å²	98.8	30%	0.299	52%	0.52	S	S	.	.	H	α-helix	trans	-59.6	-45.9	177.5	0	0	0	0	0	112.8	A39 L40 G45 I46 I47	A39-G43 PolarHBondContact O-N 3.36Å; L40-G43 PolarHBondContact O-N 2.99Å; G43-G45 VanDerWaalsContact C-N 3.34Å; G43-G45 PolarHBondContact O-N 3.45Å; G43-I46 PolarHBondContact O-N 3.34Å; G43-I47 VanDerWaalsContact O-CG1 3.3Å; G43-I47 WeakPolarHBondContact O-CG1 3.26Å; G43-I47 PolarHBondContact O-N 3Å
44	L	95.6	Very high	92.3	Very high	105 Å²	105	93.7 Å²	93.7	55%	0.55	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-41.5	174.1	-72.3	171.6	0	0	0	111.9	L40 I42 I46 I47 V48	L40-L44 WeakPolarHBondContact O-CB 3.42Å; L40-L44 VanDerWaalsContact O-CG 3.27Å; L40-L44 WeakPolarHBondContact O-CG 3.25Å; L40-L44 PolarHBondContact O-N 3.38Å; I42-L44 PolarHBondContact O-N 3.04Å; L44-I46 PolarHBondContact O-N 2.88Å; L44-I47 PolarHBondContact O-N 3.5Å; L44-V48 WeakPolarHBondContact O-CB 3.45Å; L44-V48 VanDerWaalsContact O-CG2 3.26Å; L44-V48 WeakPolarHBondContact O-CG2 3.3Å; L44-V48 PolarHBondContact O-N 3.2Å
45	G	96	Very high	93.5	Very high	34 Å²	34	89.4 Å²	89.4	35%	0.351	49%	0.493	S	S	.	.	H	α-helix	trans	-61.2	-42.7	176.3	0	0	0	0	0	113	L41 I42 G43 T49	L41-G45 PolarHBondContact O-N 3.42Å; I42-G45 PolarHBondContact O-N 3.28Å; G43-G45 VanDerWaalsContact C-N 3.34Å; G43-G45 PolarHBondContact O-N 3.45Å; G45-T49 WeakPolarHBondContact O-CB 3.36Å; G45-T49 PolarHBondContact O-N 3.31Å; G45-T49 PolarHBondContact O-OG1 2.89Å
46	I	97.5	Very high	94.5	Very high	98 Å²	98	85.8 Å²	85.8	50%	0.503	49%	0.487	S	S	.	.	H	α-helix	trans	-62.8	-49.5	175	-66.6	166.3	0	0	0	110.1	I42 G43 L44 V48 T49 L50	I42-I46 HydrophobicContact CG2-CD1 3.99Å; I42-I46 WeakPolarHBondContact O-CG1 3.33Å; I42-I46 PolarHBondContact O-N 2.94Å; G43-I46 PolarHBondContact O-N 3.34Å; L44-I46 PolarHBondContact O-N 2.88Å; I46-V48 PolarHBondContact O-N 2.93Å; I46-T49 PolarHBondContact O-N 3.5Å; I46-L50 HydrophobicContact CG2-CD1 4.21Å; I46-L50 HydrophobicContact CG2-CG 4.36Å; I46-L50 WeakPolarHBondContact O-CG 3.31Å; I46-L50 PolarHBondContact O-N 3.49Å
47	I	97.7	Very high	95.4	Very high	95 Å²	95	85.1 Å²	85.1	49%	0.487	49%	0.485	S	S	.	.	H	α-helix	trans	-58.6	-46.8	179.4	-67.8	165.9	0	0	0	111.1	G43 L44 T49 L50 I51	G43-I47 VanDerWaalsContact O-CG1 3.3Å; G43-I47 WeakPolarHBondContact O-CG1 3.26Å; G43-I47 PolarHBondContact O-N 3Å; L44-I47 PolarHBondContact O-N 3.5Å; I47-T49 VanDerWaalsContact C-N 3.33Å; I47-T49 PolarHBondContact O-N 3.34Å; I47-L50 PolarHBondContact O-N 2.95Å; I47-I51 HydrophobicContact CG2-CD1 3.86Å; I47-I51 WeakPolarHBondContact O-CG1 3.44Å; I47-I51 PolarHBondContact O-N 3.48Å
48	V	98.2	Very high	95.9	Very high	81 Å²	81	87.8 Å²	87.8	49%	0.491	49%	0.489	S	S	.	.	H	α-helix	trans	-61.2	-43	177.4	169.7	0	0	0	0	110.9	L44 I46 L50 I51 L52	L44-V48 WeakPolarHBondContact O-CB 3.45Å; L44-V48 VanDerWaalsContact O-CG2 3.26Å; L44-V48 WeakPolarHBondContact O-CG2 3.3Å; L44-V48 PolarHBondContact O-N 3.2Å; I46-V48 PolarHBondContact O-N 2.93Å; V48-L50 PolarHBondContact O-N 2.72Å; V48-I51 PolarHBondContact O-N 3.18Å; V48-L52 HydrophobicContact CG1-CD1 4.07Å; V48-L52 HydrophobicContact CG1-CG 4.41Å; V48-L52 VanDerWaalsContact O-CG 3.3Å; V48-L52 WeakPolarHBondContact O-CG 3.3Å; V48-L52 PolarHBondContact O-N 2.87Å
49	T	98.3	Very high	96.4	Very high	76 Å²	76	91.5 Å²	91.5	47%	0.466	50%	0.5	S	S	.	.	H	α-helix	trans	-63.2	-43.3	177.6	-54.3	0	0	0	0	111.4	G45 I46 I47 I51 L52 L53	G45-T49 WeakPolarHBondContact O-CB 3.36Å; G45-T49 PolarHBondContact O-N 3.31Å; G45-T49 PolarHBondContact O-OG1 2.89Å; I46-T49 PolarHBondContact O-N 3.5Å; I47-T49 VanDerWaalsContact C-N 3.33Å; I47-T49 PolarHBondContact O-N 3.34Å; T49-I51 PolarHBondContact O-N 2.94Å; T49-L52 PolarHBondContact O-N 2.94Å; T49-L53 HydrophobicContact CG2-CD1 4.4Å; T49-L53 VanDerWaalsContact O-CG 3.31Å; T49-L53 WeakPolarHBondContact O-CG 3.3Å; T49-L53 PolarHBondContact O-N 3.3Å
50	L	97.9	Very high	96.8	Very high	99 Å²	99	95.1 Å²	95.1	52%	0.518	51%	0.508	S	S	.	.	H	α-helix	trans	-62.7	-42.5	176	-66.4	-179.6	0	0	0	111.9	I46 I47 V48 L52 L53 L54	I46-L50 HydrophobicContact CG2-CD1 4.21Å; I46-L50 HydrophobicContact CG2-CG 4.36Å; I46-L50 WeakPolarHBondContact O-CG 3.31Å; I46-L50 PolarHBondContact O-N 3.49Å; I47-L50 PolarHBondContact O-N 2.95Å; V48-L50 PolarHBondContact O-N 2.72Å; L50-L52 VanDerWaalsContact C-N 3.35Å; L50-L53 PolarHBondContact O-N 2.91Å; L50-L54 VanDerWaalsContact O-CG 3.3Å; L50-L54 WeakPolarHBondContact O-CG 3.29Å; L50-L54 PolarHBondContact O-N 3.29Å
51	I	98.5	Very high	97.1	Very high	94 Å²	94	96.1 Å²	96.1	48%	0.482	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-45.5	175.4	-69.1	168.1	0	0	0	110.3	I47 V48 T49 L53 L54 V55	I47-I51 HydrophobicContact CG2-CD1 3.86Å; I47-I51 WeakPolarHBondContact O-CG1 3.44Å; I47-I51 PolarHBondContact O-N 3.48Å; V48-I51 PolarHBondContact O-N 3.18Å; T49-I51 PolarHBondContact O-N 2.94Å; I51-L53 VanDerWaalsContact C-N 3.34Å; I51-L53 PolarHBondContact O-N 2.94Å; I51-L54 PolarHBondContact O-N 2.98Å; I51-V55 HydrophobicContact CG2-CG2 4.29Å; I51-V55 WeakPolarHBondContact O-CB 3.38Å; I51-V55 VanDerWaalsContact O-CG2 3.25Å; I51-V55 WeakPolarHBondContact O-CG2 3.48Å; I51-V55 PolarHBondContact O-N 2.9Å
52	L	98.3	Very high	97.1	Very high	99 Å²	99	93.9 Å²	93.9	52%	0.518	50%	0.5	S	S	.	.	H	α-helix	trans	-61.2	-41.9	177	-71.1	174.1	0	0	0	111.8	V48 T49 L50 V55 L56	V48-L52 HydrophobicContact CG1-CD1 4.07Å; V48-L52 HydrophobicContact CG1-CG 4.41Å; V48-L52 VanDerWaalsContact O-CG 3.3Å; V48-L52 WeakPolarHBondContact O-CG 3.3Å; V48-L52 PolarHBondContact O-N 2.87Å; T49-L52 PolarHBondContact O-N 2.94Å; L50-L52 VanDerWaalsContact C-N 3.35Å; L52-V55 PolarHBondContact O-N 3.36Å; L52-L56 WeakPolarHBondContact O-CB 3.25Å; L52-L56 WeakPolarHBondContact O-CG 3.45Å; L52-L56 PolarHBondContact O-N 2.87Å
53	L	98.2	Very high	97.1	Very high	102 Å²	102	95.2 Å²	95.2	53%	0.534	50%	0.498	S	S	.	.	H	α-helix	trans	-64.3	-39.9	176.4	-69.8	176.6	0	0	0	112.5	T49 L50 I51 L56 S57	T49-L53 HydrophobicContact CG2-CD1 4.4Å; T49-L53 VanDerWaalsContact O-CG 3.31Å; T49-L53 WeakPolarHBondContact O-CG 3.3Å; T49-L53 PolarHBondContact O-N 3.3Å; L50-L53 PolarHBondContact O-N 2.91Å; I51-L53 VanDerWaalsContact C-N 3.34Å; I51-L53 PolarHBondContact O-N 2.94Å; L53-L56 PolarHBondContact O-N 3.32Å; L53-S57 WeakPolarHBondContact O-CB 3.16Å; L53-S57 PolarHBondContact O-N 3.44Å; L53-S57 PolarHBondContact O-OG 2.85Å
54	L	98.3	Very high	97.1	Very high	117 Å²	117	97.3 Å²	97.3	61%	0.613	51%	0.508	S	S	*	.	H	α-helix	trans	-67	-39.6	175.4	-70.3	174.1	0	0	0	112.1	L50 I51 S57 Y58	L50-L54 VanDerWaalsContact O-CG 3.3Å; L50-L54 WeakPolarHBondContact O-CG 3.29Å; L50-L54 PolarHBondContact O-N 3.29Å; I51-L54 PolarHBondContact O-N 2.98Å; L54-S57 PolarHBondContact O-OG 3.35Å; L54-Y58 VanDerWaalsContact O-CB 3.29Å; L54-Y58 WeakPolarHBondContact O-CB 3.39Å; L54-Y58 PolarHBondContact O-N 3.27Å
55	V	98.6	Very high	96.8	Very high	61 Å²	61	96.5 Å²	96.5	37%	0.37	51%	0.508	S	S	.	.	H	α-helix	trans	-65.3	-46.2	175.7	169.5	0	0	0	0	110.1	I51 L52 Y58 F59	I51-V55 HydrophobicContact CG2-CG2 4.29Å; I51-V55 WeakPolarHBondContact O-CB 3.38Å; I51-V55 VanDerWaalsContact O-CG2 3.25Å; I51-V55 WeakPolarHBondContact O-CG2 3.48Å; I51-V55 PolarHBondContact O-N 2.9Å; L52-V55 PolarHBondContact O-N 3.36Å; V55-Y58 WeakPolarHBondContact O-CB 3.21Å; V55-Y58 PolarHBondContact O-N 3.29Å; V55-F59 HydrophobicContact CG1-CD2 3.57Å; V55-F59 HydrophobicContact CG1-CE2 3.45Å; V55-F59 VanDerWaalsContact CG1-CE2 3.45Å; V55-F59 WeakPolarHBondContact O-CD2 3.35Å; V55-F59 PolarHBondContact O-N 2.95Å
56	L	98.1	Very high	96.3	Very high	107 Å²	107	99 Å²	99	56%	0.56	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-42.6	177.1	-71.8	173	0	0	0	111.9	L52 L53 Y58 F59 M60	L52-L56 WeakPolarHBondContact O-CB 3.25Å; L52-L56 WeakPolarHBondContact O-CG 3.45Å; L52-L56 PolarHBondContact O-N 2.87Å; L53-L56 PolarHBondContact O-N 3.32Å; L56-Y58 VanDerWaalsContact C-N 3.35Å; L56-F59 PolarHBondContact O-N 3.26Å; L56-M60 WeakPolarHBondContact O-CB 3.47Å; L56-M60 VanDerWaalsContact O-CG 3.28Å; L56-M60 WeakPolarHBondContact O-CG 3.28Å; L56-M60 PolarHBondContact O-N 3.5Å
57	S	97.3	Very high	95.7	Very high	53 Å²	53	99.4 Å²	99.4	37%	0.371	52%	0.516	S	S	.	.	H	α-helix	trans	-64.8	-40.6	176.6	72.7	0	0	0	0	111.6	L53 L54 M60 H61	L53-S57 WeakPolarHBondContact O-CB 3.16Å; L53-S57 PolarHBondContact O-N 3.44Å; L53-S57 PolarHBondContact O-OG 2.85Å; L54-S57 PolarHBondContact O-OG 3.35Å; S57-M60 PolarHBondContact O-N 2.91Å; S57-H61 WeakPolarHBondContact O-CB 3.47Å; S57-H61 PolarHBondContact O-CD2 2.98Å; S57-H61 VanDerWaalsContact O-CD2 3.27Å; S57-H61 PolarHBondContact O-N 2.91Å
58	Y	97.9	Very high	94.8	Very high	153 Å²	153	98.7 Å²	98.7	60%	0.6	52%	0.519	S	S	*	.	H	α-helix	trans	-58.8	-50.4	173.2	175.2	-101.8	0	0	0	111.6	L54 V55 L56 M60 H61 V62	L54-Y58 VanDerWaalsContact O-CB 3.29Å; L54-Y58 WeakPolarHBondContact O-CB 3.39Å; L54-Y58 PolarHBondContact O-N 3.27Å; V55-Y58 WeakPolarHBondContact O-CB 3.21Å; V55-Y58 PolarHBondContact O-N 3.29Å; L56-Y58 VanDerWaalsContact C-N 3.35Å; Y58-M60 VanDerWaalsContact C-N 3.35Å; Y58-M60 PolarHBondContact O-N 3.46Å; Y58-H61 PolarHBondContact O-N 3.47Å; Y58-V62 HydrophobicContact CD1-CG2 4.33Å; Y58-V62 HydrophobicContact CD2-CG2 4.26Å; Y58-V62 HydrophobicContact CE1-CG2 3.93Å; Y58-V62 HydrophobicContact CE2-CG2 3.86Å; Y58-V62 HydrophobicContact CG-CG2 4.48Å; Y58-V62 VanDerWaalsContact O-CG2 3.31Å; Y58-V62 WeakPolarHBondContact O-CG2 3.31Å; Y58-V62 PolarHBondContact O-N 3.48Å
59	F	98.1	Very high	93.5	Very high	125 Å²	125	101.5 Å²	101.5	55%	0.548	53%	0.527	S	S	.	.	H	α-helix	trans	-60.8	-41.4	177.6	-84.1	-68.9	0	0	0	112.6	V55 L56 V62 Y63	V55-F59 HydrophobicContact CG1-CD2 3.57Å; V55-F59 HydrophobicContact CG1-CE2 3.45Å; V55-F59 VanDerWaalsContact CG1-CE2 3.45Å; V55-F59 WeakPolarHBondContact O-CD2 3.35Å; V55-F59 PolarHBondContact O-N 2.95Å; L56-F59 PolarHBondContact O-N 3.26Å; F59-V62 PolarHBondContact O-N 2.84Å; F59-Y63 VanDerWaalsContact O-CB 3.29Å; F59-Y63 WeakPolarHBondContact O-CB 3.36Å; F59-Y63 PolarHBondContact O-N 3.42Å
60	M	96.6	Very high	92.2	Very high	138 Å²	138	103.2 Å²	103.2	68%	0.68	53%	0.532	S	S	*	.	H	α-helix	trans	-65.3	-40.9	176.8	-71.6	-61.3	-130.1	0	0	112.3	L56 S57 Y58 Y63 S64	L56-M60 WeakPolarHBondContact O-CB 3.47Å; L56-M60 VanDerWaalsContact O-CG 3.28Å; L56-M60 WeakPolarHBondContact O-CG 3.28Å; L56-M60 PolarHBondContact O-N 3.5Å; S57-M60 PolarHBondContact O-N 2.91Å; Y58-M60 VanDerWaalsContact C-N 3.35Å; Y58-M60 PolarHBondContact O-N 3.46Å; M60-Y63 PolarHBondContact O-N 3.27Å; M60-S64 WeakPolarHBondContact O-CB 3.41Å; M60-S64 PolarHBondContact O-N 2.91Å
61	H	96.6	Very high	90.9	Very high	137 Å²	137	102 Å²	102	63%	0.634	53%	0.526	S	S	*	.	H	α-helix	trans	-63.5	-46.7	173.9	-89.1	-70.6	0	0	0	111.8	S57 Y58 Y63 S64 V65	S57-H61 WeakPolarHBondContact O-CB 3.47Å; S57-H61 PolarHBondContact O-CD2 2.98Å; S57-H61 VanDerWaalsContact O-CD2 3.27Å; S57-H61 PolarHBondContact O-N 2.91Å; Y58-H61 PolarHBondContact O-N 3.47Å; H61-Y63 VanDerWaalsContact C-N 3.34Å; H61-Y63 PolarHBondContact O-N 3.37Å; H61-S64 PolarHBondContact O-N 2.92Å; H61-V65 WeakPolarHBondContact O-CG2 3.46Å; H61-V65 PolarHBondContact O-N 3.37Å
62	V	94.9	Very high	89.6	Confident	58 Å²	58	104.6 Å²	104.6	35%	0.352	54%	0.538	S	S	.	.	H	α-helix	trans	-60.2	-45.3	176.8	171	0	0	0	0	110.7	Y58 F59 S64 V65 V66	Y58-V62 HydrophobicContact CD1-CG2 4.33Å; Y58-V62 HydrophobicContact CD2-CG2 4.26Å; Y58-V62 HydrophobicContact CE1-CG2 3.93Å; Y58-V62 HydrophobicContact CE2-CG2 3.86Å; Y58-V62 HydrophobicContact CG-CG2 4.48Å; Y58-V62 VanDerWaalsContact O-CG2 3.31Å; Y58-V62 WeakPolarHBondContact O-CG2 3.31Å; Y58-V62 PolarHBondContact O-N 3.48Å; F59-V62 PolarHBondContact O-N 2.84Å; V62-S64 PolarHBondContact O-N 3.41Å; V62-V65 PolarHBondContact O-N 2.87Å; V62-V66 HydrophobicContact CG1-CG2 4.42Å; V62-V66 WeakPolarHBondContact O-CG2 3.32Å; V62-V66 PolarHBondContact O-N 2.88Å
63	Y	93.3	Very high	88.1	Confident	138 Å²	138	105.8 Å²	105.8	54%	0.541	54%	0.541	S	S	.	.	H	α-helix	trans	-60.2	-46.5	176.9	-176.6	-101.3	0	0	0	111.6	F59 M60 H61 V65 V66 H67	F59-Y63 VanDerWaalsContact O-CB 3.29Å; F59-Y63 WeakPolarHBondContact O-CB 3.36Å; F59-Y63 PolarHBondContact O-N 3.42Å; M60-Y63 PolarHBondContact O-N 3.27Å; H61-Y63 VanDerWaalsContact C-N 3.34Å; H61-Y63 PolarHBondContact O-N 3.37Å; Y63-V65 VanDerWaalsContact C-N 3.35Å; Y63-V65 PolarHBondContact O-N 3.3Å; Y63-V66 PolarHBondContact O-N 3.01Å; Y63-H67 AromaticContact CE2-CE1 3.97Å; Y63-H67 AromaticContact CE2-ND1 3.71Å; Y63-H67 AromaticContact CZ-CE1 3.96Å; Y63-H67 AromaticContact CZ-ND1 3.78Å; Y63-H67 WeakPolarHBondContact O-CB 3.29Å; Y63-H67 PolarHBondContact O-N 3.25Å
64	S	92.4	Very high	86.9	Confident	73 Å²	73	106.8 Å²	106.8	51%	0.51	55%	0.547	S	S	.	.	H	α-helix	trans	-60.3	-42.5	177.2	-176.1	0	0	0	0	112.3	M60 H61 V62 S68	M60-S64 WeakPolarHBondContact O-CB 3.41Å; M60-S64 PolarHBondContact O-N 2.91Å; H61-S64 PolarHBondContact O-N 2.92Å; V62-S64 PolarHBondContact O-N 3.41Å; S64-S68 VanDerWaalsContact O-CB 3.28Å; S64-S68 WeakPolarHBondContact O-CB 3.28Å; S64-S68 PolarHBondContact O-N 3.36Å; S64-S68 PolarHBondContact O-OG 2.89Å
65	V	89.5	Confident	85.9	Confident	88 Å²	88	105 Å²	105	53%	0.533	54%	0.541	S	S	.	.	H	α-helix	trans	-62.7	-49.7	177.5	171.2	0	0	0	0	109.9	H61 V62 Y63 H67 S68 H69	H61-V65 WeakPolarHBondContact O-CG2 3.46Å; H61-V65 PolarHBondContact O-N 3.37Å; V62-V65 PolarHBondContact O-N 2.87Å; Y63-V65 VanDerWaalsContact C-N 3.35Å; Y63-V65 PolarHBondContact O-N 3.3Å; V65-H67 PolarHBondContact O-N 3.43Å; V65-S68 PolarHBondContact O-N 3.43Å; V65-S68 PolarHBondContact O-OG 3.31Å; V65-H69 PolarHBondContact O-CD2 3.14Å; V65-H69 VanDerWaalsContact O-CD2 3.25Å
66	V	85.3	Confident	85.3	Confident	87 Å²	87	103.2 Å²	103.2	53%	0.527	53%	0.529	S	S	.	.	H	α-helix	trans	-63.8	-40	-178.4	173.7	0	0	0	0	112.3	V62 Y63	V62-V66 HydrophobicContact CG1-CG2 4.42Å; V62-V66 WeakPolarHBondContact O-CG2 3.32Å; V62-V66 PolarHBondContact O-N 2.88Å; Y63-V66 PolarHBondContact O-N 3.01Å
67	H	84.9	Confident	84.9	Confident	106 Å²	106	100.8 Å²	100.8	49%	0.491	52%	0.517	S	S	.	.	H	α-helix	trans	-80.7	-21.5	-179.1	-108.5	66.4	0	0	0	114.5	Y63 V65 H69	Y63-H67 AromaticContact CE2-CE1 3.97Å; Y63-H67 AromaticContact CE2-ND1 3.71Å; Y63-H67 AromaticContact CZ-CE1 3.96Å; Y63-H67 AromaticContact CZ-ND1 3.78Å; Y63-H67 WeakPolarHBondContact O-CB 3.29Å; Y63-H67 PolarHBondContact O-N 3.25Å; V65-H67 PolarHBondContact O-N 3.43Å; H67-H69 PolarHBondContact O-N 3.4Å; H67-H69 VanDerWaalsContact O-N 3.14Å
68	S	80.6	Confident	84.7	Confident	81 Å²	81	102.8 Å²	102.8	57%	0.566	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-13.9	179.5	66.6	0	0	0	0	114.3	S64 V65	S64-S68 VanDerWaalsContact O-CB 3.28Å; S64-S68 WeakPolarHBondContact O-CB 3.28Å; S64-S68 PolarHBondContact O-N 3.36Å; S64-S68 PolarHBondContact O-OG 2.89Å; V65-S68 PolarHBondContact O-N 3.43Å; V65-S68 PolarHBondContact O-OG 3.31Å
69	H	69.4	Low	84.6	Confident	140 Å²	140	97.8 Å²	97.8	65%	0.648	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.8	-0.6	-171.6	-70.5	-64.7	0	0	0	115.8	V65 H67 N71	V65-H69 PolarHBondContact O-CD2 3.14Å; V65-H69 VanDerWaalsContact O-CD2 3.25Å; H67-H69 PolarHBondContact O-N 3.4Å; H67-H69 VanDerWaalsContact O-N 3.14Å; H69-N71 PolarHBondContact O-N 3.32Å
70	I	70.9	Confident	84.5	Confident	111 Å²	111	91.9 Å²	91.9	57%	0.569	49%	0.485	S	S	*	.			trans	-95.5	87.6	-176.1	-52.8	177.8	0	0	0	109.9
71	N	72.3	Confident	84.3	Confident	75 Å²	75	89.7 Å²	89.7	40%	0.401	48%	0.476	S	S	.	.			trans	-84.2	136.1	158.4	-177.2	-5.5	0	0	0	108.8	H69 Q73 D74	H69-N71 PolarHBondContact O-N 3.32Å; N71-Q73 PolarHBondContact ND2-OE1 3.22Å; N71-Q73 PolarHBondContact O-N 3.46Å; N71-Q73 VanDerWaalsContact O-N 3.16Å; N71-Q73 PolarHBondContact OD1-N 3.28Å; N71-Q73 VanDerWaalsContact OD1-N 3.15Å; N71-D74 PolarHBondContact O-N 3.08Å; N71-D74 VanDerWaalsContact O-N 3.08Å
72	M	69.2	Low	84.3	Confident	147 Å²	147	86 Å²	86	72%	0.724	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	-32.1	177	-67.3	-162.3	-172.6	0	0	112.6	T75 I132	M72-T75 PolarHBondContact O-OG1 3.16Å; M72-I132 HydrophobicContact CB-CD1 4.46Å
73	Q	68.2	Low	84.4	Confident	124 Å²	124	87.7 Å²	87.7	58%	0.579	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.4	-31.2	178.8	-71.8	168	-26.2	0	0	113.2	N71 T75 L76	N71-Q73 PolarHBondContact ND2-OE1 3.22Å; N71-Q73 PolarHBondContact O-N 3.46Å; N71-Q73 VanDerWaalsContact O-N 3.16Å; N71-Q73 PolarHBondContact OD1-N 3.28Å; N71-Q73 VanDerWaalsContact OD1-N 3.15Å; Q73-T75 PolarHBondContact O-N 3.01Å; Q73-L76 PolarHBondContact O-N 3.43Å
74	D	72.1	Confident	84.6	Confident	124 Å²	124	85 Å²	85	66%	0.663	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.3	-22.8	-177.7	-69.1	-18.7	0	0	0	112.2	N71	N71-D74 PolarHBondContact O-N 3.08Å; N71-D74 VanDerWaalsContact O-N 3.08Å
75	T	77.9	Confident	84.9	Confident	80 Å²	80	85 Å²	85	49%	0.491	46%	0.456	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.2	-13.1	178.2	67	0	0	0	0	113.7	M72 Q73	M72-T75 PolarHBondContact O-OG1 3.16Å; Q73-T75 PolarHBondContact O-N 3.01Å
76	L	85.3	Confident	85.3	Confident	22 Å²	22	84.1 Å²	84.1	12%	0.115	45%	0.45	C	S	.	.	S	Bend	trans	-84.2	132.6	-176.2	-172	66.3	0	0	0	109.7	Q73 P78 C80 L81 C130 I132	Q73-L76 PolarHBondContact O-N 3.43Å; L76-P78 WeakPolarHBondContact O-CD 3.4Å; L76-C80 HydrophobicContact CD1-CB 4.11Å; L76-C80 HydrophobicContact CD2-CB 4.35Å; L76-C80 HydrophobicContact CG-CB 4.13Å; L76-L81 HydrophobicContact CD2-CD2 3.61Å; L76-L81 HydrophobicContact CD2-CG 4.06Å; L76-C130 WeakPolarHBondContact CD1-O 3.23Å; L76-I132 HydrophobicContact CD1-CG1 4.27Å
77	N	91.3	Very high	85.8	Confident	57 Å²	57	81.1 Å²	81.1	31%	0.305	44%	0.438	S	S	.	.			trans	-57.7	125.8	173.1	-178.9	-22	0	0	0	109.5	I79 C80 V129	N77-I79 PolarHBondContact O-N 3.15Å; N77-I79 WeakPolarHBondContact OD1-CB 3.28Å; N77-I79 WeakPolarHBondContact OD1-CG1 3.43Å; N77-I79 PolarHBondContact OD1-N 3.05Å; N77-C80 VanDerWaalsContact O-CB 3.28Å; N77-C80 WeakPolarHBondContact O-CB 2.91Å; N77-C80 PolarHBondContact O-N 3.22Å; N77-C80 PolarHBondContact O-SG 3.49Å; N77-V129 WeakPolarHBondContact ND2-CG1 3.43Å
78	P	92.6	Very high	86.4	Confident	94 Å²	94	84.5 Å²	84.5	61%	0.61	45%	0.451	S	S	*	.	G	3₁₀ helix	trans	-54.1	-28.7	-178.9	-28.3	34.9	0	0	0	114.5	L76 C80 L81	L76-P78 WeakPolarHBondContact O-CD 3.4Å; P78-C80 PolarHBondContact O-N 3.14Å; P78-L81 WeakPolarHBondContact O-CB 3.35Å; P78-L81 PolarHBondContact O-N 3.43Å
79	I	95.1	Very high	87.3	Confident	49 Å²	49	83.3 Å²	83.3	25%	0.251	44%	0.442	S	S	.	.	G	3₁₀ helix	trans	-54.9	-37.3	174.7	-69.6	170.3	0	0	0	111.1	N77 L81 L82 E117 N118 F120	N77-I79 PolarHBondContact O-N 3.15Å; N77-I79 WeakPolarHBondContact OD1-CB 3.28Å; N77-I79 WeakPolarHBondContact OD1-CG1 3.43Å; N77-I79 PolarHBondContact OD1-N 3.05Å; I79-L81 PolarHBondContact O-N 2.89Å; I79-L82 VanDerWaalsContact O-CB 3.24Å; I79-L82 WeakPolarHBondContact O-CB 3.03Å; I79-L82 WeakPolarHBondContact O-CG 3.33Å; I79-L82 PolarHBondContact O-N 3.01Å; I79-L82 VanDerWaalsContact O-N 3.08Å; I79-E117 HydrophobicContact CB-CB 4.15Å; I79-E117 HydrophobicContact CD1-CB 3.85Å; I79-E117 HydrophobicContact CD1-CG 4.27Å; I79-E117 HydrophobicContact CG1-CB 3.72Å; I79-E117 HydrophobicContact CG1-CG 4.31Å; I79-E117 HydrophobicContact CG2-CB 3.45Å; I79-E117 VanDerWaalsContact CG2-CB 3.45Å; I79-E117 VanDerWaalsContact CG2-O 3.28Å; I79-E117 WeakPolarHBondContact CG2-O 3.37Å; I79-N118 HydrophobicContact CG2-CB 4.48Å; I79-N118 WeakPolarHBondContact O-CB 3.42Å; I79-F120 HydrophobicContact CG2-CZ 4.21Å
80	C	95.4	Very high	88.6	Confident	0 Å²	0	88.7 Å²	88.7	0%	0	46%	0.456	C	S	.	.	G	3₁₀ helix	trans	-76.7	-10	-176	-47.4	0	0	0	0	112.7	L76 N77 P78 W98 C130	L76-C80 HydrophobicContact CD1-CB 4.11Å; L76-C80 HydrophobicContact CD2-CB 4.35Å; L76-C80 HydrophobicContact CG-CB 4.13Å; N77-C80 VanDerWaalsContact O-CB 3.28Å; N77-C80 WeakPolarHBondContact O-CB 2.91Å; N77-C80 PolarHBondContact O-N 3.22Å; N77-C80 PolarHBondContact O-SG 3.49Å; P78-C80 PolarHBondContact O-N 3.14Å; C80-W98 HydrophobicContact CB-CB 4.03Å; C80-W98 HydrophobicContact CB-CG 3.92Å; C80-W98 VanDerWaalsContact O-CD1 3.29Å; C80-C130 HydrophobicContact CB-CB 3.61Å; C80-C130 WeakPolarHBondContact CB-SG 3.22Å; C80-C130 WeakPolarHBondContact SG-CA 3.28Å; C80-C130 WeakPolarHBondContact SG-CB 3.04Å; C80-C130 CovalentContact SG-SG 2.02Å; C80-C130 PolarHBondContact SG-SG 2.02Å
81	L	93.9	Very high	89.9	Confident	93 Å²	93	85.4 Å²	85.4	49%	0.487	45%	0.446	S	S	.	.	G	3₁₀ helix	trans	-87.1	-12.4	170.6	-62.1	173.5	0	0	0	112.2	L76 P78 I79	L76-L81 HydrophobicContact CD2-CD2 3.61Å; L76-L81 HydrophobicContact CD2-CG 4.06Å; P78-L81 WeakPolarHBondContact O-CB 3.35Å; P78-L81 PolarHBondContact O-N 3.43Å; I79-L81 PolarHBondContact O-N 2.89Å
82	L	96.8	Very high	91.1	Very high	59 Å²	59	86 Å²	86	31%	0.309	46%	0.456	S	S	.	.	S	Bend	trans	-71.7	147.7	177.4	-58.3	173.9	0	0	0	110.6	I79 N116 E117 N118	I79-L82 VanDerWaalsContact O-CB 3.24Å; I79-L82 WeakPolarHBondContact O-CB 3.03Å; I79-L82 WeakPolarHBondContact O-CG 3.33Å; I79-L82 PolarHBondContact O-N 3.01Å; I79-L82 VanDerWaalsContact O-N 3.08Å; L82-N116 HydrophobicContact CD1-CB 4.36Å; L82-E117 HydrophobicContact CD1-CB 4.37Å; L82-E117 WeakPolarHBondContact CD1-OE2 3.48Å; L82-N118 HydrophobicContact CB-CB 4.11Å; L82-N118 PolarHBondContact O-ND2 3.39Å
83	P	96.7	Very high	92.5	Very high	94 Å²	94	83.9 Å²	83.9	61%	0.61	44%	0.443	S	S	*	.	P	Polyproline II helix	trans	-68	148.3	174.9	29.2	-35.2	0	0	0	111.1	L85 N116	P83-L85 PolarHBondContact O-N 3.41Å; P83-N116 PolarHBondContact O-ND2 3.28Å; P83-N116 PolarHBondContact O-OD1 3.46Å
84	R	97.6	Very high	93.9	Very high	81 Å²	81	82.3 Å²	82.3	31%	0.306	44%	0.439	S	S	.	.	P	Polyproline II helix	trans	-68.5	123	169.1	-61.6	-174.9	-63.2	-86.9	15	109.4	W98 E106 F108	R84-W98 PolarHBondContact NH1-O 3.33Å; R84-E106 IonicContact CZ-OE2 3.64Å; R84-E106 IonicContact NH1-OE2 3.83Å; R84-E106 IonicContact NH2-OE2 3.4Å; R84-E106 PolarHBondContact NH2-OE2 3.04Å; R84-F108 HydrophobicContact CB-CD1 4.16Å; R84-F108 HydrophobicContact CB-CD2 4.15Å; R84-F108 HydrophobicContact CB-CE1 4.27Å; R84-F108 HydrophobicContact CB-CE2 4.3Å; R84-F108 HydrophobicContact CB-CG 4.08Å; R84-F108 HydrophobicContact CB-CZ 4.34Å; R84-F108 HydrophobicContact CG-CD1 4.21Å; R84-F108 HydrophobicContact CG-CE1 4.34Å
85	L	97.6	Very high	95.2	Very high	73 Å²	73	79.2 Å²	79.2	38%	0.382	42%	0.417	S	S	.	.			trans	-116	114.8	-170.4	-174	58.9	0	0	0	112.1	P83 G87 D114	P83-L85 PolarHBondContact O-N 3.41Å; L85-G87 VanDerWaalsContact C-N 3.31Å; L85-D114 WeakPolarHBondContact CD2-O 3.43Å
86	T	97.9	Very high	96.2	Very high	69 Å²	69	78.4 Å²	78.4	42%	0.423	41%	0.405	S	S	.	.			trans	-68.3	-30.9	172.5	-61	0	0	0	0	112	I109 G111	T86-I109 WeakPolarHBondContact CA-O 3.27Å; T86-I109 WeakPolarHBondContact CB-O 2.97Å; T86-I109 WeakPolarHBondContact CG2-O 3.49Å; T86-I109 PolarHBondContact OG1-O 3.26Å; T86-G111 VanDerWaalsContact O-CA 3.23Å; T86-G111 WeakPolarHBondContact O-CA 2.94Å; T86-G111 PolarHBondContact O-N 3.48Å
87	G	97	Very high	96.8	Very high	25 Å²	25	77.3 Å²	77.3	26%	0.258	40%	0.4	S	S	.	.			trans	77.6	-176.1	-176.3	0	0	0	0	0	113.2	L85	L85-G87 VanDerWaalsContact C-N 3.31Å
88	K	96.8	Very high	97.1	Very high	177 Å²	177	75.3 Å²	75.3	77%	0.77	39%	0.388	S	S	*	.	S	Bend	trans	-92.2	-17.5	-173.5	-63.9	173.5	-174	163	0	114.2
89	C	98.4	Very high	97.3	Very high	56 Å²	56	71.7 Å²	71.7	38%	0.378	36%	0.363	S	S	.	.			trans	-74.4	161.2	179.7	-69	0	0	0	0	111.7	G111 C113	C89-G111 CarbonylContact C-O 3.24Å; C89-G111 VanDerWaalsContact C-O 3.24Å; C89-G111 WeakPolarHBondContact CB-O 3.47Å; C89-G111 WeakPolarHBondContact O-CA 3.32Å; C89-C113 HydrophobicContact CB-CB 3.92Å; C89-C113 WeakPolarHBondContact CB-SG 3.16Å; C89-C113 PolarHBondContact N-SG 3.24Å; C89-C113 WeakPolarHBondContact SG-CB 3.47Å; C89-C113 CovalentContact SG-SG 2.02Å; C89-C113 PolarHBondContact SG-SG 2.92Å
90	R	97.4	Very high	97.1	Very high	252 Å²	252	72.4 Å²	72.4	95%	0.951	37%	0.371	S	S	*	.			trans	-113.4	22	-170.7	-60	-177.8	179.8	174.2	-1	113.7
91	A	98.1	Very high	96.9	Very high	43 Å²	43	80.9 Å²	80.9	36%	0.355	41%	0.411	S	S	.	.			trans	-76.7	171.8	167.3	0	0	0	0	0	110.1	F93 G111	A91-F93 HydrophobicContact CB-CD2 3.84Å; A91-F93 HydrophobicContact CB-CE2 3.34Å; A91-F93 HydrophobicContact CB-CZ 3.98Å; A91-G111 VanDerWaalsContact CB-O 3.24Å; A91-G111 WeakPolarHBondContact CB-O 3.07Å; A91-G111 PolarHBondContact N-O 2.87Å; A91-G111 WeakPolarHBondContact O-CA 3.35Å
92	S	97.9	Very high	97	Very high	86 Å²	86	79.5 Å²	79.5	60%	0.601	41%	0.407	S	S	*	.			trans	-130.8	90.3	177.4	-176.9	0	0	0	0	109.1
93	F	98.5	Very high	96.8	Very high	104 Å²	104	81.4 Å²	81.4	46%	0.456	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	122.6	174.5	-60.3	-69.1	0	0	0	109.7	A91 R95 Y110	A91-F93 HydrophobicContact CB-CD2 3.84Å; A91-F93 HydrophobicContact CB-CE2 3.34Å; A91-F93 HydrophobicContact CB-CZ 3.98Å; F93-R95 PolarHBondContact O-N 2.9Å; F93-Y110 HydrophobicContact CB-CD1 4.24Å; F93-Y110 HydrophobicContact CD2-CD1 4.18Å; F93-Y110 PolarHBondContact N-O 3.26Å; F93-Y110 PolarHBondContact O-N 2.92Å
94	N	98.3	Very high	96.7	Very high	91 Å²	91	79.9 Å²	79.9	49%	0.487	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	125.6	171.1	-71.9	16.9	0	0	0	109.2	E107 I109	N94-E107 HydrophobicContact CB-CG 4.44Å; N94-E107 VanDerWaalsContact CB-OE1 3.23Å; N94-E107 WeakPolarHBondContact CB-OE1 3.02Å; N94-E107 VanDerWaalsContact CG-OE1 3.23Å; N94-E107 PolarHBondContact ND2-OE1 3.04Å; N94-I109 VanDerWaalsContact OD1-CD1 3.29Å; N94-I109 WeakPolarHBondContact OD1-CD1 3.22Å
95	R	98.5	Very high	96.8	Very high	58 Å²	58	76.4 Å²	76.4	22%	0.219	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	159.9	-179.7	-67.2	-64.2	-172.1	108.2	-7.1	109.7	F93 E107 F108 Y110 N119 F120	F93-R95 PolarHBondContact O-N 2.9Å; R95-E107 CarbonylContact O-C 3.52Å; R95-E107 VanDerWaalsContact O-CA 3.3Å; R95-E107 WeakPolarHBondContact O-CA 3.38Å; R95-F108 HydrophobicContact CB-CD1 4.26Å; R95-F108 HydrophobicContact CB-CE1 3.76Å; R95-F108 HydrophobicContact CB-CZ 3.95Å; R95-F108 PolarHBondContact N-O 2.03Å; R95-F108 WeakPolarHBondContact O-CD1 2.96Å; R95-F108 PolarHBondContact O-N 2.86Å; R95-Y110 HydrophobicContact CG-CD1 4.2Å; R95-Y110 HydrophobicContact CG-CG 4.25Å; R95-N119 WeakPolarHBondContact CB-OD1 3.21Å; R95-N119 WeakPolarHBondContact CD-OD1 3.38Å; R95-N119 WeakPolarHBondContact CG-OD1 3.12Å; R95-N119 PolarHBondContact NH1-OD1 3.37Å; R95-F120 WeakPolarHBondContact CA-O 3.3Å; R95-F120 WeakPolarHBondContact CD-O 3.43Å
96	W	98.7	Very high	96.8	Very high	63 Å²	63	75.4 Å²	75.4	24%	0.239	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	140	176.3	-66.7	83	0	0	0	109.7	C105 F120 K123 C126	W96-C105 HydrophobicContact CE3-CB 4.09Å; W96-C105 WeakPolarHBondContact CZ3-O 3.28Å; W96-F120 HydrophobicContact CB-CB 4.28Å; W96-F120 PolarHBondContact N-O 3.04Å; W96-F120 WeakPolarHBondContact O-CD2 3Å; W96-F120 PolarHBondContact O-N 2.85Å; W96-K123 HydrophobicContact CD2-CB 3.69Å; W96-K123 HydrophobicContact CD2-CG 4.27Å; W96-K123 HydrophobicContact CE3-CB 3.74Å; W96-K123 HydrophobicContact CE3-CD 4.32Å; W96-K123 HydrophobicContact CE3-CG 3.79Å; W96-K123 HydrophobicContact CG-CB 4.36Å; W96-K123 HydrophobicContact CH2-CB 3.92Å; W96-K123 HydrophobicContact CH2-CD 3.79Å; W96-K123 HydrophobicContact CH2-CG 4.08Å; W96-K123 HydrophobicContact CZ2-CB 3.87Å; W96-K123 HydrophobicContact CZ2-CD 4.5Å; W96-K123 HydrophobicContact CZ3-CB 3.86Å; W96-K123 HydrophobicContact CZ3-CD 3.69Å; W96-K123 HydrophobicContact CZ3-CG 3.69Å; W96-C126 HydrophobicContact CB-CB 4.02Å
97	G	98.2	Very high	96.8	Very high	0 Å²	0	77.2 Å²	77.2	0%	0	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.8	146.4	172.9	0	0	0	0	0	110.8	E106 N118	G97-E106 PolarHBondContact N-O 3.38Å; G97-E106 PolarHBondContact O-N 3.39Å; G97-N118 VanDerWaalsContact CA-OD1 3.27Å; G97-N118 WeakPolarHBondContact CA-OD1 3.5Å
98	W	97.7	Very high	96.9	Very high	15 Å²	15	77 Å²	77	6%	0.057	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	137.1	176.8	-173.1	-102.9	0	0	0	110.7	C80 R84 T103 C105 N118 C130 K131	C80-W98 HydrophobicContact CB-CB 4.03Å; C80-W98 HydrophobicContact CB-CG 3.92Å; C80-W98 VanDerWaalsContact O-CD1 3.29Å; R84-W98 PolarHBondContact NH1-O 3.33Å; W98-T103 VanDerWaalsContact CH2-C 3.43Å; W98-T103 WeakPolarHBondContact CH2-O 3.07Å; W98-C105 VanDerWaalsContact CE3-SG 3.59Å; W98-N118 PolarHBondContact N-OD1 2.83Å; W98-N118 PolarHBondContact O-ND2 3.43Å; W98-C130 HydrophobicContact CB-CB 3.72Å; W98-C130 HydrophobicContact CD2-CB 3.44Å; W98-C130 VanDerWaalsContact CD2-CB 3.44Å; W98-C130 HydrophobicContact CE3-CB 3.45Å; W98-C130 VanDerWaalsContact CE3-CB 3.45Å; W98-C130 HydrophobicContact CG-CB 3.58Å; W98-C130 HydrophobicContact CZ3-CB 4.21Å; W98-K131 HydrophobicContact CH2-CB 4.28Å; W98-K131 HydrophobicContact CH2-CG 4.38Å; W98-K131 HydrophobicContact CZ3-CB 4.26Å
99	N	96.4	Very high	96.9	Very high	17 Å²	17	72.1 Å²	72.1	9%	0.091	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	110.1	168.9	-172.4	-17.9	0	0	0	109.1	Q101 T102 T103 T104 E106	N99-Q101 PolarHBondContact O-N 3.22Å; N99-Q101 WeakPolarHBondContact OD1-CB 3.35Å; N99-Q101 PolarHBondContact OD1-N 2.68Å; N99-T102 WeakPolarHBondContact CB-OG1 3.24Å; N99-T102 PolarHBondContact ND2-OG1 2.85Å; N99-T103 VanDerWaalsContact O-CA 3.28Å; N99-T103 WeakPolarHBondContact O-CA 3.27Å; N99-T103 PolarHBondContact O-N 3.48Å; N99-T104 PolarHBondContact N-O 3.07Å; N99-T104 PolarHBondContact O-N 3.41Å; N99-E106 HydrophobicContact CB-CG 4.21Å; N99-E106 PolarHBondContact ND2-OE1 2.77Å; N99-E106 PolarHBondContact ND2-OE2 2.79Å
100	P	91.5	Very high	96.9	Very high	64 Å²	64	70.7 Å²	70.7	42%	0.416	36%	0.355	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.9	-18.8	179.3	28.1	-34.5	0	0	0	113.3
101	Q	92	Very high	97	Very high	179 Å²	179	58.7 Å²	58.7	84%	0.836	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.1	-41.7	179.2	-60.2	-178	-6.8	0	0	112.3	N99	N99-Q101 PolarHBondContact O-N 3.22Å; N99-Q101 WeakPolarHBondContact OD1-CB 3.35Å; N99-Q101 PolarHBondContact OD1-N 2.68Å
102	T	94.6	Very high	97	Very high	64 Å²	64	58.2 Å²	58.2	39%	0.393	31%	0.309	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.1	-9.8	178.3	55.2	0	0	0	0	112.1	N99 T104 E106	N99-T102 WeakPolarHBondContact CB-OG1 3.24Å; N99-T102 PolarHBondContact ND2-OG1 2.85Å; T102-T104 PolarHBondContact O-N 3.29Å; T102-T104 PolarHBondContact OG1-OG1 3.49Å; T102-E106 WeakPolarHBondContact CB-OE1 3.49Å; T102-E106 WeakPolarHBondContact CG2-OE1 3.4Å; T102-E106 PolarHBondContact OG1-OE1 3.08Å
103	T	92.4	Very high	97	Very high	99 Å²	99	55.6 Å²	55.6	61%	0.607	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.4	35.7	-176.8	62.6	0	0	0	0	113.2	W98 N99	W98-T103 VanDerWaalsContact CH2-C 3.43Å; W98-T103 WeakPolarHBondContact CH2-O 3.07Å; N99-T103 VanDerWaalsContact O-CA 3.28Å; N99-T103 WeakPolarHBondContact O-CA 3.27Å; N99-T103 PolarHBondContact O-N 3.48Å
104	T	95.8	Very high	96.9	Very high	62 Å²	62	55 Å²	55	38%	0.38	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	158.3	-178.8	57.5	0	0	0	0	111.6	N99 T102	N99-T104 PolarHBondContact N-O 3.07Å; N99-T104 PolarHBondContact O-N 3.41Å; T102-T104 PolarHBondContact O-N 3.29Å; T102-T104 PolarHBondContact OG1-OG1 3.49Å
105	C	98.1	Very high	96.8	Very high	8 Å²	8	52.9 Å²	52.9	5%	0.054	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	123	164.5	-70.2	0	0	0	0	109.5	W96 W98 K123 C126 E127	W96-C105 HydrophobicContact CE3-CB 4.09Å; W96-C105 WeakPolarHBondContact CZ3-O 3.28Å; W98-C105 VanDerWaalsContact CE3-SG 3.59Å; C105-K123 HydrophobicContact CB-CG 4.23Å; C105-C126 HydrophobicContact CB-CB 3.81Å; C105-C126 WeakPolarHBondContact CB-SG 3.23Å; C105-C126 WeakPolarHBondContact SG-CB 3.35Å; C105-C126 CovalentContact SG-SG 2.03Å; C105-C126 PolarHBondContact SG-SG 3.06Å; C105-E127 HydrophobicContact CB-CG 4.12Å; C105-E127 VanDerWaalsContact SG-CG 3.59Å; C105-E127 PolarHBondContact SG-N 3.35Å
106	E	98.4	Very high	96.7	Very high	51 Å²	51	51.6 Å²	51.6	24%	0.238	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	142.8	-179.4	-67.2	174.2	178.7	0	0	109.8	R84 G97 N99 T102	R84-E106 IonicContact CZ-OE2 3.64Å; R84-E106 IonicContact NH1-OE2 3.83Å; R84-E106 IonicContact NH2-OE2 3.4Å; R84-E106 PolarHBondContact NH2-OE2 3.04Å; G97-E106 PolarHBondContact N-O 3.38Å; G97-E106 PolarHBondContact O-N 3.39Å; N99-E106 HydrophobicContact CB-CG 4.21Å; N99-E106 PolarHBondContact ND2-OE1 2.77Å; N99-E106 PolarHBondContact ND2-OE2 2.79Å; T102-E106 WeakPolarHBondContact CB-OE1 3.49Å; T102-E106 WeakPolarHBondContact CG2-OE1 3.4Å; T102-E106 PolarHBondContact OG1-OE1 3.08Å
107	E	98.2	Very high	96.7	Very high	107 Å²	107	54.2 Å²	54.2	50%	0.5	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	142	173.7	-168.4	176	-150.4	0	0	110.2	N94 R95	N94-E107 HydrophobicContact CB-CG 4.44Å; N94-E107 VanDerWaalsContact CB-OE1 3.23Å; N94-E107 WeakPolarHBondContact CB-OE1 3.02Å; N94-E107 VanDerWaalsContact CG-OE1 3.23Å; N94-E107 PolarHBondContact ND2-OE1 3.04Å; R95-E107 CarbonylContact O-C 3.52Å; R95-E107 VanDerWaalsContact O-CA 3.3Å; R95-E107 WeakPolarHBondContact O-CA 3.38Å
108	F	98.4	Very high	96.7	Very high	22 Å²	22	54.2 Å²	54.2	10%	0.096	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.8	162.1	172.6	76.7	-78.1	0	0	0	110.8	R84 R95 N119	R84-F108 HydrophobicContact CB-CD1 4.16Å; R84-F108 HydrophobicContact CB-CD2 4.15Å; R84-F108 HydrophobicContact CB-CE1 4.27Å; R84-F108 HydrophobicContact CB-CE2 4.3Å; R84-F108 HydrophobicContact CB-CG 4.08Å; R84-F108 HydrophobicContact CB-CZ 4.34Å; R84-F108 HydrophobicContact CG-CD1 4.21Å; R84-F108 HydrophobicContact CG-CE1 4.34Å; R95-F108 HydrophobicContact CB-CD1 4.26Å; R95-F108 HydrophobicContact CB-CE1 3.76Å; R95-F108 HydrophobicContact CB-CZ 3.95Å; R95-F108 PolarHBondContact N-O 2.03Å; R95-F108 WeakPolarHBondContact O-CD1 2.96Å; R95-F108 PolarHBondContact O-N 2.86Å; F108-N119 HydrophobicContact CZ-CB 4.1Å
109	I	98.3	Very high	96.7	Very high	73 Å²	73	54.4 Å²	54.4	37%	0.374	30%	0.302	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.5	121.3	176.9	-55.9	-58.1	0	0	0	109.9	T86 N94	T86-I109 WeakPolarHBondContact CA-O 3.27Å; T86-I109 WeakPolarHBondContact CB-O 2.97Å; T86-I109 WeakPolarHBondContact CG2-O 3.49Å; T86-I109 PolarHBondContact OG1-O 3.26Å; N94-I109 VanDerWaalsContact OD1-CD1 3.29Å; N94-I109 WeakPolarHBondContact OD1-CD1 3.22Å
110	Y	98.6	Very high	96.8	Very high	26 Å²	26	54.2 Å²	54.2	10%	0.102	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	126.8	169.5	172.6	-127.4	0	0	0	110.7	F93 R95 G112 C113 A115 N119	F93-Y110 HydrophobicContact CB-CD1 4.24Å; F93-Y110 HydrophobicContact CD2-CD1 4.18Å; F93-Y110 PolarHBondContact N-O 3.26Å; F93-Y110 PolarHBondContact O-N 2.92Å; R95-Y110 HydrophobicContact CG-CD1 4.2Å; R95-Y110 HydrophobicContact CG-CG 4.25Å; Y110-G112 VanDerWaalsContact C-N 3.26Å; Y110-G112 VanDerWaalsContact CE1-CA 3.45Å; Y110-G112 PolarHBondContact O-N 3.48Å; Y110-G112 PolarHBondContact OH-O 3.31Å; Y110-C113 VanDerWaalsContact CE2-O 3.29Å; Y110-C113 WeakPolarHBondContact CE2-O 3.29Å; Y110-C113 WeakPolarHBondContact OH-CA 3.18Å; Y110-C113 PolarHBondContact OH-N 3.47Å; Y110-C113 VanDerWaalsContact OH-N 3.1Å; Y110-A115 HydrophobicContact CD2-CB 4.27Å; Y110-A115 HydrophobicContact CE1-CB 4.46Å; Y110-A115 HydrophobicContact CE2-CB 3.5Å; Y110-A115 VanDerWaalsContact CE2-CB 3.5Å; Y110-N119 WeakPolarHBondContact CD2-ND2 3.42Å
111	G	98.3	Very high	97.2	Very high	1 Å²	1	56.6 Å²	56.6	1%	0.01	31%	0.309	C	S	.	.			trans	-74	-10.1	-175.8	0	0	0	0	0	115	T86 C89 A91	T86-G111 VanDerWaalsContact O-CA 3.23Å; T86-G111 WeakPolarHBondContact O-CA 2.94Å; T86-G111 PolarHBondContact O-N 3.48Å; C89-G111 CarbonylContact C-O 3.24Å; C89-G111 VanDerWaalsContact C-O 3.24Å; C89-G111 WeakPolarHBondContact CB-O 3.47Å; C89-G111 WeakPolarHBondContact O-CA 3.32Å; A91-G111 VanDerWaalsContact CB-O 3.24Å; A91-G111 WeakPolarHBondContact CB-O 3.07Å; A91-G111 PolarHBondContact N-O 2.87Å; A91-G111 WeakPolarHBondContact O-CA 3.35Å
112	G	97.8	Very high	97.5	Very high	33 Å²	33	51 Å²	51	34%	0.34	29%	0.287	S	S	.	.	S	Bend	trans	101.2	-6.2	174.9	0	0	0	0	0	116	Y110	Y110-G112 VanDerWaalsContact C-N 3.26Å; Y110-G112 VanDerWaalsContact CE1-CA 3.45Å; Y110-G112 PolarHBondContact O-N 3.48Å; Y110-G112 PolarHBondContact OH-O 3.31Å
113	C	98	Very high	97.6	Very high	31 Å²	31	51.9 Å²	51.9	21%	0.209	29%	0.285	C	S	.	.	S	Bend	trans	-145.7	166.9	171.1	69.1	0	0	0	0	111.8	C89 Y110 A115	C89-C113 HydrophobicContact CB-CB 3.92Å; C89-C113 WeakPolarHBondContact CB-SG 3.16Å; C89-C113 PolarHBondContact N-SG 3.24Å; C89-C113 WeakPolarHBondContact SG-CB 3.47Å; C89-C113 CovalentContact SG-SG 2.02Å; C89-C113 PolarHBondContact SG-SG 2.92Å; Y110-C113 VanDerWaalsContact CE2-O 3.29Å; Y110-C113 WeakPolarHBondContact CE2-O 3.29Å; Y110-C113 WeakPolarHBondContact OH-CA 3.18Å; Y110-C113 PolarHBondContact OH-N 3.47Å; Y110-C113 VanDerWaalsContact OH-N 3.1Å; C113-A115 VanDerWaalsContact C-N 3.25Å; C113-A115 PolarHBondContact O-N 3.19Å
114	D	96	Very high	97.9	Very high	91 Å²	91	52.8 Å²	52.8	49%	0.487	28%	0.283	S	S	.	.	S	Bend	trans	56.1	35.7	179.5	-55.9	-26.3	0	0	0	113.3	L85	L85-D114 WeakPolarHBondContact CD2-O 3.43Å
115	A	96.3	Very high	98	Very high	46 Å²	46	54 Å²	54	38%	0.38	28%	0.284	S	S	.	.			trans	-65.6	143.9	169.1	0	0	0	0	0	110.7	Y110 C113 N119	Y110-A115 HydrophobicContact CD2-CB 4.27Å; Y110-A115 HydrophobicContact CE1-CB 4.46Å; Y110-A115 HydrophobicContact CE2-CB 3.5Å; Y110-A115 VanDerWaalsContact CE2-CB 3.5Å; C113-A115 VanDerWaalsContact C-N 3.25Å; C113-A115 PolarHBondContact O-N 3.19Å; A115-N119 HydrophobicContact CB-CB 4.43Å
116	N	98	Very high	98	Very high	31 Å²	31	53.6 Å²	53.6	17%	0.166	28%	0.281	C	S	.	.			trans	-94.1	-177	155.5	64.4	13.1	0	0	0	109.8	L82 P83 N118 N119	L82-N116 HydrophobicContact CD1-CB 4.36Å; P83-N116 PolarHBondContact O-ND2 3.28Å; P83-N116 PolarHBondContact O-OD1 3.46Å; N116-N118 VanDerWaalsContact C-N 3.3Å; N116-N118 PolarHBondContact O-N 2.77Å; N116-N118 PolarHBondContact OD1-N 3.36Å; N116-N119 WeakPolarHBondContact O-CB 3.41Å
117	E	97.7	Very high	97.9	Very high	119 Å²	119	53.8 Å²	53.8	56%	0.556	28%	0.282	S	S	*	.	S	Bend	trans	-74.8	-15.7	-173	-61.9	81	179.3	0	0	113.7	I79 L82 N119	I79-E117 HydrophobicContact CB-CB 4.15Å; I79-E117 HydrophobicContact CD1-CB 3.85Å; I79-E117 HydrophobicContact CD1-CG 4.27Å; I79-E117 HydrophobicContact CG1-CB 3.72Å; I79-E117 HydrophobicContact CG1-CG 4.31Å; I79-E117 HydrophobicContact CG2-CB 3.45Å; I79-E117 VanDerWaalsContact CG2-CB 3.45Å; I79-E117 VanDerWaalsContact CG2-O 3.28Å; I79-E117 WeakPolarHBondContact CG2-O 3.37Å; L82-E117 HydrophobicContact CD1-CB 4.37Å; L82-E117 WeakPolarHBondContact CD1-OE2 3.48Å; E117-N119 PolarHBondContact O-N 2.84Å
118	N	98.3	Very high	97.7	Very high	0 Å²	0	53 Å²	53	0%	0	28%	0.284	C	S	.	.	S	Bend	trans	-79	57.3	173.6	-167.2	10.4	0	0	0	110.8	I79 L82 G97 W98 N116	I79-N118 HydrophobicContact CG2-CB 4.48Å; I79-N118 WeakPolarHBondContact O-CB 3.42Å; L82-N118 HydrophobicContact CB-CB 4.11Å; L82-N118 PolarHBondContact O-ND2 3.39Å; G97-N118 VanDerWaalsContact CA-OD1 3.27Å; G97-N118 WeakPolarHBondContact CA-OD1 3.5Å; W98-N118 PolarHBondContact N-OD1 2.83Å; W98-N118 PolarHBondContact O-ND2 3.43Å; N116-N118 VanDerWaalsContact C-N 3.3Å; N116-N118 PolarHBondContact O-N 2.77Å; N116-N118 PolarHBondContact OD1-N 3.36Å
119	N	98.5	Very high	97.6	Very high	18 Å²	18	54.3 Å²	54.3	10%	0.096	29%	0.294	C	S	.	.			trans	-153.6	97.2	-171.9	-173.2	-31.3	0	0	0	110.4	R95 F108 Y110 A115 N116 E117	R95-N119 WeakPolarHBondContact CB-OD1 3.21Å; R95-N119 WeakPolarHBondContact CD-OD1 3.38Å; R95-N119 WeakPolarHBondContact CG-OD1 3.12Å; R95-N119 PolarHBondContact NH1-OD1 3.37Å; F108-N119 HydrophobicContact CZ-CB 4.1Å; Y110-N119 WeakPolarHBondContact CD2-ND2 3.42Å; A115-N119 HydrophobicContact CB-CB 4.43Å; N116-N119 WeakPolarHBondContact O-CB 3.41Å; E117-N119 PolarHBondContact O-N 2.84Å
120	F	98.6	Very high	97.4	Very high	14 Å²	14	50.9 Å²	50.9	6%	0.061	28%	0.277	C	S	.	.	B	Isolated β-bridge	trans	-112.5	153.9	-174	-54.4	-79.5	0	0	0	111.5	I79 R95 W96 E125 C126 V129	I79-F120 HydrophobicContact CG2-CZ 4.21Å; R95-F120 WeakPolarHBondContact CA-O 3.3Å; R95-F120 WeakPolarHBondContact CD-O 3.43Å; W96-F120 HydrophobicContact CB-CB 4.28Å; W96-F120 PolarHBondContact N-O 3.04Å; W96-F120 WeakPolarHBondContact O-CD2 3Å; W96-F120 PolarHBondContact O-N 2.85Å; F120-E125 HydrophobicContact CB-CB 4.31Å; F120-E125 HydrophobicContact CB-CG 4.26Å; F120-E125 HydrophobicContact CD1-CG 3.77Å; F120-E125 HydrophobicContact CG-CG 4.4Å; F120-C126 HydrophobicContact CB-CB 3.88Å; F120-C126 HydrophobicContact CD2-CB 3.4Å; F120-C126 HydrophobicContact CE2-CB 4.09Å; F120-C126 HydrophobicContact CG-CB 3.73Å; F120-V129 HydrophobicContact CE1-CB 3.95Å; F120-V129 HydrophobicContact CE1-CG1 3.97Å; F120-V129 HydrophobicContact CE1-CG2 3.9Å; F120-V129 HydrophobicContact CZ-CB 4.01Å; F120-V129 HydrophobicContact CZ-CG1 3.81Å; F120-V129 HydrophobicContact CZ-CG2 4.47Å
121	L	98.1	Very high	97.1	Very high	114 Å²	114	55.3 Å²	55.3	60%	0.597	30%	0.297	S	S	*	.	S	Bend	trans	-79.4	-33.8	-180	-73.6	171.8	0	0	0	112.2	E125	L121-E125 PolarHBondContact N-OE2 2.65Å
122	T	98.5	Very high	96.5	Very high	60 Å²	60	58.6 Å²	58.6	37%	0.368	31%	0.313	S	S	.	.	S	Bend	trans	-128.1	160.1	-179.9	77.8	0	0	0	0	112	E124 E125 C126	T122-E124 VanDerWaalsContact C-N 3.29Å; T122-E124 VanDerWaalsContact CB-OE2 3.32Å; T122-E124 WeakPolarHBondContact CB-OE2 2.97Å; T122-E124 PolarHBondContact O-N 3.3Å; T122-E124 PolarHBondContact OG1-OE2 3.1Å; T122-E125 PolarHBondContact O-N 3.32Å; T122-E125 PolarHBondContact OG1-N 2.92Å; T122-C126 PolarHBondContact O-N 2.75Å
123	K	98.2	Very high	95.5	Very high	83 Å²	83	62.8 Å²	62.8	36%	0.361	32%	0.322	S	S	.	.	H	α-helix	trans	-62.3	-41	175.4	-175.3	177.9	173.6	178.9	0	110.9	W96 C105 E125 C126 E127	W96-K123 HydrophobicContact CD2-CB 3.69Å; W96-K123 HydrophobicContact CD2-CG 4.27Å; W96-K123 HydrophobicContact CE3-CB 3.74Å; W96-K123 HydrophobicContact CE3-CD 4.32Å; W96-K123 HydrophobicContact CE3-CG 3.79Å; W96-K123 HydrophobicContact CG-CB 4.36Å; W96-K123 HydrophobicContact CH2-CB 3.92Å; W96-K123 HydrophobicContact CH2-CD 3.79Å; W96-K123 HydrophobicContact CH2-CG 4.08Å; W96-K123 HydrophobicContact CZ2-CB 3.87Å; W96-K123 HydrophobicContact CZ2-CD 4.5Å; W96-K123 HydrophobicContact CZ3-CB 3.86Å; W96-K123 HydrophobicContact CZ3-CD 3.69Å; W96-K123 HydrophobicContact CZ3-CG 3.69Å; C105-K123 HydrophobicContact CB-CG 4.23Å; K123-E125 VanDerWaalsContact C-N 3.34Å; K123-E125 PolarHBondContact O-N 2.9Å; K123-C126 WeakPolarHBondContact O-CB 2.95Å; K123-C126 PolarHBondContact O-N 2.77Å; K123-E127 WeakPolarHBondContact CE-OE1 3.48Å; K123-E127 HydrophobicContact CG-CG 4.36Å; K123-E127 IonicContact NZ-OE1 2.77Å; K123-E127 WeakPolarHBondContact O-CG 3.35Å; K123-E127 PolarHBondContact O-N 2.02Å
124	E	97.9	Very high	94.3	Very high	119 Å²	119	66.7 Å²	66.7	56%	0.556	35%	0.345	S	S	*	.	H	α-helix	trans	-65.3	-38.5	-177.5	-60.8	69.6	-149.1	0	0	111.5	T122 E127 T128	T122-E124 VanDerWaalsContact C-N 3.29Å; T122-E124 VanDerWaalsContact CB-OE2 3.32Å; T122-E124 WeakPolarHBondContact CB-OE2 2.97Å; T122-E124 PolarHBondContact O-N 3.3Å; T122-E124 PolarHBondContact OG1-OE2 3.1Å; E124-E127 PolarHBondContact O-N 3.27Å; E124-T128 VanDerWaalsContact O-CB 3.22Å; E124-T128 WeakPolarHBondContact O-CB 3.33Å; E124-T128 PolarHBondContact O-N 3.34Å; E124-T128 PolarHBondContact O-OG1 2.72Å
125	E	97.7	Very high	92.8	Very high	86 Å²	86	71.9 Å²	71.9	40%	0.402	36%	0.359	S	S	.	.	H	α-helix	trans	-62.4	-50.9	174.6	-175.2	-175	-162.1	0	0	110.3	F120 L121 T122 K123 E127 T128 V129	F120-E125 HydrophobicContact CB-CB 4.31Å; F120-E125 HydrophobicContact CB-CG 4.26Å; F120-E125 HydrophobicContact CD1-CG 3.77Å; F120-E125 HydrophobicContact CG-CG 4.4Å; L121-E125 PolarHBondContact N-OE2 2.65Å; T122-E125 PolarHBondContact O-N 3.32Å; T122-E125 PolarHBondContact OG1-N 2.92Å; K123-E125 VanDerWaalsContact C-N 3.34Å; K123-E125 PolarHBondContact O-N 2.9Å; E125-E127 PolarHBondContact O-N 2.8Å; E125-T128 PolarHBondContact O-N 2.88Å; E125-V129 WeakPolarHBondContact O-CG2 3.24Å; E125-V129 PolarHBondContact O-N 2.82Å; E125-V129 VanDerWaalsContact O-N 3.07Å
126	C	98.2	Very high	91.2	Very high	0 Å²	0	80.4 Å²	80.4	0%	0	40%	0.396	C	S	.	.	H	α-helix	trans	-56.3	-47.8	176	173.1	0	0	0	0	111.9	W96 C105 F120 T122 K123 T128 V129 C130	W96-C126 HydrophobicContact CB-CB 4.02Å; C105-C126 HydrophobicContact CB-CB 3.81Å; C105-C126 WeakPolarHBondContact CB-SG 3.23Å; C105-C126 WeakPolarHBondContact SG-CB 3.35Å; C105-C126 CovalentContact SG-SG 2.03Å; C105-C126 PolarHBondContact SG-SG 3.06Å; F120-C126 HydrophobicContact CB-CB 3.88Å; F120-C126 HydrophobicContact CD2-CB 3.4Å; F120-C126 HydrophobicContact CE2-CB 4.09Å; F120-C126 HydrophobicContact CG-CB 3.73Å; T122-C126 PolarHBondContact O-N 2.75Å; K123-C126 WeakPolarHBondContact O-CB 2.95Å; K123-C126 PolarHBondContact O-N 2.77Å; C126-T128 VanDerWaalsContact C-N 3.35Å; C126-T128 PolarHBondContact O-N 2.79Å; C126-V129 PolarHBondContact O-N 2.81Å; C126-C130 VanDerWaalsContact O-CB 3.27Å; C126-C130 WeakPolarHBondContact O-CB 3.29Å; C126-C130 PolarHBondContact O-N 2.95Å
127	E	96.2	Very high	90.9	Very high	56 Å²	56	82.9 Å²	82.9	26%	0.262	41%	0.407	S	S	.	.	H	α-helix	trans	-67.8	-36.1	-179.8	-72.6	-172.8	174.3	0	0	111.8	C105 K123 E124 E125 V129 K131	C105-E127 HydrophobicContact CB-CG 4.12Å; C105-E127 VanDerWaalsContact SG-CG 3.59Å; C105-E127 PolarHBondContact SG-N 3.35Å; K123-E127 WeakPolarHBondContact CE-OE1 3.48Å; K123-E127 HydrophobicContact CG-CG 4.36Å; K123-E127 IonicContact NZ-OE1 2.77Å; K123-E127 WeakPolarHBondContact O-CG 3.35Å; K123-E127 PolarHBondContact O-N 2.02Å; E124-E127 PolarHBondContact O-N 3.27Å; E125-E127 PolarHBondContact O-N 2.8Å; E127-V129 VanDerWaalsContact C-N 3.26Å; E127-V129 PolarHBondContact O-N 2.82Å; E127-K131 HydrophobicContact CB-CB 4.47Å; E127-K131 WeakPolarHBondContact O-CA 3.39Å; E127-K131 WeakPolarHBondContact O-CB 3.4Å; E127-K131 PolarHBondContact O-N 2.94Å
128	T	94.8	Very high	90.5	Very high	89 Å²	89	80.9 Å²	80.9	55%	0.546	40%	0.399	S	S	.	.	H	α-helix	trans	-63.9	-36.2	177.8	-63.3	0	0	0	0	111.8	E124 E125 C126	E124-T128 VanDerWaalsContact O-CB 3.22Å; E124-T128 WeakPolarHBondContact O-CB 3.33Å; E124-T128 PolarHBondContact O-N 3.34Å; E124-T128 PolarHBondContact O-OG1 2.72Å; E125-T128 PolarHBondContact O-N 2.88Å; C126-T128 VanDerWaalsContact C-N 3.35Å; C126-T128 PolarHBondContact O-N 2.79Å
129	V	94.9	Very high	90.1	Very high	51 Å²	51	85.4 Å²	85.4	31%	0.309	42%	0.421	S	S	.	.	H	α-helix	trans	-83.2	-40.6	-178.6	176	0	0	0	0	112	N77 F120 E125 C126 E127	N77-V129 WeakPolarHBondContact ND2-CG1 3.43Å; F120-V129 HydrophobicContact CE1-CB 3.95Å; F120-V129 HydrophobicContact CE1-CG1 3.97Å; F120-V129 HydrophobicContact CE1-CG2 3.9Å; F120-V129 HydrophobicContact CZ-CB 4.01Å; F120-V129 HydrophobicContact CZ-CG1 3.81Å; F120-V129 HydrophobicContact CZ-CG2 4.47Å; E125-V129 WeakPolarHBondContact O-CG2 3.24Å; E125-V129 PolarHBondContact O-N 2.82Å; E125-V129 VanDerWaalsContact O-N 3.07Å; C126-V129 PolarHBondContact O-N 2.81Å; E127-V129 VanDerWaalsContact C-N 3.26Å; E127-V129 PolarHBondContact O-N 2.82Å
130	C	95.2	Very high	89.6	Confident	1 Å²	1	89.4 Å²	89.4	1%	0.007	44%	0.441	C	S	.	.	H	α-helix	trans	-108.8	-20.3	-167.2	-65.4	0	0	0	0	115.6	L76 C80 W98 C126 I132	L76-C130 WeakPolarHBondContact CD1-O 3.23Å; C80-C130 HydrophobicContact CB-CB 3.61Å; C80-C130 WeakPolarHBondContact CB-SG 3.22Å; C80-C130 WeakPolarHBondContact SG-CA 3.28Å; C80-C130 WeakPolarHBondContact SG-CB 3.04Å; C80-C130 CovalentContact SG-SG 2.02Å; C80-C130 PolarHBondContact SG-SG 2.02Å; W98-C130 HydrophobicContact CB-CB 3.72Å; W98-C130 HydrophobicContact CD2-CB 3.44Å; W98-C130 VanDerWaalsContact CD2-CB 3.44Å; W98-C130 HydrophobicContact CE3-CB 3.45Å; W98-C130 VanDerWaalsContact CE3-CB 3.45Å; W98-C130 HydrophobicContact CG-CB 3.58Å; W98-C130 HydrophobicContact CZ3-CB 4.21Å; C126-C130 VanDerWaalsContact O-CB 3.27Å; C126-C130 WeakPolarHBondContact O-CB 3.29Å; C126-C130 PolarHBondContact O-N 2.95Å; C130-I132 PolarHBondContact O-N 3.33Å
131	K	92.2	Very high	89.1	Confident	119 Å²	119	94.1 Å²	94.1	52%	0.517	46%	0.464	S	S	.	.	S	Bend	trans	-75.4	127.1	177.4	-162.9	173.5	-174.3	173.2	0	109.3	W98 E127 K133	W98-K131 HydrophobicContact CH2-CB 4.28Å; W98-K131 HydrophobicContact CH2-CG 4.38Å; W98-K131 HydrophobicContact CZ3-CB 4.26Å; E127-K131 HydrophobicContact CB-CB 4.47Å; E127-K131 WeakPolarHBondContact O-CA 3.39Å; E127-K131 WeakPolarHBondContact O-CB 3.4Å; E127-K131 PolarHBondContact O-N 2.94Å; K131-K133 PolarHBondContact O-N 2.98Å; K131-K133 VanDerWaalsContact O-N 3.14Å
132	I	84.7	Confident	88.5	Confident	70 Å²	70	92.8 Å²	92.8	36%	0.359	46%	0.455	S	S	.	.			trans	-58.6	120.1	175	-60.9	174.1	0	0	0	108.5	M72 L76 C130 V134	M72-I132 HydrophobicContact CB-CD1 4.46Å; L76-I132 HydrophobicContact CD1-CG1 4.27Å; C130-I132 PolarHBondContact O-N 3.33Å; I132-V134 HydrophobicContact CG2-CG2 4.23Å; I132-V134 PolarHBondContact O-N 2.74Å
133	K	77.4	Confident	87.7	Confident	121 Å²	121	95.1 Å²	95.1	53%	0.526	46%	0.462	S	S	.	.			trans	-87.8	101.5	172	-66.7	-179.7	-173.4	173.2	0	108.2	K131 Y135	K131-K133 PolarHBondContact O-N 2.98Å; K131-K133 VanDerWaalsContact O-N 3.14Å; K133-Y135 HydrophobicContact CB-CE2 4.19Å; K133-Y135 PolarHBondContact O-N 3.39Å
134	V	72.7	Confident	86.9	Confident	113 Å²	113	96.1 Å²	96.1	69%	0.685	47%	0.469	S	S	*	.			trans	-78.9	114.3	167.3	-177.2	0	0	0	0	107.3	I132 I136	I132-V134 HydrophobicContact CG2-CG2 4.23Å; I132-V134 PolarHBondContact O-N 2.74Å; V134-I136 HydrophobicContact CG1-CG1 4.13Å
135	Y	64.1	Low	86	Confident	199 Å²	199	94.2 Å²	94.2	78%	0.78	46%	0.462	S	S	*	.			trans	-84.2	116.2	167.7	-62.9	-79.6	0	0	0	107.7	K133	K133-Y135 HydrophobicContact CB-CE2 4.19Å; K133-Y135 PolarHBondContact O-N 3.39Å
136	I	64.3	Low	85	Confident	225 Å²	225	94.9 Å²	94.9	100%	1.154	47%	0.468	S	S	*	.			trans	-96.1	0	172.8	-56.9	172	0	0	0	108.1	V134	V134-I136 HydrophobicContact CG1-CG1 4.13Å

Retrieved 136 of 136 residues in 214.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).