A0A3Q0KPS8_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KPS8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 56 aa.

						>A0A3Q0KPS8_SCHMA|A0A3Q0KPS8
MEKIGDYIIGTMYLMDLRPTHSVYFISYKISYEKEAKVKLIINDSKLEPKHHHHHH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.1	Low	73.1	Confident	188 Å²	188	89.5 Å²	89.5	93%	0.926	47%	0.467	S	S	*	.				0	140.4	0	-68.2	-177	-171.2	0	0	107.1	Y28	M1-Y28 WeakPolarHBondContact CE-OH 3.48Å
2	E	70.6	Confident	73.2	Confident	129 Å²	129	90.7 Å²	90.7	60%	0.603	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128	136	-179	-164.1	176.4	169.9	0	0	108.9	I4 I9	E2-I4 HydrophobicContact CG-CG1 4.17Å; E2-I9 PolarHBondContact N-O 3.32Å; E2-I9 VanDerWaalsContact N-O 3.08Å; E2-I9 PolarHBondContact O-N 3.16Å
3	K	66.2	Low	73.1	Confident	151 Å²	151	95.2 Å²	95.2	66%	0.657	48%	0.479	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.4	117.1	174.5	-175.7	-178.8	177.6	-177.2	0	108	G5 Y7	K3-G5 VanDerWaalsContact CE-O 3.25Å; K3-G5 WeakPolarHBondContact CE-O 3.25Å; K3-Y7 WeakPolarHBondContact CA-O 3.42Å
4	I	70.5	Confident	72.9	Confident	91 Å²	91	94.2 Å²	94.2	47%	0.467	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	105.5	176.8	-58.7	-180	0	0	0	107.7	E2 D6 Y7 I9	E2-I4 HydrophobicContact CG-CG1 4.17Å; I4-D6 PolarHBondContact O-N 3.41Å; I4-Y7 PolarHBondContact N-O 2.96Å; I4-Y7 WeakPolarHBondContact O-CB 3.49Å; I4-Y7 PolarHBondContact O-N 3.41Å; I4-Y7 VanDerWaalsContact O-N 3.16Å; I4-I9 HydrophobicContact CD1-CD1 4.07Å
5	G	77.1	Confident	72.6	Confident	55 Å²	55	97.7 Å²	97.7	57%	0.567	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.5	-129.1	-170.7	0	0	0	0	0	111.5	K3 Y7	K3-G5 VanDerWaalsContact CE-O 3.25Å; K3-G5 WeakPolarHBondContact CE-O 3.25Å; G5-Y7 PolarHBondContact O-N 2.94Å
6	D	75.6	Confident	72.2	Confident	114 Å²	114	93.6 Å²	93.6	61%	0.61	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.1	8.4	178.8	-54.7	-43.6	0	0	0	113.7	I4	I4-D6 PolarHBondContact O-N 3.41Å
7	Y	71.2	Confident	71.9	Confident	81 Å²	81	98.1 Å²	98.1	32%	0.318	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.7	137.3	-175.8	-57.4	-84.8	0	0	0	111.6	K3 I4 G5 K29 I30	K3-Y7 WeakPolarHBondContact CA-O 3.42Å; I4-Y7 PolarHBondContact N-O 2.96Å; I4-Y7 WeakPolarHBondContact O-CB 3.49Å; I4-Y7 PolarHBondContact O-N 3.41Å; I4-Y7 VanDerWaalsContact O-N 3.16Å; G5-Y7 PolarHBondContact O-N 2.94Å; Y7-K29 HydrophobicContact CD1-CD 4.13Å; Y7-K29 HydrophobicContact CD1-CG 3.87Å; Y7-K29 HydrophobicContact CG-CD 4.47Å; Y7-K29 HydrophobicContact CG-CG 4.33Å; Y7-I30 CarbonylContact C-O 3.55Å; Y7-I30 VanDerWaalsContact CA-O 3.28Å; Y7-I30 WeakPolarHBondContact CA-O 3.47Å
8	I	73.9	Confident	71.5	Confident	40 Å²	40	100.9 Å²	100.9	21%	0.205	50%	0.5	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	125.2	162.4	-64.3	175.2	0	0	0	107.6	I30 Y32	I8-I30 PolarHBondContact N-O 3.12Å; I8-I30 PolarHBondContact O-N 2.84Å; I8-Y32 HydrophobicContact CD1-CE2 3.63Å; I8-Y32 WeakPolarHBondContact CD1-OH 3.28Å; I8-Y32 HydrophobicContact CG1-CE2 4.02Å
9	I	77.5	Confident	70.9	Confident	62 Å²	62	101.9 Å²	101.9	32%	0.318	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	129.3	175.3	-53.7	-175.8	0	0	0	108.6	E2 I4 K29	E2-I9 PolarHBondContact N-O 3.32Å; E2-I9 VanDerWaalsContact N-O 3.08Å; E2-I9 PolarHBondContact O-N 3.16Å; I4-I9 HydrophobicContact CD1-CD1 4.07Å; I9-K29 HydrophobicContact CG1-CG 4.35Å
10	G	76.3	Confident	70.3	Confident	3 Å²	3	99.3 Å²	99.3	3%	0.031	50%	0.504	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	146.4	179.7	0	0	0	0	0	111.9	S27 Y28	G10-S27 WeakPolarHBondContact O-CA 3.32Å; G10-Y28 PolarHBondContact N-O 3.38Å; G10-Y28 VanDerWaalsContact N-O 3.11Å; G10-Y28 PolarHBondContact O-N 2.69Å
11	T	77.3	Confident	69.7	Low	71 Å²	71	101.1 Å²	101.1	44%	0.436	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	128.4	169.6	-52.2	0	0	0	0	107.9	Y13 I26	T11-Y13 HydrophobicContact CG2-CE2 4.21Å; T11-I26 CarbonylContact C-O 3.52Å; T11-I26 WeakPolarHBondContact CA-O 3.33Å
12	M	74.6	Confident	69.3	Low	103 Å²	103	92.4 Å²	92.4	51%	0.507	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	138.1	172.4	-74.4	175.8	64.2	0	0	109.7	I26 Y28	M12-I26 HydrophobicContact CB-CB 4.48Å; M12-I26 PolarHBondContact N-O 3.04Å; M12-I26 PolarHBondContact O-N 3.42Å; M12-Y28 HydrophobicContact CG-CE1 4.02Å; M12-Y28 HydrophobicContact SD-CE1 3.92Å
13	Y	72.1	Confident	69	Low	149 Å²	149	88.6 Å²	88.6	58%	0.584	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.7	119.9	176.8	-58.2	-102.4	0	0	0	107.4	T11 F25	T11-Y13 HydrophobicContact CG2-CE2 4.21Å; Y13-F25 AromaticContact CD1-CD1 3.34Å; Y13-F25 HydrophobicContact CD1-CD1 3.34Å; Y13-F25 AromaticContact CD1-CE1 3.29Å; Y13-F25 HydrophobicContact CD1-CE1 3.29Å; Y13-F25 AromaticContact CE1-CD1 3.38Å; Y13-F25 HydrophobicContact CE1-CD1 3.38Å; Y13-F25 AromaticContact CE1-CE1 3.28Å; Y13-F25 HydrophobicContact CE1-CE1 3.28Å; Y13-F25 HydrophobicContact CG-CD1 4.34Å
14	L	69.9	Low	69	Low	82 Å²	82	84 Å²	84	43%	0.429	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	116.6	165.8	-74	94.9	0	0	0	108	Y24 I26	L14-Y24 HydrophobicContact CB-CD2 4.49Å; L14-Y24 PolarHBondContact N-O 2.9Å; L14-Y24 PolarHBondContact O-N 2.9Å; L14-I26 HydrophobicContact CD1-CD1 3.42Å; L14-I26 VanDerWaalsContact CD1-CD1 3.42Å; L14-I26 HydrophobicContact CD1-CG1 3.63Å
15	M	68.2	Low	68.9	Low	146 Å²	146	82.4 Å²	82.4	72%	0.719	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.2	121.8	170.6	-59.6	-176.4	-150	0	0	107.8
16	D	66.6	Low	68.6	Low	32 Å²	32	81.9 Å²	81.9	17%	0.171	41%	0.406	C	S	.	.	P	Polyproline II helix	trans	-79.3	120.8	168	179.4	4.8	0	0	0	109.3	R18 S22 Y24	D16-R18 VanDerWaalsContact CG-NE 3.31Å; D16-R18 PolarHBondContact O-N 2.8Å; D16-R18 WeakPolarHBondContact OD1-CB 3.14Å; D16-R18 VanDerWaalsContact OD1-CG 3.27Å; D16-R18 WeakPolarHBondContact OD1-CG 3.15Å; D16-R18 PolarHBondContact OD1-N 3.08Å; D16-R18 VanDerWaalsContact OD1-N 3.07Å; D16-R18 IonicContact OD1-NE 3.11Å; D16-R18 PolarHBondContact OD1-NE 2.94Å; D16-R18 VanDerWaalsContact OD1-NE 3.11Å; D16-R18 IonicContact OD2-CZ 3.07Å; D16-R18 IonicContact OD2-NE 2.73Å; D16-R18 PolarHBondContact OD2-NE 3.06Å; D16-R18 IonicContact OD2-NH2 2.64Å; D16-R18 PolarHBondContact OD2-NH2 3.45Å; D16-S22 PolarHBondContact N-O 2.86Å; D16-Y24 HydrophobicContact CB-CE2 3.98Å
17	L	66	Low	68.3	Low	171 Å²	171	78.3 Å²	78.3	90%	0.895	39%	0.39	S	S	*	.			trans	-71.7	-4.6	-177.9	-67.3	171.1	0	0	0	113.2
18	R	65.3	Low	68.3	Low	149 Å²	149	76.1 Å²	76.1	56%	0.562	38%	0.381	S	S	*	.	S	Bend	trans	-64.7	150.8	173.3	-68.1	179.8	-63.8	176.6	3.2	109.9	D16 T20 H21	D16-R18 VanDerWaalsContact CG-NE 3.31Å; D16-R18 PolarHBondContact O-N 2.8Å; D16-R18 WeakPolarHBondContact OD1-CB 3.14Å; D16-R18 VanDerWaalsContact OD1-CG 3.27Å; D16-R18 WeakPolarHBondContact OD1-CG 3.15Å; D16-R18 PolarHBondContact OD1-N 3.08Å; D16-R18 VanDerWaalsContact OD1-N 3.07Å; D16-R18 IonicContact OD1-NE 3.11Å; D16-R18 PolarHBondContact OD1-NE 2.94Å; D16-R18 VanDerWaalsContact OD1-NE 3.11Å; D16-R18 IonicContact OD2-CZ 3.07Å; D16-R18 IonicContact OD2-NE 2.73Å; D16-R18 PolarHBondContact OD2-NE 3.06Å; D16-R18 IonicContact OD2-NH2 2.64Å; D16-R18 PolarHBondContact OD2-NH2 3.45Å; R18-T20 PolarHBondContact O-N 3.11Å; R18-H21 PolarHBondContact O-N 3.11Å
19	P	59.4	Low	68.2	Low	120 Å²	120	79 Å²	79	78%	0.779	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-15.6	-178.1	-23.7	32.8	0	0	0	114.1	H21	P19-H21 PolarHBondContact O-N 2.93Å; P19-H21 PolarHBondContact O-ND1 3.01Å
20	T	59.8	Low	67.8	Low	48 Å²	48	79.3 Å²	79.3	29%	0.294	39%	0.394	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.4	-9.5	177.9	57.2	0	0	0	0	114.3	R18 S22 K46	R18-T20 PolarHBondContact O-N 3.11Å; T20-S22 VanDerWaalsContact C-N 3.27Å; T20-S22 PolarHBondContact O-N 2.81Å; T20-S22 VanDerWaalsContact O-N 3.14Å; T20-K46 VanDerWaalsContact CA-NZ 3.35Å; T20-K46 HydrophobicContact CG2-CD 4.16Å; T20-K46 VanDerWaalsContact O-CE 3.29Å; T20-K46 WeakPolarHBondContact O-CE 3.4Å
21	H	57	Low	67.6	Low	139 Å²	139	79.8 Å²	79.8	64%	0.644	40%	0.396	S	S	*	.			trans	36.4	55.7	175.5	-61.9	98.5	0	0	0	113.1	R18 P19 V23	R18-H21 PolarHBondContact O-N 3.11Å; P19-H21 PolarHBondContact O-N 2.93Å; P19-H21 PolarHBondContact O-ND1 3.01Å; H21-V23 PolarHBondContact O-N 2.88Å
22	S	61.1	Low	67	Low	4 Å²	4	84.8 Å²	84.8	3%	0.028	41%	0.409	C	S	.	.	P	Polyproline II helix	trans	-77.2	118.2	171.3	-58.3	0	0	0	0	107.4	D16 T20 Y24 D44	D16-S22 PolarHBondContact N-O 2.86Å; T20-S22 VanDerWaalsContact C-N 3.27Å; T20-S22 PolarHBondContact O-N 2.81Å; T20-S22 VanDerWaalsContact O-N 3.14Å; S22-Y24 VanDerWaalsContact CB-CZ 3.45Å; S22-Y24 VanDerWaalsContact CB-OH 3.26Å; S22-Y24 WeakPolarHBondContact CB-OH 3.49Å; S22-Y24 WeakPolarHBondContact O-CE2 3.34Å; S22-D44 PolarHBondContact OG-OD1 3.11Å
23	V	62.7	Low	66.7	Low	49 Å²	49	88 Å²	88	30%	0.297	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	116.3	176.7	-177.4	0	0	0	0	107.7	H21 F25	H21-V23 PolarHBondContact O-N 2.88Å; V23-F25 HydrophobicContact CB-CE2 4.35Å; V23-F25 HydrophobicContact CB-CZ 4.28Å; V23-F25 HydrophobicContact CG1-CE1 3.83Å; V23-F25 HydrophobicContact CG1-CE2 3.83Å; V23-F25 HydrophobicContact CG1-CZ 3.43Å; V23-F25 VanDerWaalsContact CG1-CZ 3.43Å
24	Y	67.4	Low	66.1	Low	55 Å²	55	87.6 Å²	87.6	22%	0.216	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	134.8	179.1	-53.3	-87.6	0	0	0	109.6	L14 D16 S22 I42	L14-Y24 HydrophobicContact CB-CD2 4.49Å; L14-Y24 PolarHBondContact N-O 2.9Å; L14-Y24 PolarHBondContact O-N 2.9Å; D16-Y24 HydrophobicContact CB-CE2 3.98Å; S22-Y24 VanDerWaalsContact CB-CZ 3.45Å; S22-Y24 VanDerWaalsContact CB-OH 3.26Å; S22-Y24 WeakPolarHBondContact CB-OH 3.49Å; S22-Y24 WeakPolarHBondContact O-CE2 3.34Å; Y24-I42 HydrophobicContact CD1-CB 4.06Å; Y24-I42 HydrophobicContact CD1-CG1 3.94Å; Y24-I42 HydrophobicContact CD1-CG2 3.59Å; Y24-I42 HydrophobicContact CE1-CB 4.37Å; Y24-I42 HydrophobicContact CE1-CG1 4.37Å; Y24-I42 HydrophobicContact CE1-CG2 3.46Å; Y24-I42 VanDerWaalsContact CE1-CG2 3.46Å
25	F	68.1	Low	65.9	Low	58 Å²	58	92.1 Å²	92.1	25%	0.254	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	118.3	175.7	-51.1	-91	0	0	0	108.7	Y13 V23 I41 N43	Y13-F25 AromaticContact CD1-CD1 3.34Å; Y13-F25 HydrophobicContact CD1-CD1 3.34Å; Y13-F25 AromaticContact CD1-CE1 3.29Å; Y13-F25 HydrophobicContact CD1-CE1 3.29Å; Y13-F25 AromaticContact CE1-CD1 3.38Å; Y13-F25 HydrophobicContact CE1-CD1 3.38Å; Y13-F25 AromaticContact CE1-CE1 3.28Å; Y13-F25 HydrophobicContact CE1-CE1 3.28Å; Y13-F25 HydrophobicContact CG-CD1 4.34Å; V23-F25 HydrophobicContact CB-CE2 4.35Å; V23-F25 HydrophobicContact CB-CZ 4.28Å; V23-F25 HydrophobicContact CG1-CE1 3.83Å; V23-F25 HydrophobicContact CG1-CE2 3.83Å; V23-F25 HydrophobicContact CG1-CZ 3.43Å; V23-F25 VanDerWaalsContact CG1-CZ 3.43Å; F25-I41 PolarHBondContact N-O 2.94Å; F25-I41 CarbonylContact O-C 3.56Å; F25-I41 PolarHBondContact O-N 3.48Å; F25-N43 HydrophobicContact CD2-CB 4.19Å; F25-N43 HydrophobicContact CE2-CB 3.86Å
26	I	69.8	Low	65.8	Low	43 Å²	43	87.9 Å²	87.9	22%	0.221	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	115	172.1	-45	-161.1	0	0	0	107.5	T11 M12 L14 V38 L40	T11-I26 CarbonylContact C-O 3.52Å; T11-I26 WeakPolarHBondContact CA-O 3.33Å; M12-I26 HydrophobicContact CB-CB 4.48Å; M12-I26 PolarHBondContact N-O 3.04Å; M12-I26 PolarHBondContact O-N 3.42Å; L14-I26 HydrophobicContact CD1-CD1 3.42Å; L14-I26 VanDerWaalsContact CD1-CD1 3.42Å; L14-I26 HydrophobicContact CD1-CG1 3.63Å; I26-V38 HydrophobicContact CG2-CG1 3.7Å; I26-L40 HydrophobicContact CB-CD1 4.36Å; I26-L40 HydrophobicContact CD1-CD1 3.86Å; I26-L40 HydrophobicContact CG1-CD1 3.54Å
27	S	70.2	Confident	65.7	Low	39 Å²	39	94.4 Å²	94.4	27%	0.273	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	127.9	171.1	-60	0	0	0	0	108.9	G10 K39	G10-S27 WeakPolarHBondContact O-CA 3.32Å; S27-K39 PolarHBondContact N-O 3.14Å; S27-K39 CarbonylContact O-C 3.57Å; S27-K39 PolarHBondContact O-N 3.42Å
28	Y	71.2	Confident	65.7	Low	36 Å²	36	90.8 Å²	90.8	14%	0.141	44%	0.443	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	144.8	175.7	57.5	-97.2	0	0	0	111.2	M1 G10 M12 I30	M1-Y28 WeakPolarHBondContact CE-OH 3.48Å; G10-Y28 PolarHBondContact N-O 3.38Å; G10-Y28 VanDerWaalsContact N-O 3.11Å; G10-Y28 PolarHBondContact O-N 2.69Å; M12-Y28 HydrophobicContact CG-CE1 4.02Å; M12-Y28 HydrophobicContact SD-CE1 3.92Å; Y28-I30 HydrophobicContact CD2-CD1 3.57Å; Y28-I30 HydrophobicContact CD2-CG1 3.82Å; Y28-I30 HydrophobicContact CE2-CD1 3.76Å; Y28-I30 HydrophobicContact CE2-CG1 4.45Å
29	K	71.6	Confident	65.7	Low	99 Å²	99	90.6 Å²	90.6	43%	0.43	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	109.8	171	-179.6	174.4	177.6	176.4	0	107.2	Y7 I9 K37	Y7-K29 HydrophobicContact CD1-CD 4.13Å; Y7-K29 HydrophobicContact CD1-CG 3.87Å; Y7-K29 HydrophobicContact CG-CD 4.47Å; Y7-K29 HydrophobicContact CG-CG 4.33Å; I9-K29 HydrophobicContact CG1-CG 4.35Å; K29-K37 PolarHBondContact N-O 2.88Å; K29-K37 PolarHBondContact O-N 3.21Å; K29-K37 VanDerWaalsContact O-N 3.11Å
30	I	70.1	Confident	66.1	Low	70 Å²	70	89.5 Å²	89.5	36%	0.359	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	131.2	177.9	-59.2	164.8	0	0	0	106.9	Y7 I8 Y28 A36	Y7-I30 CarbonylContact C-O 3.55Å; Y7-I30 VanDerWaalsContact CA-O 3.28Å; Y7-I30 WeakPolarHBondContact CA-O 3.47Å; I8-I30 PolarHBondContact N-O 3.12Å; I8-I30 PolarHBondContact O-N 2.84Å; Y28-I30 HydrophobicContact CD2-CD1 3.57Å; Y28-I30 HydrophobicContact CD2-CG1 3.82Å; Y28-I30 HydrophobicContact CE2-CD1 3.76Å; Y28-I30 HydrophobicContact CE2-CG1 4.45Å; I30-A36 HydrophobicContact CB-CB 4.41Å; I30-A36 HydrophobicContact CG1-CB 3.87Å; I30-A36 HydrophobicContact CG2-CB 4.4Å
31	S	71.2	Confident	66.4	Low	12 Å²	12	90.8 Å²	90.8	8%	0.084	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	144	166.8	91	0	0	0	0	108.3	E33 K34	S31-E33 PolarHBondContact O-N 3.4Å; S31-K34 VanDerWaalsContact OG-C 3.27Å; S31-K34 WeakPolarHBondContact OG-CA 3.28Å; S31-K34 WeakPolarHBondContact OG-CB 3.26Å; S31-K34 PolarHBondContact OG-N 2.94Å; S31-K34 PolarHBondContact OG-O 2.89Å
32	Y	66	Low	66.7	Low	176 Å²	176	88.4 Å²	88.4	69%	0.69	43%	0.428	S	S	*	.	S	Bend	trans	-64.8	-28.8	-178.6	-81.4	-84.5	0	0	0	112.9	I8	I8-Y32 HydrophobicContact CD1-CE2 3.63Å; I8-Y32 WeakPolarHBondContact CD1-OH 3.28Å; I8-Y32 HydrophobicContact CG1-CE2 4.02Å
33	E	67.1	Low	66.7	Low	171 Å²	171	92.7 Å²	92.7	80%	0.799	45%	0.451	S	S	*	.	S	Bend	trans	-104.1	-17.4	-175	-62.3	-169.1	163.2	0	0	114.5	S31	S31-E33 PolarHBondContact O-N 3.4Å
34	K	60.6	Low	66.7	Low	141 Å²	141	92.1 Å²	92.1	61%	0.613	45%	0.446	S	S	*	.	S	Bend	trans	-132.9	144.6	-172	-46.4	-177.6	178.1	177.3	0	110.7	S31	S31-K34 VanDerWaalsContact OG-C 3.27Å; S31-K34 WeakPolarHBondContact OG-CA 3.28Å; S31-K34 WeakPolarHBondContact OG-CB 3.26Å; S31-K34 PolarHBondContact OG-N 2.94Å; S31-K34 PolarHBondContact OG-O 2.89Å
35	E	65.9	Low	66.3	Low	176 Å²	176	93.4 Å²	93.4	82%	0.822	46%	0.463	S	S	*	.			trans	-34.1	133.7	178.7	-69.8	178.4	150.6	0	0	113.8	K37	E35-K37 PolarHBondContact O-N 3.05Å
36	A	64.2	Low	65.7	Low	57 Å²	57	96.1 Å²	96.1	47%	0.471	48%	0.475	S	S	.	.	P	Polyproline II helix	trans	-69.9	127	174.6	0	0	0	0	0	110.2	I30	I30-A36 HydrophobicContact CB-CB 4.41Å; I30-A36 HydrophobicContact CG1-CB 3.87Å; I30-A36 HydrophobicContact CG2-CB 4.4Å
37	K	64.4	Low	64.9	Low	170 Å²	170	100 Å²	100	74%	0.739	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.6	116.4	169	-69.2	-173.5	-179.7	-177.3	0	108.5	K29 E35	K29-K37 PolarHBondContact N-O 2.88Å; K29-K37 PolarHBondContact O-N 3.21Å; K29-K37 VanDerWaalsContact O-N 3.11Å; E35-K37 PolarHBondContact O-N 3.05Å
38	V	66.4	Low	64	Low	95 Å²	95	105.5 Å²	105.5	58%	0.576	52%	0.517	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.6	125.6	177.5	-176.4	0	0	0	0	108.6	I26	I26-V38 HydrophobicContact CG2-CG1 3.7Å
39	K	66.1	Low	62.9	Low	144 Å²	144	108.5 Å²	108.5	63%	0.626	54%	0.541	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.4	106.1	173.3	-170.3	179	-179.6	-177.8	0	108.5	S27 I41	S27-K39 PolarHBondContact N-O 3.14Å; S27-K39 CarbonylContact O-C 3.57Å; S27-K39 PolarHBondContact O-N 3.42Å; K39-I41 HydrophobicContact CD-CD1 4.41Å; K39-I41 HydrophobicContact CD-CG1 4.47Å; K39-I41 HydrophobicContact CG-CG1 4.23Å
40	L	67.7	Low	62.1	Low	97 Å²	97	111.6 Å²	111.6	51%	0.508	55%	0.554	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-82.1	120.8	172.7	178.7	61.4	0	0	0	109	I26 I42	I26-L40 HydrophobicContact CB-CD1 4.36Å; I26-L40 HydrophobicContact CD1-CD1 3.86Å; I26-L40 HydrophobicContact CG1-CD1 3.54Å; L40-I42 HydrophobicContact CD1-CG1 4.38Å; L40-I42 HydrophobicContact CD2-CD1 4.06Å; L40-I42 HydrophobicContact CD2-CG1 4.11Å; L40-I42 HydrophobicContact CG-CD1 4.4Å; L40-I42 HydrophobicContact CG-CG1 3.92Å
41	I	65.3	Low	61.2	Low	75 Å²	75	115.2 Å²	115.2	39%	0.385	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-112.7	106.1	174.4	-57.5	176.5	0	0	0	107.3	F25 K39	F25-I41 PolarHBondContact N-O 2.94Å; F25-I41 CarbonylContact O-C 3.56Å; F25-I41 PolarHBondContact O-N 3.48Å; K39-I41 HydrophobicContact CD-CD1 4.41Å; K39-I41 HydrophobicContact CD-CG1 4.47Å; K39-I41 HydrophobicContact CG-CG1 4.23Å
42	I	64.9	Low	60.2	Low	90 Å²	90	121.9 Å²	121.9	46%	0.462	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.8	109.1	177.8	-60.5	175.9	0	0	0	107.6	Y24 L40 D44	Y24-I42 HydrophobicContact CD1-CB 4.06Å; Y24-I42 HydrophobicContact CD1-CG1 3.94Å; Y24-I42 HydrophobicContact CD1-CG2 3.59Å; Y24-I42 HydrophobicContact CE1-CB 4.37Å; Y24-I42 HydrophobicContact CE1-CG1 4.37Å; Y24-I42 HydrophobicContact CE1-CG2 3.46Å; Y24-I42 VanDerWaalsContact CE1-CG2 3.46Å; L40-I42 HydrophobicContact CD1-CG1 4.38Å; L40-I42 HydrophobicContact CD2-CD1 4.06Å; L40-I42 HydrophobicContact CD2-CG1 4.11Å; L40-I42 HydrophobicContact CG-CD1 4.4Å; L40-I42 HydrophobicContact CG-CG1 3.92Å; I42-D44 HydrophobicContact CG2-CB 3.97Å; I42-D44 PolarHBondContact O-N 2.79Å
43	N	60.9	Low	59.3	Low	93 Å²	93	120.7 Å²	120.7	50%	0.497	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.6	79.9	169.3	-169.7	17.7	0	0	0	108.9	F25 S45	F25-N43 HydrophobicContact CD2-CB 4.19Å; F25-N43 HydrophobicContact CE2-CB 3.86Å; N43-S45 PolarHBondContact O-N 2.64Å
44	D	61.5	Low	58.2	Low	37 Å²	37	121.1 Å²	121.1	20%	0.198	60%	0.601	C	S	.	*			trans	-93.6	94.8	171.1	-168.4	2.4	0	0	0	108.3	S22 I42 K46 L47	S22-D44 PolarHBondContact OG-OD1 3.11Å; I42-D44 HydrophobicContact CG2-CB 3.97Å; I42-D44 PolarHBondContact O-N 2.79Å; D44-K46 PolarHBondContact O-N 3.07Å; D44-K46 VanDerWaalsContact OD1-CB 3.28Å; D44-K46 WeakPolarHBondContact OD1-CB 3.27Å; D44-K46 PolarHBondContact OD1-N 3.21Å; D44-K46 VanDerWaalsContact OD1-N 3.12Å; D44-L47 HydrophobicContact CB-CB 4.3Å; D44-L47 HydrophobicContact CB-CD1 3.72Å; D44-L47 HydrophobicContact CB-CG 3.7Å; D44-L47 WeakPolarHBondContact O-CB 3.25Å; D44-L47 PolarHBondContact O-N 2.73Å
45	S	59.3	Low	57.3	Low	83 Å²	83	121.4 Å²	121.4	58%	0.58	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.6	-11.6	173.7	57.2	0	0	0	0	113	N43	N43-S45 PolarHBondContact O-N 2.64Å
46	K	55.7	Low	56.2	Low	114 Å²	114	125.2 Å²	125.2	50%	0.496	62%	0.621	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.1	-10.8	174.3	-54.2	-168	173.2	-150.9	0	114.5	T20 D44 E48	T20-K46 VanDerWaalsContact CA-NZ 3.35Å; T20-K46 HydrophobicContact CG2-CD 4.16Å; T20-K46 VanDerWaalsContact O-CE 3.29Å; T20-K46 WeakPolarHBondContact O-CE 3.4Å; D44-K46 PolarHBondContact O-N 3.07Å; D44-K46 VanDerWaalsContact OD1-CB 3.28Å; D44-K46 WeakPolarHBondContact OD1-CB 3.27Å; D44-K46 PolarHBondContact OD1-N 3.21Å; D44-K46 VanDerWaalsContact OD1-N 3.12Å; K46-E48 VanDerWaalsContact C-N 3.26Å
47	L	52.2	Low	55.8	Low	126 Å²	126	128.6 Å²	128.6	66%	0.66	63%	0.629	S	S	*	*			trans	-78.3	-13	173.2	-72.5	176.1	0	0	0	112.5	D44 P49	D44-L47 HydrophobicContact CB-CB 4.3Å; D44-L47 HydrophobicContact CB-CD1 3.72Å; D44-L47 HydrophobicContact CB-CG 3.7Å; D44-L47 WeakPolarHBondContact O-CB 3.25Å; D44-L47 PolarHBondContact O-N 2.73Å; L47-P49 VanDerWaalsContact O-CD 3.25Å; L47-P49 WeakPolarHBondContact O-CD 3.29Å; L47-P49 VanDerWaalsContact O-N 3.1Å
48	E	51.5	Low	55.3	Low	153 Å²	153	126.4 Å²	126.4	72%	0.715	62%	0.623	S	S	*	*	S	Bend	trans	-59.8	118	165.8	-71.1	-135.1	128.6	0	0	107.6	K46 K50	K46-E48 VanDerWaalsContact C-N 3.26Å; E48-K50 PolarHBondContact O-N 2.78Å
49	P	49.2	Very low	54.7	Low	99 Å²	99	128.2 Å²	128.2	64%	0.643	63%	0.626	S	S	*	*			trans	-59.9	109.3	174.4	23.5	-29	0	0	0	105.2	L47 H51	L47-P49 VanDerWaalsContact O-CD 3.25Å; L47-P49 WeakPolarHBondContact O-CD 3.29Å; L47-P49 VanDerWaalsContact O-N 3.1Å; P49-H51 PolarHBondContact O-N 2.92Å; P49-H51 PolarHBondContact O-ND1 2.81Å
50	K	54	Low	54	Low	165 Å²	165	127.2 Å²	127.2	72%	0.717	63%	0.625	S	S	*	*			trans	-53.4	101.9	169.3	-70.3	-175.9	179	-176.9	0	104.7	E48 H52	E48-K50 PolarHBondContact O-N 2.78Å; K50-H52 PolarHBondContact O-N 3.35Å
51	H	50.5	Low	53.2	Low	146 Å²	146	129.1 Å²	129.1	68%	0.676	63%	0.633	S	S	*	*			trans	-64.7	88.6	168.5	-77	58	0	0	0	103.7	P49 H53	P49-H51 PolarHBondContact O-N 2.92Å; P49-H51 PolarHBondContact O-ND1 2.81Å; H51-H53 PolarHBondContact O-N 2.72Å
52	H	51.7	Low	52.4	Low	152 Å²	152	132.7 Å²	132.7	70%	0.704	65%	0.649	S	S	*	*			trans	-69.2	75.8	165.3	-78.6	-26.9	0	0	0	106.3	K50 H54	K50-H52 PolarHBondContact O-N 3.35Å; H52-H54 PolarHBondContact O-N 2.99Å
53	H	45.8	Very low	51.5	Low	151 Å²	151	135.8 Å²	135.8	70%	0.699	66%	0.663	S	S	*	*			trans	-66.1	79.3	147.5	-75.7	168.5	0	0	0	106.4	H51 H55	H51-H53 PolarHBondContact O-N 2.72Å; H53-H55 VanDerWaalsContact C-N 3.28Å; H53-H55 PolarHBondContact O-N 2.73Å
54	H	45.3	Very low	50.7	Low	179 Å²	179	139.1 Å²	139.1	83%	0.829	68%	0.676	S	S	*	*			trans	-86.2	91.1	152.4	-116	71.9	0	0	0	106.4	H52	H52-H54 PolarHBondContact O-N 2.99Å
55	H	41.1	Very low	49.8	Very low	147 Å²	147	147.6 Å²	147.6	68%	0.681	72%	0.715	S	S	*	*			trans	-54.3	144.2	159.3	-105.1	-92.1	0	0	0	109.9	H53	H53-H55 VanDerWaalsContact C-N 3.28Å; H53-H55 PolarHBondContact O-N 2.73Å
56	H	42	Very low	49	Very low	256 Å²	256	153.5 Å²	153.5	100%	1.185	73%	0.728	S	S	*	*			trans	80.6	0	162.4	-86.8	-75.2	0	0	0	119.2

Retrieved 56 of 56 residues in 30.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).