A0A3Q0KP57_SCHMA Loading...

Phosphate transport system regulatory protein PhoU

AlphaFold DB , UniProt , Accession A0A3Q0KP57, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 77 aa.

						>A0A3Q0KP57_SCHMA|A0A3Q0KP57
MFQRNETRMLRTDLENKILSLKEQLDFHSRLIDGCEKLVEHGLYIEKAVGVCKQAEYESRLTEELRLIRDPTASELD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.9	Low	88.5	Confident	193 Å²	193	144.5 Å²	144.5	95%	0.951	66%	0.655	S	S	*	*				0	-48	0	-156.7	174	-176	0	0	111.7	Q3 R4 N5	M1-Q3 PolarHBondContact O-N 3.38Å; M1-R4 PolarHBondContact O-N 3.02Å; M1-R4 VanDerWaalsContact O-N 3.16Å; M1-N5 PolarHBondContact O-N 3.34Å
2	F	78.2	Confident	89.2	Confident	186 Å²	186	137.3 Å²	137.3	82%	0.816	63%	0.631	S	S	*	*	H	α-helix	trans	-49.6	-53.8	178.6	-66.7	-78.8	0	0	0	115	R4 N5 E6	F2-R4 VanDerWaalsContact C-N 3.26Å; F2-R4 PolarHBondContact O-N 3.04Å; F2-N5 PolarHBondContact O-N 3.49Å; F2-E6 PolarHBondContact O-N 3.16Å
3	Q	82.2	Confident	89.9	Confident	158 Å²	158	134.4 Å²	134.4	74%	0.738	62%	0.623	S	S	*	*	H	α-helix	trans	-57	-36.5	179.5	-71.4	-179.6	-17.9	0	0	113.5	M1 N5 E6 T7	M1-Q3 PolarHBondContact O-N 3.38Å; Q3-N5 PolarHBondContact O-N 3.2Å; Q3-E6 PolarHBondContact O-N 3.43Å; Q3-T7 PolarHBondContact O-N 2.87Å; Q3-T7 PolarHBondContact O-OG1 3.27Å
4	R	87.6	Confident	90.4	Very high	204 Å²	204	131.8 Å²	131.8	77%	0.77	62%	0.615	S	S	*	*	H	α-helix	trans	-66.9	-37.8	178.7	-169.4	-173.8	-72.9	-176	-2.6	111.5	M1 F2 R8	M1-R4 PolarHBondContact O-N 3.02Å; M1-R4 VanDerWaalsContact O-N 3.16Å; F2-R4 VanDerWaalsContact C-N 3.26Å; F2-R4 PolarHBondContact O-N 3.04Å; R4-R8 WeakPolarHBondContact O-CB 3.48Å; R4-R8 PolarHBondContact O-N 2.88Å; R4-R8 VanDerWaalsContact O-N 3.09Å
5	N	88.8	Confident	91	Very high	82 Å²	82	130.1 Å²	130.1	44%	0.439	61%	0.607	S	S	.	*	H	α-helix	trans	-69.4	-42.1	175.8	-76.4	-9.7	0	0	0	111.2	M1 F2 Q3 R8 M9	M1-N5 PolarHBondContact O-N 3.34Å; F2-N5 PolarHBondContact O-N 3.49Å; Q3-N5 PolarHBondContact O-N 3.2Å; N5-R8 WeakPolarHBondContact O-CB 3.37Å; N5-R8 PolarHBondContact O-N 3.28Å; N5-M9 WeakPolarHBondContact O-CG 3.4Å; N5-M9 PolarHBondContact O-N 3.34Å
6	E	92.4	Very high	91.4	Very high	130 Å²	130	127.6 Å²	127.6	61%	0.607	60%	0.599	S	S	*	*	H	α-helix	trans	-62.8	-45.9	177.6	-167.2	175.3	-163.6	0	0	112	F2 Q3 R8 M9 L10	F2-E6 PolarHBondContact O-N 3.16Å; Q3-E6 PolarHBondContact O-N 3.43Å; E6-R8 VanDerWaalsContact C-N 3.27Å; E6-R8 PolarHBondContact O-N 3.34Å; E6-M9 PolarHBondContact O-N 3.09Å; E6-L10 WeakPolarHBondContact O-CB 3.45Å; E6-L10 PolarHBondContact O-N 2.93Å
7	T	94.1	Very high	91.8	Very high	83 Å²	83	127.1 Å²	127.1	51%	0.509	59%	0.594	S	S	.	*	H	α-helix	trans	-61.3	-36.3	173.7	-54.5	0	0	0	0	112	Q3 R11	Q3-T7 PolarHBondContact O-N 2.87Å; Q3-T7 PolarHBondContact O-OG1 3.27Å; T7-R11 WeakPolarHBondContact O-CB 3.39Å; T7-R11 PolarHBondContact O-N 3.11Å
8	R	94.2	Very high	92.2	Very high	179 Å²	179	125.2 Å²	125.2	68%	0.675	59%	0.588	S	S	*	*	H	α-helix	trans	-68	-44.7	177	-174.3	-179.4	-179.4	-178.7	0.8	111.5	R4 N5 E6 R11 T12	R4-R8 WeakPolarHBondContact O-CB 3.48Å; R4-R8 PolarHBondContact O-N 2.88Å; R4-R8 VanDerWaalsContact O-N 3.09Å; N5-R8 WeakPolarHBondContact O-CB 3.37Å; N5-R8 PolarHBondContact O-N 3.28Å; E6-R8 VanDerWaalsContact C-N 3.27Å; E6-R8 PolarHBondContact O-N 3.34Å; R8-R11 PolarHBondContact O-N 3.26Å; R8-T12 PolarHBondContact O-N 3.02Å; R8-T12 PolarHBondContact O-OG1 3.18Å
9	M	94.9	Very high	92.5	Very high	116 Å²	116	123.7 Å²	123.7	57%	0.571	58%	0.584	S	S	*	*	H	α-helix	trans	-60.8	-49.6	176.2	-70.9	-172.7	-59.8	0	0	110.7	N5 E6 R11 T12 D13	N5-M9 WeakPolarHBondContact O-CG 3.4Å; N5-M9 PolarHBondContact O-N 3.34Å; E6-M9 PolarHBondContact O-N 3.09Å; M9-R11 VanDerWaalsContact C-N 3.28Å; M9-R11 PolarHBondContact O-N 3.02Å; M9-T12 PolarHBondContact O-N 2.93Å; M9-T12 VanDerWaalsContact O-N 3.11Å; M9-D13 PolarHBondContact O-N 2.96Å
10	L	96	Very high	92.8	Very high	106 Å²	106	119.7 Å²	119.7	56%	0.555	57%	0.57	S	S	*	*	H	α-helix	trans	-57.5	-40.7	177.5	-176.8	64.5	0	0	0	112.3	E6 D13 L14	E6-L10 WeakPolarHBondContact O-CB 3.45Å; E6-L10 PolarHBondContact O-N 2.93Å; L10-D13 PolarHBondContact O-N 2.9Å; L10-L14 HydrophobicContact CG-CD1 4.26Å; L10-L14 WeakPolarHBondContact O-CB 3.27Å; L10-L14 VanDerWaalsContact O-CG 3.27Å; L10-L14 WeakPolarHBondContact O-CG 3.46Å; L10-L14 PolarHBondContact O-N 3Å
11	R	96.8	Very high	93.1	Very high	152 Å²	152	118 Å²	118	57%	0.574	56%	0.564	S	S	*	*	H	α-helix	trans	-61.8	-49.3	175.5	-175.8	-171.4	-57	178.3	-0.3	111.5	T7 R8 M9 D13 L14 E15	T7-R11 WeakPolarHBondContact O-CB 3.39Å; T7-R11 PolarHBondContact O-N 3.11Å; R8-R11 PolarHBondContact O-N 3.26Å; M9-R11 VanDerWaalsContact C-N 3.28Å; M9-R11 PolarHBondContact O-N 3.02Å; R11-D13 VanDerWaalsContact C-N 3.32Å; R11-D13 PolarHBondContact O-N 2.87Å; R11-L14 PolarHBondContact O-N 3.26Å; R11-E15 HydrophobicContact CG-CG 4.4Å; R11-E15 WeakPolarHBondContact CG-OE1 3.49Å; R11-E15 WeakPolarHBondContact O-CB 3.38Å; R11-E15 VanDerWaalsContact O-CG 3.32Å; R11-E15 WeakPolarHBondContact O-CG 3.32Å; R11-E15 PolarHBondContact O-N 3.46Å
12	T	97.2	Very high	94.6	Very high	59 Å²	59	115.5 Å²	115.5	36%	0.362	55%	0.548	S	S	.	.	H	α-helix	trans	-62.3	-39.9	179.3	-64.6	0	0	0	0	111.6	R8 M9 L14 E15 N16	R8-T12 PolarHBondContact O-N 3.02Å; R8-T12 PolarHBondContact O-OG1 3.18Å; M9-T12 PolarHBondContact O-N 2.93Å; M9-T12 VanDerWaalsContact O-N 3.11Å; T12-L14 PolarHBondContact O-N 3.48Å; T12-E15 PolarHBondContact O-N 3.34Å; T12-N16 WeakPolarHBondContact O-CB 3.36Å; T12-N16 PolarHBondContact O-N 3.49Å; T12-N16 PolarHBondContact O-ND2 3.35Å
13	D	97.9	Very high	95.5	Very high	99 Å²	99	112.3 Å²	112.3	53%	0.529	54%	0.535	S	S	.	.	H	α-helix	trans	-63.4	-42.1	175.9	-68.8	-20.7	0	0	0	111.8	M9 L10 R11 N16 K17	M9-D13 PolarHBondContact O-N 2.96Å; L10-D13 PolarHBondContact O-N 2.9Å; R11-D13 VanDerWaalsContact C-N 3.32Å; R11-D13 PolarHBondContact O-N 2.87Å; D13-N16 PolarHBondContact O-N 3.44Å; D13-K17 WeakPolarHBondContact O-CB 3.46Å; D13-K17 PolarHBondContact O-N 3.25Å
14	L	98.1	Very high	96.3	Very high	98 Å²	98	109.2 Å²	109.2	51%	0.513	52%	0.521	S	S	.	.	H	α-helix	trans	-65.5	-42.8	174.7	-72.5	171.8	0	0	0	112.2	L10 R11 T12 K17 I18	L10-L14 HydrophobicContact CG-CD1 4.26Å; L10-L14 WeakPolarHBondContact O-CB 3.27Å; L10-L14 VanDerWaalsContact O-CG 3.27Å; L10-L14 WeakPolarHBondContact O-CG 3.46Å; L10-L14 PolarHBondContact O-N 3Å; R11-L14 PolarHBondContact O-N 3.26Å; T12-L14 PolarHBondContact O-N 3.48Å; L14-K17 PolarHBondContact O-N 2.94Å; L14-I18 WeakPolarHBondContact O-CB 3.47Å; L14-I18 VanDerWaalsContact O-CG1 3.26Å; L14-I18 WeakPolarHBondContact O-CG1 3.26Å; L14-I18 PolarHBondContact O-N 3.32Å
15	E	98.1	Very high	96.8	Very high	106 Å²	106	105 Å²	105	50%	0.495	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-46.2	175.7	-74.9	167.4	172.5	0	0	111.1	R11 T12 K17 I18 L19	R11-E15 HydrophobicContact CG-CG 4.4Å; R11-E15 WeakPolarHBondContact CG-OE1 3.49Å; R11-E15 WeakPolarHBondContact O-CB 3.38Å; R11-E15 VanDerWaalsContact O-CG 3.32Å; R11-E15 WeakPolarHBondContact O-CG 3.32Å; R11-E15 PolarHBondContact O-N 3.46Å; T12-E15 PolarHBondContact O-N 3.34Å; E15-K17 VanDerWaalsContact C-N 3.34Å; E15-K17 PolarHBondContact O-N 2.9Å; E15-I18 PolarHBondContact O-N 2.97Å; E15-L19 PolarHBondContact O-N 3.48Å
16	N	98.3	Very high	97.3	Very high	91 Å²	91	104.7 Å²	104.7	49%	0.487	51%	0.511	S	S	.	.	H	α-helix	trans	-62.1	-41.8	175.5	-71.6	-23.2	0	0	0	111.6	T12 D13 L19 S20	T12-N16 WeakPolarHBondContact O-CB 3.36Å; T12-N16 PolarHBondContact O-N 3.49Å; T12-N16 PolarHBondContact O-ND2 3.35Å; D13-N16 PolarHBondContact O-N 3.44Å; N16-L19 PolarHBondContact O-N 2.87Å; N16-S20 WeakPolarHBondContact O-CB 3.5Å; N16-S20 PolarHBondContact O-N 3.03Å
17	K	98.4	Very high	97.5	Very high	118 Å²	118	104.8 Å²	104.8	51%	0.513	51%	0.51	S	S	.	.	H	α-helix	trans	-64.9	-42	177.5	-173.7	60.9	177.5	178.7	0	111.8	D13 L14 E15 L19 S20 L21	D13-K17 WeakPolarHBondContact O-CB 3.46Å; D13-K17 PolarHBondContact O-N 3.25Å; L14-K17 PolarHBondContact O-N 2.94Å; E15-K17 VanDerWaalsContact C-N 3.34Å; E15-K17 PolarHBondContact O-N 2.9Å; K17-L19 VanDerWaalsContact C-N 3.35Å; K17-S20 PolarHBondContact O-N 3.41Å; K17-L21 HydrophobicContact CG-CD1 4.23Å; K17-L21 WeakPolarHBondContact O-CB 3.29Å; K17-L21 VanDerWaalsContact O-CG 3.29Å; K17-L21 WeakPolarHBondContact O-CG 3.33Å; K17-L21 PolarHBondContact O-N 3.49Å
18	I	98.5	Very high	97.7	Very high	93 Å²	93	105.4 Å²	105.4	48%	0.477	51%	0.507	S	S	.	.	H	α-helix	trans	-62.3	-43.6	175.6	-71.7	165.5	0	0	0	110.5	L14 E15 L21 K22	L14-I18 WeakPolarHBondContact O-CB 3.47Å; L14-I18 VanDerWaalsContact O-CG1 3.26Å; L14-I18 WeakPolarHBondContact O-CG1 3.26Å; L14-I18 PolarHBondContact O-N 3.32Å; E15-I18 PolarHBondContact O-N 2.97Å; I18-L21 PolarHBondContact O-N 3.36Å; I18-K22 HydrophobicContact CG2-CD 4.31Å; I18-K22 WeakPolarHBondContact O-CG 3.46Å; I18-K22 PolarHBondContact O-N 2.98Å
19	L	98.5	Very high	97.9	Very high	97 Å²	97	99.4 Å²	99.4	51%	0.508	49%	0.492	S	S	.	.	H	α-helix	trans	-60.5	-49.5	177.5	-177	64.4	0	0	0	111.2	E15 N16 K17 L21 K22 E23	E15-L19 PolarHBondContact O-N 3.48Å; N16-L19 PolarHBondContact O-N 2.87Å; K17-L19 VanDerWaalsContact C-N 3.35Å; L19-L21 VanDerWaalsContact C-N 3.32Å; L19-L21 PolarHBondContact O-N 2.96Å; L19-K22 WeakPolarHBondContact O-CB 3.49Å; L19-K22 PolarHBondContact O-N 3.26Å; L19-K22 VanDerWaalsContact O-N 3.11Å; L19-E23 PolarHBondContact O-N 3.43Å
20	S	98.5	Very high	98.1	Very high	44 Å²	44	101.6 Å²	101.6	31%	0.308	49%	0.494	S	S	.	.	H	α-helix	trans	-60.1	-40	177.6	179.9	0	0	0	0	112.6	N16 K17 K22 E23 Q24	N16-S20 WeakPolarHBondContact O-CB 3.5Å; N16-S20 PolarHBondContact O-N 3.03Å; K17-S20 PolarHBondContact O-N 3.41Å; S20-K22 VanDerWaalsContact C-N 3.35Å; S20-E23 PolarHBondContact O-N 3.49Å; S20-Q24 WeakPolarHBondContact O-CG 3.38Å; S20-Q24 PolarHBondContact O-N 3.36Å
21	L	98.6	Very high	98.2	Very high	85 Å²	85	101 Å²	101	45%	0.445	49%	0.491	S	S	.	.	H	α-helix	trans	-66.1	-36.1	175.9	-74	171.5	0	0	0	112.5	K17 I18 L19 Q24 L25	K17-L21 HydrophobicContact CG-CD1 4.23Å; K17-L21 WeakPolarHBondContact O-CB 3.29Å; K17-L21 VanDerWaalsContact O-CG 3.29Å; K17-L21 WeakPolarHBondContact O-CG 3.33Å; K17-L21 PolarHBondContact O-N 3.49Å; I18-L21 PolarHBondContact O-N 3.36Å; L19-L21 VanDerWaalsContact C-N 3.32Å; L19-L21 PolarHBondContact O-N 2.96Å; L21-Q24 PolarHBondContact O-N 2.98Å; L21-L25 WeakPolarHBondContact O-CB 3.44Å; L21-L25 PolarHBondContact O-N 3.11Å
22	K	98.6	Very high	98.2	Very high	140 Å²	140	98.3 Å²	98.3	61%	0.609	49%	0.487	S	S	*	.	H	α-helix	trans	-66.1	-42.5	175.2	-76	177.7	175.9	-176.5	0	112	I18 L19 S20 L25 D26	I18-K22 HydrophobicContact CG2-CD 4.31Å; I18-K22 WeakPolarHBondContact O-CG 3.46Å; I18-K22 PolarHBondContact O-N 2.98Å; L19-K22 WeakPolarHBondContact O-CB 3.49Å; L19-K22 PolarHBondContact O-N 3.26Å; L19-K22 VanDerWaalsContact O-N 3.11Å; S20-K22 VanDerWaalsContact C-N 3.35Å; K22-L25 PolarHBondContact O-N 3.25Å; K22-D26 PolarHBondContact O-N 3.18Å
23	E	98.4	Very high	98.2	Very high	118 Å²	118	99.4 Å²	99.4	55%	0.551	49%	0.491	S	S	*	.	H	α-helix	trans	-63.1	-43.2	175.7	-69.7	171.9	171.9	0	0	111.4	L19 S20 L25 D26 F27	L19-E23 PolarHBondContact O-N 3.43Å; S20-E23 PolarHBondContact O-N 3.49Å; E23-L25 VanDerWaalsContact C-N 3.34Å; E23-L25 PolarHBondContact O-N 3.48Å; E23-D26 PolarHBondContact O-N 2.98Å; E23-F27 WeakPolarHBondContact O-CB 3.4Å; E23-F27 PolarHBondContact O-N 2.9Å
24	Q	98.5	Very high	98.2	Very high	94 Å²	94	96.6 Å²	96.6	44%	0.439	49%	0.485	S	S	.	.	H	α-helix	trans	-60.3	-45.4	173.5	-73.3	178.1	3.7	0	0	111	S20 L21 F27 H28	S20-Q24 WeakPolarHBondContact O-CG 3.38Å; S20-Q24 PolarHBondContact O-N 3.36Å; L21-Q24 PolarHBondContact O-N 2.98Å; Q24-F27 PolarHBondContact O-N 3.24Å; Q24-H28 PolarHBondContact O-N 3.42Å; Q24-H28 PolarHBondContact O-ND1 2.92Å
25	L	98.5	Very high	98.2	Very high	114 Å²	114	95.2 Å²	95.2	60%	0.597	48%	0.483	S	S	*	.	H	α-helix	trans	-61.8	-46.4	179.1	-176.6	61.4	0	0	0	111.9	L21 K22 E23 F27 H28 S29	L21-L25 WeakPolarHBondContact O-CB 3.44Å; L21-L25 PolarHBondContact O-N 3.11Å; K22-L25 PolarHBondContact O-N 3.25Å; E23-L25 VanDerWaalsContact C-N 3.34Å; E23-L25 PolarHBondContact O-N 3.48Å; L25-F27 VanDerWaalsContact C-N 3.32Å; L25-F27 PolarHBondContact O-N 3.35Å; L25-H28 PolarHBondContact O-N 3.03Å; L25-S29 PolarHBondContact O-N 2.69Å; L25-S29 PolarHBondContact O-OG 3.11Å
26	D	98.5	Very high	98.2	Very high	77 Å²	77	95.5 Å²	95.5	41%	0.412	48%	0.484	S	S	.	.	H	α-helix	trans	-58.4	-43.5	175.7	174	69.7	0	0	0	111.6	K22 E23 S29 R30	K22-D26 PolarHBondContact O-N 3.18Å; E23-D26 PolarHBondContact O-N 2.98Å; D26-S29 PolarHBondContact O-N 2.93Å; D26-R30 WeakPolarHBondContact O-CG 3.49Å; D26-R30 PolarHBondContact O-N 3.4Å; D26-R30 IonicContact OD1-CZ 3.63Å; D26-R30 IonicContact OD1-NE 3.18Å; D26-R30 PolarHBondContact OD1-NE 2.87Å; D26-R30 IonicContact OD1-NH2 3.25Å; D26-R30 PolarHBondContact OD1-NH2 3.27Å; D26-R30 IonicContact OD2-CZ 3.1Å; D26-R30 IonicContact OD2-NE 3.18Å; D26-R30 PolarHBondContact OD2-NE 2.93Å; D26-R30 VanDerWaalsContact OD2-NE 3.11Å; D26-R30 IonicContact OD2-NH1 3.92Å; D26-R30 IonicContact OD2-NH2 2.92Å; D26-R30 PolarHBondContact OD2-NH2 3.3Å
27	F	98	Very high	98.1	Very high	131 Å²	131	97.4 Å²	97.4	58%	0.575	49%	0.488	S	S	*	.	H	α-helix	trans	-61.1	-47.3	175.6	177.4	-97.7	0	0	0	112.4	E23 Q24 L25 R30 L31	E23-F27 WeakPolarHBondContact O-CB 3.4Å; E23-F27 PolarHBondContact O-N 2.9Å; Q24-F27 PolarHBondContact O-N 3.24Å; L25-F27 VanDerWaalsContact C-N 3.32Å; L25-F27 PolarHBondContact O-N 3.35Å; F27-R30 PolarHBondContact O-N 2.96Å; F27-L31 WeakPolarHBondContact O-CB 3.48Å; F27-L31 PolarHBondContact O-N 3.31Å
28	H	98.3	Very high	98.1	Very high	97 Å²	97	97.8 Å²	97.8	45%	0.449	50%	0.495	S	S	.	.	H	α-helix	trans	-65.2	-39	178.8	-71.4	96.4	0	0	0	111.9	Q24 L25 L31 I32	Q24-H28 PolarHBondContact O-N 3.42Å; Q24-H28 PolarHBondContact O-ND1 2.92Å; L25-H28 PolarHBondContact O-N 3.03Å; H28-L31 WeakPolarHBondContact O-CB 3.34Å; H28-L31 PolarHBondContact O-N 3.02Å; H28-I32 VanDerWaalsContact O-CG1 3.29Å; H28-I32 WeakPolarHBondContact O-CG1 3.43Å; H28-I32 PolarHBondContact O-N 3.31Å
29	S	98.1	Very high	98.1	Very high	52 Å²	52	97.8 Å²	97.8	36%	0.364	50%	0.499	S	S	.	.	H	α-helix	trans	-59.7	-47.8	174.6	-69.1	0	0	0	0	111.4	L25 D26 L31 I32 D33	L25-S29 PolarHBondContact O-N 2.69Å; L25-S29 PolarHBondContact O-OG 3.11Å; D26-S29 PolarHBondContact O-N 2.93Å; S29-L31 VanDerWaalsContact C-N 3.29Å; S29-L31 PolarHBondContact O-N 3.24Å; S29-I32 PolarHBondContact O-N 3.19Å; S29-D33 VanDerWaalsContact O-CG 3.29Å; S29-D33 PolarHBondContact O-N 3.26Å
30	R	98	Very high	98.1	Very high	163 Å²	163	99.2 Å²	99.2	62%	0.615	50%	0.503	S	S	*	.	H	α-helix	trans	-62.6	-36.2	176.3	-68.7	173.8	-170.2	-164.7	6.2	112.9	D26 F27 G34	D26-R30 WeakPolarHBondContact O-CG 3.49Å; D26-R30 PolarHBondContact O-N 3.4Å; D26-R30 IonicContact OD1-CZ 3.63Å; D26-R30 IonicContact OD1-NE 3.18Å; D26-R30 PolarHBondContact OD1-NE 2.87Å; D26-R30 IonicContact OD1-NH2 3.25Å; D26-R30 PolarHBondContact OD1-NH2 3.27Å; D26-R30 IonicContact OD2-CZ 3.1Å; D26-R30 IonicContact OD2-NE 3.18Å; D26-R30 PolarHBondContact OD2-NE 2.93Å; D26-R30 VanDerWaalsContact OD2-NE 3.11Å; D26-R30 IonicContact OD2-NH1 3.92Å; D26-R30 IonicContact OD2-NH2 2.92Å; D26-R30 PolarHBondContact OD2-NH2 3.3Å; F27-R30 PolarHBondContact O-N 2.96Å; R30-G34 PolarHBondContact O-N 3.35Å
31	L	98	Very high	98	Very high	94 Å²	94	102.9 Å²	102.9	49%	0.492	52%	0.515	S	S	.	.	H	α-helix	trans	-65.3	-43.9	175.9	-176.1	66	0	0	0	110.9	F27 H28 S29 G34 C35	F27-L31 WeakPolarHBondContact O-CB 3.48Å; F27-L31 PolarHBondContact O-N 3.31Å; H28-L31 WeakPolarHBondContact O-CB 3.34Å; H28-L31 PolarHBondContact O-N 3.02Å; S29-L31 VanDerWaalsContact C-N 3.29Å; S29-L31 PolarHBondContact O-N 3.24Å; L31-G34 PolarHBondContact O-N 3.18Å; L31-C35 PolarHBondContact O-N 2.93Å; L31-C35 PolarHBondContact O-SG 2.93Å
32	I	98	Very high	98	Very high	94 Å²	94	100.6 Å²	100.6	48%	0.482	51%	0.512	S	S	.	.	H	α-helix	trans	-61.8	-49.1	176.4	-69.5	165.3	0	0	0	110.3	H28 S29 G34 C35 E36	H28-I32 VanDerWaalsContact O-CG1 3.29Å; H28-I32 WeakPolarHBondContact O-CG1 3.43Å; H28-I32 PolarHBondContact O-N 3.31Å; S29-I32 PolarHBondContact O-N 3.19Å; I32-G34 PolarHBondContact O-N 3.04Å; I32-C35 WeakPolarHBondContact O-CB 3.29Å; I32-C35 PolarHBondContact O-N 3.48Å; I32-E36 HydrophobicContact CG2-CG 4.42Å; I32-E36 WeakPolarHBondContact O-CG 3.46Å; I32-E36 PolarHBondContact O-N 3.21Å
33	D	97.5	Very high	98	Very high	83 Å²	83	98.8 Å²	98.8	44%	0.444	51%	0.509	S	S	.	.	H	α-helix	trans	-57.5	-38.2	177	-65.2	-12.1	0	0	0	112	S29 K37	S29-D33 VanDerWaalsContact O-CG 3.29Å; S29-D33 PolarHBondContact O-N 3.26Å; D33-K37 WeakPolarHBondContact O-CG 3.45Å; D33-K37 PolarHBondContact O-N 2.91Å
34	G	97	Very high	98	Very high	40 Å²	40	101.2 Å²	101.2	41%	0.412	51%	0.514	S	S	.	.	H	α-helix	trans	-66.6	-42	175.3	0	0	0	0	0	112.8	R30 L31 I32 L38	R30-G34 PolarHBondContact O-N 3.35Å; L31-G34 PolarHBondContact O-N 3.18Å; I32-G34 PolarHBondContact O-N 3.04Å; G34-L38 PolarHBondContact O-N 2.9Å; G34-L38 VanDerWaalsContact O-N 3.08Å
35	C	97.7	Very high	97.9	Very high	68 Å²	68	101.6 Å²	101.6	46%	0.459	52%	0.518	S	S	.	.	H	α-helix	trans	-65.1	-42.3	175.6	-73	0	0	0	0	112	L31 I32 K37 L38 V39	L31-C35 PolarHBondContact O-N 2.93Å; L31-C35 PolarHBondContact O-SG 2.93Å; I32-C35 WeakPolarHBondContact O-CB 3.29Å; I32-C35 PolarHBondContact O-N 3.48Å; C35-K37 PolarHBondContact O-N 3.43Å; C35-L38 WeakPolarHBondContact O-CB 3.4Å; C35-L38 PolarHBondContact O-N 3.34Å; C35-L38 VanDerWaalsContact O-N 3.16Å; C35-V39 WeakPolarHBondContact O-CG2 3.36Å; C35-V39 PolarHBondContact O-N 3.46Å
36	E	97.4	Very high	97.9	Very high	113 Å²	113	102.6 Å²	102.6	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-58.9	-47.2	176.8	-73.1	-179.2	168.5	0	0	111.1	I32 L38 V39 E40	I32-E36 HydrophobicContact CG2-CG 4.42Å; I32-E36 WeakPolarHBondContact O-CG 3.46Å; I32-E36 PolarHBondContact O-N 3.21Å; E36-L38 VanDerWaalsContact C-N 3.29Å; E36-L38 PolarHBondContact O-N 3.16Å; E36-V39 WeakPolarHBondContact O-CB 3.48Å; E36-V39 PolarHBondContact O-N 2.97Å; E36-V39 VanDerWaalsContact O-N 3.15Å; E36-E40 WeakPolarHBondContact O-CG 3.49Å; E36-E40 PolarHBondContact O-N 3.08Å
37	K	97.6	Very high	97.9	Very high	131 Å²	131	106.5 Å²	106.5	57%	0.57	53%	0.533	S	S	*	.	H	α-helix	trans	-60.2	-38.3	174.9	-71.8	173.1	-176	173.9	0	112.9	D33 C35 E40 H41	D33-K37 WeakPolarHBondContact O-CG 3.45Å; D33-K37 PolarHBondContact O-N 2.91Å; C35-K37 PolarHBondContact O-N 3.43Å; K37-E40 PolarHBondContact O-N 3.15Å; K37-H41 PolarHBondContact O-CD2 3.28Å; K37-H41 PolarHBondContact O-N 2.95Å
38	L	97.9	Very high	97.8	Very high	126 Å²	126	102.1 Å²	102.1	66%	0.66	52%	0.521	S	S	*	.	H	α-helix	trans	-66	-40.2	177.3	-174.1	64.6	0	0	0	111.4	G34 C35 E36 H41 G42	G34-L38 PolarHBondContact O-N 2.9Å; G34-L38 VanDerWaalsContact O-N 3.08Å; C35-L38 WeakPolarHBondContact O-CB 3.4Å; C35-L38 PolarHBondContact O-N 3.34Å; C35-L38 VanDerWaalsContact O-N 3.16Å; E36-L38 VanDerWaalsContact C-N 3.29Å; E36-L38 PolarHBondContact O-N 3.16Å; L38-H41 PolarHBondContact O-N 2.92Å; L38-G42 PolarHBondContact O-N 2.87Å
39	V	98.2	Very high	97.8	Very high	93 Å²	93	100.6 Å²	100.6	56%	0.564	52%	0.518	S	S	*	.	H	α-helix	trans	-63.7	-45.7	174.7	171.9	0	0	0	0	110.7	C35 E36 H41 G42 L43	C35-V39 WeakPolarHBondContact O-CG2 3.36Å; C35-V39 PolarHBondContact O-N 3.46Å; E36-V39 WeakPolarHBondContact O-CB 3.48Å; E36-V39 PolarHBondContact O-N 2.97Å; E36-V39 VanDerWaalsContact O-N 3.15Å; V39-H41 VanDerWaalsContact C-N 3.34Å; V39-H41 PolarHBondContact O-N 3.49Å; V39-G42 PolarHBondContact O-N 3.47Å; V39-G42 VanDerWaalsContact O-N 3.16Å; V39-L43 HydrophobicContact CG1-CD1 4.17Å; V39-L43 HydrophobicContact CG1-CG 4.49Å; V39-L43 WeakPolarHBondContact O-CG 3.3Å; V39-L43 PolarHBondContact O-N 3.29Å
40	E	97.8	Very high	97.8	Very high	126 Å²	126	99.9 Å²	99.9	59%	0.589	52%	0.52	S	S	*	.	H	α-helix	trans	-58.2	-44.3	175.9	-72.2	179.3	172.1	0	0	112.2	E36 K37 L43 Y44	E36-E40 WeakPolarHBondContact O-CG 3.49Å; E36-E40 PolarHBondContact O-N 3.08Å; K37-E40 PolarHBondContact O-N 3.15Å; E40-L43 PolarHBondContact O-N 3.42Å; E40-Y44 PolarHBondContact O-N 3.43Å
41	H	97.7	Very high	97.7	Very high	121 Å²	121	96.7 Å²	96.7	56%	0.56	52%	0.518	S	S	*	.	H	α-helix	trans	-63.7	-41.5	174.6	-76.8	-30.5	0	0	0	112.5	K37 L38 V39 L43 Y44 I45	K37-H41 PolarHBondContact O-CD2 3.28Å; K37-H41 PolarHBondContact O-N 2.95Å; L38-H41 PolarHBondContact O-N 2.92Å; V39-H41 VanDerWaalsContact C-N 3.34Å; V39-H41 PolarHBondContact O-N 3.49Å; H41-L43 PolarHBondContact O-N 2.96Å; H41-Y44 PolarHBondContact O-N 3.4Å; H41-I45 VanDerWaalsContact O-CG1 3.3Å; H41-I45 WeakPolarHBondContact O-CG1 3.29Å; H41-I45 PolarHBondContact O-N 2.93Å
42	G	98.1	Very high	97.6	Very high	38 Å²	38	95.7 Å²	95.7	39%	0.392	52%	0.518	S	S	.	.	H	α-helix	trans	-57.7	-47.6	174.6	0	0	0	0	0	112.1	L38 V39 Y44 I45 E46	L38-G42 PolarHBondContact O-N 2.87Å; V39-G42 PolarHBondContact O-N 3.47Å; V39-G42 VanDerWaalsContact O-N 3.16Å; G42-Y44 PolarHBondContact O-N 2.89Å; G42-I45 PolarHBondContact O-N 3.16Å; G42-E46 WeakPolarHBondContact O-CB 3.47Å; G42-E46 PolarHBondContact O-N 2.95Å
43	L	98	Very high	97.5	Very high	102 Å²	102	96.6 Å²	96.6	53%	0.534	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-39.7	177.1	-69.8	172.4	0	0	0	112.4	V39 E40 H41 E46 K47	V39-L43 HydrophobicContact CG1-CD1 4.17Å; V39-L43 HydrophobicContact CG1-CG 4.49Å; V39-L43 WeakPolarHBondContact O-CG 3.3Å; V39-L43 PolarHBondContact O-N 3.29Å; E40-L43 PolarHBondContact O-N 3.42Å; H41-L43 PolarHBondContact O-N 2.96Å; L43-E46 PolarHBondContact O-N 3.18Å; L43-K47 WeakPolarHBondContact O-CB 3.46Å; L43-K47 PolarHBondContact O-N 2.92Å
44	Y	98.1	Very high	97.5	Very high	169 Å²	169	97.9 Å²	97.9	66%	0.663	52%	0.522	S	S	*	.	H	α-helix	trans	-62	-45.8	175.1	175.9	-94.8	0	0	0	111.7	E40 H41 G42 K47 A48	E40-Y44 PolarHBondContact O-N 3.43Å; H41-Y44 PolarHBondContact O-N 3.4Å; G42-Y44 PolarHBondContact O-N 2.89Å; Y44-K47 PolarHBondContact O-N 2.84Å; Y44-A48 WeakPolarHBondContact O-CB 3.43Å; Y44-A48 PolarHBondContact O-N 3.39Å
45	I	98	Very high	97.5	Very high	101 Å²	101	98.5 Å²	98.5	52%	0.518	52%	0.523	S	S	.	.	H	α-helix	trans	-62.9	-45.8	177.4	-68.4	166	0	0	0	110.3	H41 G42 K47 A48 V49	H41-I45 VanDerWaalsContact O-CG1 3.3Å; H41-I45 WeakPolarHBondContact O-CG1 3.29Å; H41-I45 PolarHBondContact O-N 2.93Å; G42-I45 PolarHBondContact O-N 3.16Å; I45-K47 VanDerWaalsContact C-N 3.31Å; I45-K47 PolarHBondContact O-N 3.42Å; I45-A48 PolarHBondContact O-N 3.36Å; I45-V49 HydrophobicContact CG2-CG2 4.17Å; I45-V49 WeakPolarHBondContact O-CB 3.4Å; I45-V49 VanDerWaalsContact O-CG2 3.29Å; I45-V49 WeakPolarHBondContact O-CG2 3.47Å; I45-V49 PolarHBondContact O-N 2.87Å
46	E	97.9	Very high	97.4	Very high	136 Å²	136	101.7 Å²	101.7	64%	0.636	53%	0.531	S	S	*	.	H	α-helix	trans	-57.1	-45.7	177.5	-177.1	176.4	-164.3	0	0	111.4	G42 L43 V49 G50	G42-E46 WeakPolarHBondContact O-CB 3.47Å; G42-E46 PolarHBondContact O-N 2.95Å; L43-E46 PolarHBondContact O-N 3.18Å; E46-V49 PolarHBondContact O-N 3.28Å; E46-G50 PolarHBondContact O-N 2.95Å
47	K	97.9	Very high	97.4	Very high	158 Å²	158	102.7 Å²	102.7	69%	0.687	53%	0.531	S	S	*	.	H	α-helix	trans	-61.6	-46.1	175.6	-174.8	178.6	-179.9	179.7	0	112	L43 Y44 I45 G50 V51	L43-K47 WeakPolarHBondContact O-CB 3.46Å; L43-K47 PolarHBondContact O-N 2.92Å; Y44-K47 PolarHBondContact O-N 2.84Å; I45-K47 VanDerWaalsContact C-N 3.31Å; I45-K47 PolarHBondContact O-N 3.42Å; K47-G50 PolarHBondContact O-N 3.26Å; K47-V51 WeakPolarHBondContact O-CG2 3.41Å; K47-V51 PolarHBondContact O-N 3.46Å
48	A	97.3	Very high	97.4	Very high	39 Å²	39	101.6 Å²	101.6	32%	0.322	53%	0.528	S	S	.	.	H	α-helix	trans	-61.8	-44.9	178.8	0	0	0	0	0	111.5	Y44 I45 G50 V51 C52	Y44-A48 WeakPolarHBondContact O-CB 3.43Å; Y44-A48 PolarHBondContact O-N 3.39Å; I45-A48 PolarHBondContact O-N 3.36Å; A48-G50 VanDerWaalsContact C-N 3.34Å; A48-G50 PolarHBondContact O-N 2.94Å; A48-V51 PolarHBondContact O-N 3.37Å; A48-C52 PolarHBondContact O-N 3.49Å; A48-C52 PolarHBondContact O-SG 3.23Å; A48-C52 VanDerWaalsContact O-SG 3.36Å
49	V	97.7	Very high	97.3	Very high	65 Å²	65	99.5 Å²	99.5	39%	0.394	52%	0.524	S	S	.	.	H	α-helix	trans	-62.4	-40.9	175.8	170.1	0	0	0	0	111.2	I45 E46 V51 C52 K53	I45-V49 HydrophobicContact CG2-CG2 4.17Å; I45-V49 WeakPolarHBondContact O-CB 3.4Å; I45-V49 VanDerWaalsContact O-CG2 3.29Å; I45-V49 WeakPolarHBondContact O-CG2 3.47Å; I45-V49 PolarHBondContact O-N 2.87Å; E46-V49 PolarHBondContact O-N 3.28Å; V49-V51 PolarHBondContact O-N 2.98Å; V49-C52 PolarHBondContact O-N 3.45Å; V49-K53 HydrophobicContact CG1-CD 4.09Å; V49-K53 HydrophobicContact CG1-CG 4.42Å; V49-K53 WeakPolarHBondContact O-CB 3.36Å; V49-K53 WeakPolarHBondContact O-CG 3.47Å; V49-K53 PolarHBondContact O-N 3.36Å
50	G	96.9	Very high	97.2	Very high	38 Å²	38	102 Å²	102	39%	0.392	52%	0.523	S	S	.	.	H	α-helix	trans	-58.9	-45	174.9	0	0	0	0	0	112.5	E46 K47 A48 K53 Q54	E46-G50 PolarHBondContact O-N 2.95Å; K47-G50 PolarHBondContact O-N 3.26Å; A48-G50 VanDerWaalsContact C-N 3.34Å; A48-G50 PolarHBondContact O-N 2.94Å; G50-K53 PolarHBondContact O-N 3.41Å; G50-Q54 WeakPolarHBondContact O-CB 3.42Å; G50-Q54 PolarHBondContact O-N 3.04Å
51	V	96.3	Very high	97.2	Very high	96 Å²	96	100.6 Å²	100.6	58%	0.582	52%	0.519	S	S	*	.	H	α-helix	trans	-64.4	-44.7	176.5	172.4	0	0	0	0	111.6	K47 A48 V49 Q54 A55	K47-V51 WeakPolarHBondContact O-CG2 3.41Å; K47-V51 PolarHBondContact O-N 3.46Å; A48-V51 PolarHBondContact O-N 3.37Å; V49-V51 PolarHBondContact O-N 2.98Å; V51-Q54 PolarHBondContact O-N 3.02Å; V51-A55 PolarHBondContact O-N 2.97Å
52	C	95.8	Very high	97.1	Very high	73 Å²	73	99.2 Å²	99.2	49%	0.493	52%	0.52	S	S	.	.	H	α-helix	trans	-60.1	-47.6	177.2	-70.2	0	0	0	0	111.7	A48 V49 Q54 A55 E56	A48-C52 PolarHBondContact O-N 3.49Å; A48-C52 PolarHBondContact O-SG 3.23Å; A48-C52 VanDerWaalsContact O-SG 3.36Å; V49-C52 PolarHBondContact O-N 3.45Å; C52-Q54 VanDerWaalsContact C-N 3.32Å; C52-Q54 PolarHBondContact O-N 3.32Å; C52-A55 PolarHBondContact O-N 3.48Å; C52-E56 WeakPolarHBondContact O-CG 3.46Å; C52-E56 PolarHBondContact O-N 2.95Å
53	K	96.7	Very high	97.1	Very high	113 Å²	113	101.8 Å²	101.8	49%	0.491	52%	0.521	S	S	.	.	H	α-helix	trans	-59.4	-43.6	177.3	-75.3	177.5	178.4	178	0	111.8	V49 G50 A55 E56 Y57	V49-K53 HydrophobicContact CG1-CD 4.09Å; V49-K53 HydrophobicContact CG1-CG 4.42Å; V49-K53 WeakPolarHBondContact O-CB 3.36Å; V49-K53 WeakPolarHBondContact O-CG 3.47Å; V49-K53 PolarHBondContact O-N 3.36Å; G50-K53 PolarHBondContact O-N 3.41Å; K53-A55 VanDerWaalsContact C-N 3.34Å; K53-A55 PolarHBondContact O-N 3.32Å; K53-E56 PolarHBondContact O-N 3.02Å; K53-Y57 HydrophobicContact CB-CE2 4.45Å; K53-Y57 WeakPolarHBondContact O-CD2 3.05Å; K53-Y57 PolarHBondContact O-N 3.49Å
54	Q	97.1	Very high	97	Very high	109 Å²	109	101.2 Å²	101.2	51%	0.509	52%	0.516	S	S	.	.	H	α-helix	trans	-59	-47	177.6	-177.1	62.8	26.2	0	0	111.3	G50 V51 C52 E56 Y57 E58	G50-Q54 WeakPolarHBondContact O-CB 3.42Å; G50-Q54 PolarHBondContact O-N 3.04Å; V51-Q54 PolarHBondContact O-N 3.02Å; C52-Q54 VanDerWaalsContact C-N 3.32Å; C52-Q54 PolarHBondContact O-N 3.32Å; Q54-E56 PolarHBondContact O-N 3.09Å; Q54-Y57 PolarHBondContact O-N 3.43Å; Q54-E58 PolarHBondContact NE2-OE1 2.94Å; Q54-E58 WeakPolarHBondContact O-CG 3.42Å; Q54-E58 PolarHBondContact O-N 3.18Å
55	A	96.4	Very high	96.8	Very high	53 Å²	53	98.1 Å²	98.1	44%	0.438	51%	0.51	S	S	.	.	H	α-helix	trans	-63.4	-39.7	178.1	0	0	0	0	0	112.7	V51 C52 K53 E58 S59	V51-A55 PolarHBondContact O-N 2.97Å; C52-A55 PolarHBondContact O-N 3.48Å; K53-A55 VanDerWaalsContact C-N 3.34Å; K53-A55 PolarHBondContact O-N 3.32Å; A55-E58 PolarHBondContact O-N 3.33Å; A55-S59 WeakPolarHBondContact O-CB 3.49Å; A55-S59 PolarHBondContact O-N 2.92Å
56	E	96.5	Very high	96.7	Very high	135 Å²	135	99.4 Å²	99.4	63%	0.631	51%	0.509	S	S	*	.	H	α-helix	trans	-62.3	-43.9	174.7	-73.8	173.6	-178.1	0	0	111.8	C52 K53 Q54 S59 R60	C52-E56 WeakPolarHBondContact O-CG 3.46Å; C52-E56 PolarHBondContact O-N 2.95Å; K53-E56 PolarHBondContact O-N 3.02Å; Q54-E56 PolarHBondContact O-N 3.09Å; E56-S59 PolarHBondContact O-N 3.41Å; E56-R60 WeakPolarHBondContact O-CB 3.4Å; E56-R60 PolarHBondContact O-N 3.44Å
57	Y	97.2	Very high	96.5	Very high	135 Å²	135	98.1 Å²	98.1	53%	0.529	51%	0.506	S	S	.	.	H	α-helix	trans	-64.2	-43.8	176.3	-78.6	-61.5	0	0	0	112.4	K53 Q54 R60 L61	K53-Y57 HydrophobicContact CB-CE2 4.45Å; K53-Y57 WeakPolarHBondContact O-CD2 3.05Å; K53-Y57 PolarHBondContact O-N 3.49Å; Q54-Y57 PolarHBondContact O-N 3.43Å; Y57-R60 PolarHBondContact O-N 2.96Å; Y57-L61 VanDerWaalsContact O-CB 3.32Å; Y57-L61 WeakPolarHBondContact O-CB 3.42Å; Y57-L61 PolarHBondContact O-N 2.82Å
58	E	96.8	Very high	96.2	Very high	107 Å²	107	95.9 Å²	95.9	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-62.4	-42	176.5	-74.7	174.2	-169.7	0	0	111.9	Q54 A55 T62	Q54-E58 PolarHBondContact NE2-OE1 2.94Å; Q54-E58 WeakPolarHBondContact O-CG 3.42Å; Q54-E58 PolarHBondContact O-N 3.18Å; A55-E58 PolarHBondContact O-N 3.33Å; E58-T62 WeakPolarHBondContact O-CB 3.37Å; E58-T62 PolarHBondContact O-N 2.76Å; E58-T62 PolarHBondContact O-OG1 2.9Å
59	S	96.4	Very high	95.9	Very high	83 Å²	83	101.4 Å²	101.4	58%	0.58	51%	0.512	S	S	*	.	H	α-helix	trans	-63.9	-43.8	175.5	-171.6	0	0	0	0	111.8	A55 E56 T62 E63	A55-S59 WeakPolarHBondContact O-CB 3.49Å; A55-S59 PolarHBondContact O-N 2.92Å; E56-S59 PolarHBondContact O-N 3.41Å; S59-T62 PolarHBondContact O-N 3.28Å; S59-E63 PolarHBondContact O-N 3.47Å; S59-E63 VanDerWaalsContact O-N 3.09Å
60	R	97.2	Very high	95.6	Very high	144 Å²	144	101.1 Å²	101.1	54%	0.543	51%	0.509	S	S	.	.	H	α-helix	trans	-65.4	-44.3	178.9	-166.6	-179.7	81.9	-152.6	-1.3	111.3	E56 Y57 T62 E63 E64	E56-R60 WeakPolarHBondContact O-CB 3.4Å; E56-R60 PolarHBondContact O-N 3.44Å; Y57-R60 PolarHBondContact O-N 2.96Å; R60-T62 VanDerWaalsContact C-N 3.31Å; R60-T62 PolarHBondContact O-N 2.89Å; R60-E63 PolarHBondContact O-N 3.26Å; R60-E64 WeakPolarHBondContact CG-OE1 3.42Å; R60-E64 IonicContact NE-OE1 3.11Å; R60-E64 PolarHBondContact NE-OE1 2.91Å; R60-E64 WeakPolarHBondContact O-CG 3.43Å; R60-E64 PolarHBondContact O-N 3.44Å
61	L	96.9	Very high	95.2	Very high	97 Å²	97	102.4 Å²	102.4	51%	0.508	51%	0.511	S	S	.	.	H	α-helix	trans	-61.7	-41.3	177.5	-179.7	63	0	0	0	111.6	Y57 E63 E64 L65	Y57-L61 VanDerWaalsContact O-CB 3.32Å; Y57-L61 WeakPolarHBondContact O-CB 3.42Å; Y57-L61 PolarHBondContact O-N 2.82Å; L61-E63 VanDerWaalsContact C-N 3.33Å; L61-E63 PolarHBondContact O-N 3.42Å; L61-E64 PolarHBondContact O-N 3.47Å; L61-L65 HydrophobicContact CD1-CD1 4.41Å; L61-L65 HydrophobicContact CD1-CG 4.37Å; L61-L65 HydrophobicContact CG-CD1 4.2Å; L61-L65 WeakPolarHBondContact O-CB 3.39Å; L61-L65 VanDerWaalsContact O-CG 3.28Å; L61-L65 WeakPolarHBondContact O-CG 3.32Å; L61-L65 PolarHBondContact O-N 3.17Å
62	T	96.6	Very high	94.5	Very high	93 Å²	93	101 Å²	101	57%	0.571	50%	0.502	S	S	*	.	H	α-helix	trans	-62	-42.3	177.4	-59.6	0	0	0	0	111.4	E58 S59 R60 R66	E58-T62 WeakPolarHBondContact O-CB 3.37Å; E58-T62 PolarHBondContact O-N 2.76Å; E58-T62 PolarHBondContact O-OG1 2.9Å; S59-T62 PolarHBondContact O-N 3.28Å; R60-T62 VanDerWaalsContact C-N 3.31Å; R60-T62 PolarHBondContact O-N 2.89Å; T62-R66 WeakPolarHBondContact O-CB 3.37Å; T62-R66 PolarHBondContact O-N 3.33Å
63	E	96.5	Very high	93.7	Very high	92 Å²	92	99.9 Å²	99.9	43%	0.43	50%	0.498	S	S	.	.	H	α-helix	trans	-68.7	-43.2	177.7	-173.2	60.6	-166.8	0	0	112	S59 R60 L61 L65 R66 L67	S59-E63 PolarHBondContact O-N 3.47Å; S59-E63 VanDerWaalsContact O-N 3.09Å; R60-E63 PolarHBondContact O-N 3.26Å; L61-E63 VanDerWaalsContact C-N 3.33Å; L61-E63 PolarHBondContact O-N 3.42Å; E63-L65 VanDerWaalsContact C-N 3.34Å; E63-L65 PolarHBondContact O-N 3.47Å; E63-R66 WeakPolarHBondContact O-CB 2.94Å; E63-R66 PolarHBondContact O-N 2.95Å; E63-L67 HydrophobicContact CG-CD1 4.42Å; E63-L67 WeakPolarHBondContact O-CG 3.28Å; E63-L67 PolarHBondContact O-N 3.3Å
64	E	95.7	Very high	92.8	Very high	90 Å²	90	98.7 Å²	98.7	42%	0.421	50%	0.504	S	S	.	.	H	α-helix	trans	-59.4	-43.9	175.2	-73.9	174.1	-164.7	0	0	111.6	R60 L61 R66 L67 I68	R60-E64 WeakPolarHBondContact CG-OE1 3.42Å; R60-E64 IonicContact NE-OE1 3.11Å; R60-E64 PolarHBondContact NE-OE1 2.91Å; R60-E64 WeakPolarHBondContact O-CG 3.43Å; R60-E64 PolarHBondContact O-N 3.44Å; L61-E64 PolarHBondContact O-N 3.47Å; E64-R66 VanDerWaalsContact C-N 3.33Å; E64-R66 PolarHBondContact O-N 3.17Å; E64-L67 PolarHBondContact O-N 3.2Å; E64-I68 WeakPolarHBondContact O-CG1 3.16Å; E64-I68 PolarHBondContact O-N 3.41Å; E64-I68 VanDerWaalsContact O-N 3.17Å
65	L	95.2	Very high	91.8	Very high	104 Å²	104	101.1 Å²	101.1	55%	0.545	52%	0.515	S	S	.	.	H	α-helix	trans	-64.1	-38.6	175.9	-73	173.8	0	0	0	112.2	L61 E63 I68 R69	L61-L65 HydrophobicContact CD1-CD1 4.41Å; L61-L65 HydrophobicContact CD1-CG 4.37Å; L61-L65 HydrophobicContact CG-CD1 4.2Å; L61-L65 WeakPolarHBondContact O-CB 3.39Å; L61-L65 VanDerWaalsContact O-CG 3.28Å; L61-L65 WeakPolarHBondContact O-CG 3.32Å; L61-L65 PolarHBondContact O-N 3.17Å; E63-L65 VanDerWaalsContact C-N 3.34Å; E63-L65 PolarHBondContact O-N 3.47Å; L65-I68 PolarHBondContact O-N 3.01Å; L65-R69 VanDerWaalsContact O-CB 3.31Å; L65-R69 WeakPolarHBondContact O-CB 3.43Å; L65-R69 PolarHBondContact O-N 2.95Å
66	R	94.9	Very high	90.8	Very high	127 Å²	127	105.5 Å²	105.5	48%	0.479	53%	0.531	S	S	.	.	H	α-helix	trans	-63.1	-44.8	175.4	-178.3	-179	-177.3	176	1.6	111.4	T62 E63 E64 I68 R69 D70	T62-R66 WeakPolarHBondContact O-CB 3.37Å; T62-R66 PolarHBondContact O-N 3.33Å; E63-R66 WeakPolarHBondContact O-CB 2.94Å; E63-R66 PolarHBondContact O-N 2.95Å; E64-R66 VanDerWaalsContact C-N 3.33Å; E64-R66 PolarHBondContact O-N 3.17Å; R66-I68 PolarHBondContact O-N 3.15Å; R66-R69 PolarHBondContact O-N 2.89Å; R66-D70 WeakPolarHBondContact CG-OD2 3.42Å; R66-D70 IonicContact NE-OD2 3.15Å; R66-D70 PolarHBondContact NE-OD2 3.36Å; R66-D70 VanDerWaalsContact NE-OD2 3.15Å; R66-D70 WeakPolarHBondContact O-CB 3.31Å; R66-D70 VanDerWaalsContact O-CG 3.29Å; R66-D70 PolarHBondContact O-N 2.71Å
67	L	94.3	Very high	89.3	Confident	110 Å²	110	108.7 Å²	108.7	58%	0.576	55%	0.552	S	S	*	*	H	α-helix	trans	-63.4	-26	177.9	-72.4	172.8	0	0	0	113.3	E63 E64 P71	E63-L67 HydrophobicContact CG-CD1 4.42Å; E63-L67 WeakPolarHBondContact O-CG 3.28Å; E63-L67 PolarHBondContact O-N 3.3Å; E64-L67 PolarHBondContact O-N 3.2Å; L67-P71 WeakPolarHBondContact O-CD 3.44Å; L67-P71 WeakPolarHBondContact O-CG 3.41Å
68	I	91.6	Very high	88.9	Confident	111 Å²	111	107.4 Å²	107.4	57%	0.569	55%	0.553	S	S	*	*	H	α-helix	trans	-81.8	-43.4	172.9	-65.1	165.1	0	0	0	110.6	E64 L65 R66 T72	E64-I68 WeakPolarHBondContact O-CG1 3.16Å; E64-I68 PolarHBondContact O-N 3.41Å; E64-I68 VanDerWaalsContact O-N 3.17Å; L65-I68 PolarHBondContact O-N 3.01Å; R66-I68 PolarHBondContact O-N 3.15Å; I68-T72 WeakPolarHBondContact O-CB 3.2Å; I68-T72 PolarHBondContact O-N 3.03Å; I68-T72 PolarHBondContact O-OG1 2.86Å
69	R	92.1	Very high	88.5	Confident	154 Å²	154	107.4 Å²	107.4	58%	0.581	56%	0.556	S	S	*	*	H	α-helix	trans	-67.5	-46.4	-175.7	-174.2	-168	66.1	-159	-4.3	112.6	L65 R66 T72 A73	L65-R69 VanDerWaalsContact O-CB 3.31Å; L65-R69 WeakPolarHBondContact O-CB 3.43Å; L65-R69 PolarHBondContact O-N 2.95Å; R66-R69 PolarHBondContact O-N 2.89Å; R69-T72 PolarHBondContact O-N 2.94Å; R69-A73 WeakPolarHBondContact O-CB 3.38Å; R69-A73 PolarHBondContact O-N 3.35Å
70	D	91.2	Very high	88	Confident	59 Å²	59	108.8 Å²	108.8	32%	0.316	56%	0.555	S	S	.	*	H	α-helix	trans	-66.1	-41.4	-170.3	-65.8	-2	0	0	0	112.3	R66 S74	R66-D70 WeakPolarHBondContact CG-OD2 3.42Å; R66-D70 IonicContact NE-OD2 3.15Å; R66-D70 PolarHBondContact NE-OD2 3.36Å; R66-D70 VanDerWaalsContact NE-OD2 3.15Å; R66-D70 WeakPolarHBondContact O-CB 3.31Å; R66-D70 VanDerWaalsContact O-CG 3.29Å; R66-D70 PolarHBondContact O-N 2.71Å; D70-S74 PolarHBondContact O-N 3.34Å; D70-S74 PolarHBondContact O-OG 3.4Å
71	P	87.4	Confident	87.5	Confident	66 Å²	66	106.7 Å²	106.7	43%	0.429	56%	0.555	S	S	.	*	H	α-helix	trans	-67.7	-42.2	170.3	-22	34.9	0	0	0	113.3	L67 A73 S74 E75	L67-P71 WeakPolarHBondContact O-CD 3.44Å; L67-P71 WeakPolarHBondContact O-CG 3.41Å; P71-A73 VanDerWaalsContact C-N 3.26Å; P71-A73 PolarHBondContact O-N 2.92Å; P71-S74 WeakPolarHBondContact O-CB 3.31Å; P71-S74 PolarHBondContact O-N 3.37Å; P71-E75 PolarHBondContact O-N 3.34Å
72	T	82.1	Confident	86.9	Confident	67 Å²	67	107.3 Å²	107.3	41%	0.411	56%	0.558	S	S	.	*	H	α-helix	trans	-61.7	-36.9	178.4	-53.6	0	0	0	0	111.4	I68 R69 S74 E75 L76	I68-T72 WeakPolarHBondContact O-CB 3.2Å; I68-T72 PolarHBondContact O-N 3.03Å; I68-T72 PolarHBondContact O-OG1 2.86Å; R69-T72 PolarHBondContact O-N 2.94Å; T72-S74 VanDerWaalsContact C-N 3.34Å; T72-E75 PolarHBondContact O-N 3.49Å; T72-L76 HydrophobicContact CG2-CD1 4.21Å; T72-L76 VanDerWaalsContact O-CG 3.31Å; T72-L76 WeakPolarHBondContact O-CG 3.45Å; T72-L76 PolarHBondContact O-N 3.22Å
73	A	78.2	Confident	86.3	Confident	48 Å²	48	108.3 Å²	108.3	40%	0.397	56%	0.557	S	S	.	*	H	α-helix	trans	-65.7	-38.2	173.9	0	0	0	0	0	111.9	R69 P71 E75 L76 D77	R69-A73 WeakPolarHBondContact O-CB 3.38Å; R69-A73 PolarHBondContact O-N 3.35Å; P71-A73 VanDerWaalsContact C-N 3.26Å; P71-A73 PolarHBondContact O-N 2.92Å; A73-E75 VanDerWaalsContact C-N 3.33Å; A73-E75 PolarHBondContact O-N 3.3Å; A73-L76 PolarHBondContact O-N 2.99Å; A73-D77 PolarHBondContact O-N 3.45Å
74	S	77.3	Confident	85.5	Confident	88 Å²	88	109.4 Å²	109.4	62%	0.615	57%	0.566	S	S	*	*	H	α-helix	trans	-71.7	-24.8	178.4	-54.3	0	0	0	0	113.5	D70 P71 T72	D70-S74 PolarHBondContact O-N 3.34Å; D70-S74 PolarHBondContact O-OG 3.4Å; P71-S74 WeakPolarHBondContact O-CB 3.31Å; P71-S74 PolarHBondContact O-N 3.37Å; T72-S74 VanDerWaalsContact C-N 3.34Å
75	E	76.8	Confident	84.7	Confident	161 Å²	161	110.9 Å²	110.9	75%	0.752	58%	0.578	S	S	*	*	H	α-helix	trans	-81.9	-16.6	175	-71.5	179.2	-175	0	0	113.3	P71 T72 A73	P71-E75 PolarHBondContact O-N 3.34Å; T72-E75 PolarHBondContact O-N 3.49Å; A73-E75 VanDerWaalsContact C-N 3.33Å; A73-E75 PolarHBondContact O-N 3.3Å
76	L	75.3	Confident	83.9	Confident	145 Å²	145	111.5 Å²	111.5	76%	0.759	58%	0.58	S	S	*	*	H	α-helix	trans	-97	-16.1	-178.5	-71.4	172	0	0	0	114	T72 A73	T72-L76 HydrophobicContact CG2-CD1 4.21Å; T72-L76 VanDerWaalsContact O-CG 3.31Å; T72-L76 WeakPolarHBondContact O-CG 3.45Å; T72-L76 PolarHBondContact O-N 3.22Å; A73-L76 PolarHBondContact O-N 2.99Å
77	D	65.3	Low	82.9	Confident	202 Å²	202	110.1 Å²	110.1	100%	1.08	59%	0.59	S	S	*	*			trans	-84.3	0	170.9	-77.2	-19.5	0	0	0	111.5	A73	A73-D77 PolarHBondContact O-N 3.45Å

Retrieved 77 of 77 residues in 165.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).