A0A3Q0KQ20_SCHMA Loading...

Essential MCU regulator, mitochondrial

Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria.

AlphaFold DB , UniProt , Accession A0A3Q0KQ20, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 67 aa.

						>A0A3Q0KQ20_SCHMA|A0A3Q0KQ20
MRCMSSDTTYRGAYKVSGAFCDRPQIMRFGILRSLAVGMPFIFVGSMISRTGAELLEEYDIFTPQDD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.2	Very low	53.3	Low	251 Å²	251	155.8 Å²	155.8	100%	1.236	79%	0.794	S	S	*	*				0	110	0	-90.8	165.8	167.1	0	0	108.8
2	R	46.5	Very low	55.5	Low	245 Å²	245	146.8 Å²	146.8	93%	0.925	77%	0.769	S	S	*	*			trans	-104.1	95.1	175	-153.9	-175.2	-80.7	176.3	-4.2	106.1	M4	R2-M4 PolarHBondContact O-N 3.28Å
3	C	45.9	Very low	57.8	Low	121 Å²	121	140 Å²	140	82%	0.818	75%	0.747	S	S	*	*			trans	-72.4	107.6	178.1	-161.7	0	0	0	0	107.8	S5	C3-S5 PolarHBondContact O-N 2.89Å
4	M	47	Very low	60	Low	176 Å²	176	139.5 Å²	139.5	87%	0.867	73%	0.731	S	S	*	*			trans	-78.5	98.5	167.9	-75.5	170.3	87.6	0	0	106.8	R2 S6	R2-M4 PolarHBondContact O-N 3.28Å; M4-S6 PolarHBondContact O-N 3.35Å
5	S	54.5	Low	61.9	Low	87 Å²	87	135.3 Å²	135.3	61%	0.608	70%	0.704	S	S	*	*			trans	-77.8	108.5	172.7	62	0	0	0	0	109.3	C3 D7	C3-S5 PolarHBondContact O-N 2.89Å; S5-D7 PolarHBondContact O-N 3.1Å
6	S	55.9	Low	63.5	Low	117 Å²	117	135.8 Å²	135.8	82%	0.818	71%	0.714	S	S	*	*			trans	-69.4	86.2	169.9	-48.7	0	0	0	0	109.9	M4	M4-S6 PolarHBondContact O-N 3.35Å
7	D	56	Low	65	Low	93 Å²	93	133.6 Å²	133.6	50%	0.497	71%	0.713	S	S	.	*			trans	-99.9	93.3	171.6	-102.3	-44.9	0	0	0	109.9	S5 T9	S5-D7 PolarHBondContact O-N 3.1Å; D7-T9 PolarHBondContact O-N 3.44Å; D7-T9 PolarHBondContact OD1-OG1 3.46Å
8	T	56.9	Low	66.4	Low	152 Å²	152	129.2 Å²	129.2	93%	0.933	70%	0.704	S	S	*	*			trans	-79.3	35.7	158.7	29	0	0	0	0	111.3
9	T	59.7	Low	67.7	Low	94 Å²	94	124.9 Å²	124.9	58%	0.577	69%	0.688	S	S	*	*	S	Bend	trans	-100.4	122.3	174.2	-57.8	0	0	0	0	108.1	D7 R11	D7-T9 PolarHBondContact O-N 3.44Å; D7-T9 PolarHBondContact OD1-OG1 3.46Å; T9-R11 PolarHBondContact O-N 3.07Å
10	Y	59.8	Low	68.8	Low	228 Å²	228	125.8 Å²	125.8	89%	0.894	69%	0.685	S	S	*	*			trans	-56	102.8	178	-162.8	-90.5	0	0	0	109.5	G12	Y10-G12 PolarHBondContact O-N 3.26Å; Y10-G12 VanDerWaalsContact O-N 3.09Å
11	R	65.6	Low	69.7	Low	150 Å²	150	122.2 Å²	122.2	57%	0.566	67%	0.668	S	S	*	*			trans	-67.4	112.5	-179.3	-77.2	-159.4	176	-148.6	-0.9	108.6	T9	T9-R11 PolarHBondContact O-N 3.07Å
12	G	79.5	Confident	72.2	Confident	47 Å²	47	116.2 Å²	116.2	49%	0.485	64%	0.642	S	S	.	*			trans	-63.7	-167	169.6	0	0	0	0	0	112.3	Y10 Y14	Y10-G12 PolarHBondContact O-N 3.26Å; Y10-G12 VanDerWaalsContact O-N 3.09Å; G12-Y14 PolarHBondContact O-N 3.38Å
13	A	86.2	Confident	74.2	Confident	59 Å²	59	115.4 Å²	115.4	49%	0.488	64%	0.639	S	S	.	*	S	Bend	trans	-67.7	-4.2	-175	0	0	0	0	0	115.4	C21	A13-C21 PolarHBondContact O-N 3.44Å
14	Y	88.7	Confident	76.2	Confident	133 Å²	133	114.8 Å²	114.8	52%	0.522	63%	0.633	S	S	.	*	B	Isolated β-bridge	trans	-125.7	146.2	-169.9	-55.2	-87.5	0	0	0	112.2	G12 A19 F20	G12-Y14 PolarHBondContact O-N 3.38Å; Y14-A19 CarbonylContact C-O 3.58Å; Y14-A19 WeakPolarHBondContact CA-O 3.32Å; Y14-F20 AromaticContact CD1-CD1 3.88Å; Y14-F20 HydrophobicContact CD1-CD1 3.88Å; Y14-F20 AromaticContact CD1-CE1 3.97Å; Y14-F20 HydrophobicContact CD1-CE1 3.97Å; Y14-F20 HydrophobicContact CD1-CG 4.37Å; Y14-F20 AromaticContact CE1-CD1 3.5Å; Y14-F20 HydrophobicContact CE1-CD1 3.5Å; Y14-F20 VanDerWaalsContact CE1-CD1 3.5Å; Y14-F20 HydrophobicContact CE1-CD2 4.46Å; Y14-F20 AromaticContact CE1-CE1 3.1Å; Y14-F20 HydrophobicContact CE1-CE1 3.1Å; Y14-F20 HydrophobicContact CE1-CE2 4.14Å; Y14-F20 HydrophobicContact CE1-CG 4.17Å; Y14-F20 AromaticContact CE1-CZ 3.46Å; Y14-F20 HydrophobicContact CE1-CZ 3.46Å; Y14-F20 VanDerWaalsContact CE1-CZ 3.46Å; Y14-F20 HydrophobicContact CE2-CE1 4.46Å; Y14-F20 AromaticContact CZ-CE1 3.4Å; Y14-F20 VanDerWaalsContact CZ-CE1 3.4Å; Y14-F20 AromaticContact CZ-CZ 3.9Å; Y14-F20 WeakPolarHBondContact OH-CE1 3.44Å
15	K	88.9	Confident	78.3	Confident	77 Å²	77	115.9 Å²	115.9	34%	0.335	64%	0.636	S	S	.	*			trans	-77.2	163.3	168.6	-58.6	-178.7	-174.9	-178	0	109.2	S17 G18 A19 D22	K15-S17 PolarHBondContact O-N 3.13Å; K15-S17 VanDerWaalsContact O-N 3.09Å; K15-G18 PolarHBondContact O-N 3.39Å; K15-A19 PolarHBondContact N-O 3.23Å; K15-D22 IonicContact NZ-OD2 2.85Å; K15-D22 PolarHBondContact NZ-OD2 3.45Å
16	V	86.2	Confident	80.2	Confident	142 Å²	142	119.1 Å²	119.1	86%	0.861	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	-27.5	176.7	-179.2	0	0	0	0	112	G18	V16-G18 PolarHBondContact O-N 3.01Å
17	S	90.2	Very high	82	Confident	100 Å²	100	118.5 Å²	118.5	70%	0.699	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.3	-3.5	173.8	59.4	0	0	0	0	114.9	K15 A19	K15-S17 PolarHBondContact O-N 3.13Å; K15-S17 VanDerWaalsContact O-N 3.09Å; S17-A19 PolarHBondContact O-N 2.64Å
18	G	89.4	Confident	83.9	Confident	53 Å²	53	124 Å²	124	55%	0.546	64%	0.644	S	S	.	*	S	Bend	trans	80.2	-6.5	-171.6	0	0	0	0	0	114.5	K15 V16	K15-G18 PolarHBondContact O-N 3.39Å; V16-G18 PolarHBondContact O-N 3.01Å
19	A	90.7	Very high	85.7	Confident	48 Å²	48	123.6 Å²	123.6	40%	0.397	63%	0.629	S	S	.	*	P	Polyproline II helix	trans	-68.4	145.8	174.8	0	0	0	0	0	111.2	Y14 K15 S17	Y14-A19 CarbonylContact C-O 3.58Å; Y14-A19 WeakPolarHBondContact CA-O 3.32Å; K15-A19 PolarHBondContact N-O 3.23Å; S17-A19 PolarHBondContact O-N 2.64Å
20	F	90.4	Very high	87.5	Confident	142 Å²	142	120.1 Å²	120.1	62%	0.623	61%	0.612	S	S	*	*	B	Isolated β-bridge	trans	-60.2	143.7	172	-76.7	-74.1	0	0	0	111.5	Y14	Y14-F20 AromaticContact CD1-CD1 3.88Å; Y14-F20 HydrophobicContact CD1-CD1 3.88Å; Y14-F20 AromaticContact CD1-CE1 3.97Å; Y14-F20 HydrophobicContact CD1-CE1 3.97Å; Y14-F20 HydrophobicContact CD1-CG 4.37Å; Y14-F20 AromaticContact CE1-CD1 3.5Å; Y14-F20 HydrophobicContact CE1-CD1 3.5Å; Y14-F20 VanDerWaalsContact CE1-CD1 3.5Å; Y14-F20 HydrophobicContact CE1-CD2 4.46Å; Y14-F20 AromaticContact CE1-CE1 3.1Å; Y14-F20 HydrophobicContact CE1-CE1 3.1Å; Y14-F20 HydrophobicContact CE1-CE2 4.14Å; Y14-F20 HydrophobicContact CE1-CG 4.17Å; Y14-F20 AromaticContact CE1-CZ 3.46Å; Y14-F20 HydrophobicContact CE1-CZ 3.46Å; Y14-F20 VanDerWaalsContact CE1-CZ 3.46Å; Y14-F20 HydrophobicContact CE2-CE1 4.46Å; Y14-F20 AromaticContact CZ-CE1 3.4Å; Y14-F20 VanDerWaalsContact CZ-CE1 3.4Å; Y14-F20 AromaticContact CZ-CZ 3.9Å; Y14-F20 WeakPolarHBondContact OH-CE1 3.44Å
21	C	88.2	Confident	89.2	Confident	51 Å²	51	115.5 Å²	115.5	35%	0.345	60%	0.602	S	S	.	*	P	Polyproline II helix	trans	-63.5	148.8	166.6	-74.1	0	0	0	0	110.1	A13	A13-C21 PolarHBondContact O-N 3.44Å
22	D	90	Very high	90.8	Very high	126 Å²	126	113.9 Å²	113.9	67%	0.674	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-61.2	150.3	174.5	-61.1	-69.3	0	0	0	109.8	K15	K15-D22 IonicContact NZ-OD2 2.85Å; K15-D22 PolarHBondContact NZ-OD2 3.45Å
23	R	88.8	Confident	91.6	Very high	228 Å²	228	119.3 Å²	119.3	86%	0.86	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-52.8	137.3	179.7	66.5	-174.4	-177.3	-118.5	0.4	110.3	Q25	R23-Q25 PolarHBondContact O-N 2.85Å
24	P	88.5	Confident	92.1	Very high	107 Å²	107	119.9 Å²	119.9	70%	0.695	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-58.7	140.2	177.9	24.6	-33.3	0	0	0	110	I26	P24-I26 PolarHBondContact O-N 3.45Å
25	Q	91.4	Very high	92.6	Very high	199 Å²	199	117.9 Å²	117.9	93%	0.93	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-76.2	117.7	177.2	-65.4	-169.6	-2.9	0	0	109.5	R23	R23-Q25 PolarHBondContact O-N 2.85Å
26	I	92.9	Very high	93	Very high	155 Å²	155	117.4 Å²	117.4	80%	0.795	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-94	125.5	-179.9	-56.5	171.7	0	0	0	109	P24 R28	P24-I26 PolarHBondContact O-N 3.45Å; I26-R28 PolarHBondContact O-N 2.97Å
27	M	94.7	Very high	93.5	Very high	104 Å²	104	114.6 Å²	114.6	51%	0.512	60%	0.601	S	S	.	*	P	Polyproline II helix	trans	-73.8	123.6	174	-173.5	162.7	79.7	0	0	110.5	F29 G30 R33	M27-F29 PolarHBondContact O-N 3.39Å; M27-G30 PolarHBondContact O-N 3.47Å; M27-R33 HydrophobicContact CE-CB 4.39Å
28	R	95	Very high	93.9	Very high	208 Å²	208	111.1 Å²	111.1	79%	0.785	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.8	130.6	174.3	-68.3	-178.2	72.2	-177.2	2.8	109.8	I26 G30	I26-R28 PolarHBondContact O-N 2.97Å; R28-G30 PolarHBondContact O-N 2.99Å
29	F	95.8	Very high	94.3	Very high	144 Å²	144	114.4 Å²	114.4	63%	0.632	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.4	32.3	-178.9	-53.3	-72.3	0	0	0	113.8	M27 I31 L32 R33	M27-F29 PolarHBondContact O-N 3.39Å; F29-I31 VanDerWaalsContact C-N 3.32Å; F29-I31 PolarHBondContact O-N 3.03Å; F29-L32 HydrophobicContact CB-CB 4.23Å; F29-L32 PolarHBondContact O-N 3.24Å; F29-L32 VanDerWaalsContact O-N 3.14Å; F29-R33 WeakPolarHBondContact O-CB 3.41Å; F29-R33 PolarHBondContact O-N 2.95Å
30	G	96	Very high	94.7	Very high	21 Å²	21	115.4 Å²	115.4	22%	0.216	59%	0.586	C	S	.	*	H	α-helix	trans	-54.5	-45.2	-174.8	0	0	0	0	0	114	M27 R28 R33 S34	M27-G30 PolarHBondContact O-N 3.47Å; R28-G30 PolarHBondContact O-N 2.99Å; G30-R33 PolarHBondContact O-N 3.36Å; G30-S34 PolarHBondContact O-N 3.04Å; G30-S34 PolarHBondContact O-OG 3.41Å
31	I	97.3	Very high	95	Very high	132 Å²	132	115.7 Å²	115.7	68%	0.677	59%	0.588	S	S	*	*	H	α-helix	trans	-65.1	-46.8	177.6	-61.8	170.3	0	0	0	111.1	F29 R33 S34 L35	F29-I31 VanDerWaalsContact C-N 3.32Å; F29-I31 PolarHBondContact O-N 3.03Å; I31-R33 VanDerWaalsContact C-N 3.26Å; I31-R33 PolarHBondContact O-N 3.01Å; I31-S34 PolarHBondContact O-N 3.07Å; I31-S34 PolarHBondContact O-OG 3.5Å; I31-L35 HydrophobicContact CG2-CD1 3.93Å; I31-L35 HydrophobicContact CG2-CG 4.41Å; I31-L35 WeakPolarHBondContact O-CB 3.14Å; I31-L35 VanDerWaalsContact O-CG 3.3Å; I31-L35 WeakPolarHBondContact O-CG 3.21Å; I31-L35 PolarHBondContact O-N 3.37Å
32	L	97.4	Very high	95.5	Very high	115 Å²	115	118.9 Å²	118.9	60%	0.602	60%	0.6	S	S	*	*	H	α-helix	trans	-62.6	-39.2	179.1	-176.3	65.5	0	0	0	110.8	F29 L35 A36	F29-L32 HydrophobicContact CB-CB 4.23Å; F29-L32 PolarHBondContact O-N 3.24Å; F29-L32 VanDerWaalsContact O-N 3.14Å; L32-L35 PolarHBondContact O-N 3.46Å; L32-A36 WeakPolarHBondContact O-CB 3.17Å; L32-A36 PolarHBondContact O-N 3.11Å
33	R	97	Very high	95.9	Very high	161 Å²	161	119 Å²	119	61%	0.608	59%	0.594	S	S	*	*	H	α-helix	trans	-66.6	-42.6	177.5	-169.5	177	-176.6	-178.9	2.1	111.8	M27 F29 G30 I31 A36 V37	M27-R33 HydrophobicContact CE-CB 4.39Å; F29-R33 WeakPolarHBondContact O-CB 3.41Å; F29-R33 PolarHBondContact O-N 2.95Å; G30-R33 PolarHBondContact O-N 3.36Å; I31-R33 VanDerWaalsContact C-N 3.26Å; I31-R33 PolarHBondContact O-N 3.01Å; R33-A36 PolarHBondContact O-N 3.27Å; R33-V37 WeakPolarHBondContact O-CG2 3.43Å; R33-V37 PolarHBondContact O-N 3.19Å
34	S	97.4	Very high	96.4	Very high	72 Å²	72	111.8 Å²	111.8	50%	0.503	58%	0.576	S	S	.	*	H	α-helix	trans	-66.4	-40.2	177.1	61	0	0	0	0	111.7	G30 I31 V37 G38	G30-S34 PolarHBondContact O-N 3.04Å; G30-S34 PolarHBondContact O-OG 3.41Å; I31-S34 PolarHBondContact O-N 3.07Å; I31-S34 PolarHBondContact O-OG 3.5Å; S34-V37 PolarHBondContact O-N 3.39Å; S34-G38 PolarHBondContact O-N 3.38Å
35	L	98.3	Very high	96.8	Very high	91 Å²	91	108.4 Å²	108.4	48%	0.476	56%	0.56	S	S	.	*	H	α-helix	trans	-67.1	-42.6	175.5	-69.2	174.6	0	0	0	112.4	I31 L32 V37 G38 M39	I31-L35 HydrophobicContact CG2-CD1 3.93Å; I31-L35 HydrophobicContact CG2-CG 4.41Å; I31-L35 WeakPolarHBondContact O-CB 3.14Å; I31-L35 VanDerWaalsContact O-CG 3.3Å; I31-L35 WeakPolarHBondContact O-CG 3.21Å; I31-L35 PolarHBondContact O-N 3.37Å; L32-L35 PolarHBondContact O-N 3.46Å; L35-V37 PolarHBondContact O-N 3.42Å; L35-G38 PolarHBondContact O-N 3.04Å; L35-M39 WeakPolarHBondContact O-CB 3.48Å; L35-M39 VanDerWaalsContact O-CG 3.3Å; L35-M39 WeakPolarHBondContact O-CG 3.4Å; L35-M39 PolarHBondContact O-N 3.03Å
36	A	97.8	Very high	97.1	Very high	66 Å²	66	101.8 Å²	101.8	55%	0.545	54%	0.536	S	S	.	.	H	α-helix	trans	-62.1	-30.5	178.7	0	0	0	0	0	112.6	L32 R33 P40	L32-A36 WeakPolarHBondContact O-CB 3.17Å; L32-A36 PolarHBondContact O-N 3.11Å; R33-A36 PolarHBondContact O-N 3.27Å; A36-P40 WeakPolarHBondContact O-CD 3.44Å; A36-P40 WeakPolarHBondContact O-CG 3.27Å
37	V	97.2	Very high	97.4	Very high	83 Å²	83	99.4 Å²	99.4	50%	0.503	52%	0.523	S	S	.	.	H	α-helix	trans	-82.1	-50.5	172	176.3	0	0	0	0	110.5	R33 S34 L35 M39 P40 F41	R33-V37 WeakPolarHBondContact O-CG2 3.43Å; R33-V37 PolarHBondContact O-N 3.19Å; S34-V37 PolarHBondContact O-N 3.39Å; L35-V37 PolarHBondContact O-N 3.42Å; V37-M39 PolarHBondContact O-N 3.07Å; V37-P40 WeakPolarHBondContact O-CD 3.48Å; V37-F41 HydrophobicContact CG1-CD2 4.12Å; V37-F41 HydrophobicContact CG1-CE2 4.07Å; V37-F41 WeakPolarHBondContact O-CD2 3.39Å
38	G	98.3	Very high	97.5	Very high	27 Å²	27	99.9 Å²	99.9	28%	0.278	53%	0.526	S	S	.	.	H	α-helix	trans	-63.5	-43.6	-173	0	0	0	0	0	114.1	S34 L35 F41 I42	S34-G38 PolarHBondContact O-N 3.38Å; L35-G38 PolarHBondContact O-N 3.04Å; G38-F41 PolarHBondContact O-N 3.23Å; G38-I42 VanDerWaalsContact O-CG1 3.3Å; G38-I42 WeakPolarHBondContact O-CG1 3.33Å; G38-I42 PolarHBondContact O-N 2.85Å
39	M	98.1	Very high	97.6	Very high	122 Å²	122	94 Å²	94	60%	0.601	52%	0.517	S	S	*	.	H	α-helix	trans	-61.8	-48.4	-172.9	-71.3	-68	-122.5	0	0	113.6	L35 V37 F41 I42 F43	L35-M39 WeakPolarHBondContact O-CB 3.48Å; L35-M39 VanDerWaalsContact O-CG 3.3Å; L35-M39 WeakPolarHBondContact O-CG 3.4Å; L35-M39 PolarHBondContact O-N 3.03Å; V37-M39 PolarHBondContact O-N 3.07Å; M39-F41 VanDerWaalsContact C-N 3.32Å; M39-F41 PolarHBondContact O-N 3.33Å; M39-I42 PolarHBondContact O-N 2.7Å; M39-F43 WeakPolarHBondContact O-CB 3.27Å; M39-F43 PolarHBondContact O-N 3.26Å
40	P	98.2	Very high	97.6	Very high	69 Å²	69	95.1 Å²	95.1	45%	0.448	52%	0.517	S	S	.	.	H	α-helix	trans	-56.9	-42.1	174.1	-26.7	33.7	0	0	0	113.4	A36 V37 F43 V44	A36-P40 WeakPolarHBondContact O-CD 3.44Å; A36-P40 WeakPolarHBondContact O-CG 3.27Å; V37-P40 WeakPolarHBondContact O-CD 3.48Å; P40-F43 PolarHBondContact O-N 2.96Å; P40-V44 WeakPolarHBondContact O-CB 3.33Å; P40-V44 VanDerWaalsContact O-CG2 3.27Å; P40-V44 WeakPolarHBondContact O-CG2 3.43Å; P40-V44 PolarHBondContact O-N 3.37Å
41	F	97.9	Very high	97.5	Very high	149 Å²	149	97.8 Å²	97.8	65%	0.654	53%	0.529	S	S	*	.	H	α-helix	trans	-70.9	-36.8	-179.6	-75.8	-71.4	0	0	0	112.7	V37 G38 M39 F43 G45	V37-F41 HydrophobicContact CG1-CD2 4.12Å; V37-F41 HydrophobicContact CG1-CE2 4.07Å; V37-F41 WeakPolarHBondContact O-CD2 3.39Å; G38-F41 PolarHBondContact O-N 3.23Å; M39-F41 VanDerWaalsContact C-N 3.32Å; M39-F41 PolarHBondContact O-N 3.33Å; F41-F43 VanDerWaalsContact C-N 3.32Å; F41-G45 WeakPolarHBondContact O-CA 3.16Å; F41-G45 PolarHBondContact O-N 2.91Å
42	I	98.1	Very high	97.4	Very high	117 Å²	117	92.8 Å²	92.8	60%	0.6	51%	0.511	S	S	*	.	H	α-helix	trans	-63	-43.6	172.5	-67.9	165.2	0	0	0	109.8	G38 M39 G45 S46	G38-I42 VanDerWaalsContact O-CG1 3.3Å; G38-I42 WeakPolarHBondContact O-CG1 3.33Å; G38-I42 PolarHBondContact O-N 2.85Å; M39-I42 PolarHBondContact O-N 2.7Å; I42-G45 PolarHBondContact O-N 2.83Å; I42-S46 WeakPolarHBondContact O-CB 3.3Å; I42-S46 PolarHBondContact O-N 2.85Å; I42-S46 PolarHBondContact O-OG 2.85Å
43	F	98.2	Very high	97.2	Very high	128 Å²	128	89.6 Å²	89.6	56%	0.561	50%	0.5	S	S	*	.	H	α-helix	trans	-64.8	-50	178.8	-176.4	-102.4	0	0	0	112	M39 P40 F41 G45 S46 M47	M39-F43 WeakPolarHBondContact O-CB 3.27Å; M39-F43 PolarHBondContact O-N 3.26Å; P40-F43 PolarHBondContact O-N 2.96Å; F41-F43 VanDerWaalsContact C-N 3.32Å; F43-G45 VanDerWaalsContact C-N 3.3Å; F43-G45 PolarHBondContact O-N 2.93Å; F43-S46 PolarHBondContact O-N 3.33Å; F43-S46 VanDerWaalsContact O-N 3.13Å; F43-S46 PolarHBondContact O-OG 2.81Å; F43-M47 HydrophobicContact CD1-CG 4.44Å; F43-M47 HydrophobicContact CE1-CE 4.26Å; F43-M47 HydrophobicContact CE1-CG 4.09Å; F43-M47 HydrophobicContact CZ-CE 4.09Å; F43-M47 HydrophobicContact CZ-CG 4.23Å; F43-M47 HydrophobicContact CZ-SD 4.26Å; F43-M47 WeakPolarHBondContact O-CG 3.33Å; F43-M47 PolarHBondContact O-N 3.4Å
44	V	98.3	Very high	96.9	Very high	77 Å²	77	86.2 Å²	86.2	47%	0.467	49%	0.492	S	S	.	.	H	α-helix	trans	-59.7	-43.1	175.5	172	0	0	0	0	110.7	P40 S46 M47 I48	P40-V44 WeakPolarHBondContact O-CB 3.33Å; P40-V44 VanDerWaalsContact O-CG2 3.27Å; P40-V44 WeakPolarHBondContact O-CG2 3.43Å; P40-V44 PolarHBondContact O-N 3.37Å; V44-S46 VanDerWaalsContact C-N 3.33Å; V44-S46 PolarHBondContact O-N 3.43Å; V44-M47 PolarHBondContact O-N 3.21Å; V44-I48 HydrophobicContact CG1-CD1 3.79Å; V44-I48 HydrophobicContact CG1-CG1 4.43Å; V44-I48 WeakPolarHBondContact O-CG1 3.2Å; V44-I48 PolarHBondContact O-N 3.37Å
45	G	98.1	Very high	96.7	Very high	36 Å²	36	86.8 Å²	86.8	37%	0.371	49%	0.488	S	S	.	.	H	α-helix	trans	-58.5	-42.4	174.5	0	0	0	0	0	112.6	F41 I42 F43 M47 I48 S49	F41-G45 WeakPolarHBondContact O-CA 3.16Å; F41-G45 PolarHBondContact O-N 2.91Å; I42-G45 PolarHBondContact O-N 2.83Å; F43-G45 VanDerWaalsContact C-N 3.3Å; F43-G45 PolarHBondContact O-N 2.93Å; G45-M47 PolarHBondContact O-N 2.92Å; G45-I48 PolarHBondContact O-N 2.83Å; G45-S49 VanDerWaalsContact O-CB 3.27Å; G45-S49 WeakPolarHBondContact O-CB 3.3Å; G45-S49 PolarHBondContact O-N 3.46Å
46	S	97.9	Very high	96.4	Very high	61 Å²	61	85.5 Å²	85.5	43%	0.427	48%	0.482	S	S	.	.	H	α-helix	trans	-65.2	-37.7	176.3	68.1	0	0	0	0	113	I42 F43 V44 S49 R50	I42-S46 WeakPolarHBondContact O-CB 3.3Å; I42-S46 PolarHBondContact O-N 2.85Å; I42-S46 PolarHBondContact O-OG 2.85Å; F43-S46 PolarHBondContact O-N 3.33Å; F43-S46 VanDerWaalsContact O-N 3.13Å; F43-S46 PolarHBondContact O-OG 2.81Å; V44-S46 VanDerWaalsContact C-N 3.33Å; V44-S46 PolarHBondContact O-N 3.43Å; S46-S49 PolarHBondContact O-N 3.5Å; S46-R50 PolarHBondContact O-N 3.29Å
47	M	97.9	Very high	95.9	Very high	104 Å²	104	87.4 Å²	87.4	51%	0.512	48%	0.479	S	S	.	.	H	α-helix	trans	-66.3	-47.6	176.8	-67.3	-73.3	-107.4	0	0	110.6	F43 V44 G45 S49 R50 T51	F43-M47 HydrophobicContact CD1-CG 4.44Å; F43-M47 HydrophobicContact CE1-CE 4.26Å; F43-M47 HydrophobicContact CE1-CG 4.09Å; F43-M47 HydrophobicContact CZ-CE 4.09Å; F43-M47 HydrophobicContact CZ-CG 4.23Å; F43-M47 HydrophobicContact CZ-SD 4.26Å; F43-M47 WeakPolarHBondContact O-CG 3.33Å; F43-M47 PolarHBondContact O-N 3.4Å; V44-M47 PolarHBondContact O-N 3.21Å; G45-M47 PolarHBondContact O-N 2.92Å; M47-S49 VanDerWaalsContact C-N 3.28Å; M47-S49 PolarHBondContact O-N 3.3Å; M47-R50 PolarHBondContact O-N 3.18Å; M47-T51 PolarHBondContact O-N 3.39Å; M47-T51 PolarHBondContact O-OG1 3.35Å
48	I	97.6	Very high	95.5	Very high	114 Å²	114	90.6 Å²	90.6	59%	0.585	49%	0.489	S	S	*	.	H	α-helix	trans	-59.3	-42.6	174.9	-65.1	165.8	0	0	0	110.3	V44 G45 R50 T51 G52	V44-I48 HydrophobicContact CG1-CD1 3.79Å; V44-I48 HydrophobicContact CG1-CG1 4.43Å; V44-I48 WeakPolarHBondContact O-CG1 3.2Å; V44-I48 PolarHBondContact O-N 3.37Å; G45-I48 PolarHBondContact O-N 2.83Å; I48-R50 VanDerWaalsContact C-N 3.33Å; I48-R50 PolarHBondContact O-N 3.48Å; I48-T51 PolarHBondContact O-N 3.29Å; I48-G52 PolarHBondContact O-N 2.81Å
49	S	96.7	Very high	95.1	Very high	85 Å²	85	97.3 Å²	97.3	59%	0.594	51%	0.507	S	S	*	.	H	α-helix	trans	-62.3	-41.1	179.5	-160.7	0	0	0	0	111.8	G45 S46 M47 A53	G45-S49 VanDerWaalsContact O-CB 3.27Å; G45-S49 WeakPolarHBondContact O-CB 3.3Å; G45-S49 PolarHBondContact O-N 3.46Å; S46-S49 PolarHBondContact O-N 3.5Å; M47-S49 VanDerWaalsContact C-N 3.28Å; M47-S49 PolarHBondContact O-N 3.3Å; S49-A53 PolarHBondContact O-N 3.28Å
50	R	95.2	Very high	94.4	Very high	168 Å²	168	97.5 Å²	97.5	63%	0.634	51%	0.51	S	S	*	.	H	α-helix	trans	-65.5	-50.7	177	-179.8	179.6	166.8	164.1	1.4	111.6	S46 M47 I48 G52 A53 E54	S46-R50 PolarHBondContact O-N 3.29Å; M47-R50 PolarHBondContact O-N 3.18Å; I48-R50 VanDerWaalsContact C-N 3.33Å; I48-R50 PolarHBondContact O-N 3.48Å; R50-G52 VanDerWaalsContact C-N 3.27Å; R50-G52 PolarHBondContact O-N 3.46Å; R50-A53 PolarHBondContact O-N 3.14Å; R50-E54 IonicContact CZ-OE1 3.56Å; R50-E54 IonicContact NE-OE1 2.89Å; R50-E54 PolarHBondContact NE-OE1 3.46Å; R50-E54 IonicContact NH2-OE1 3.28Å; R50-E54 PolarHBondContact NH2-OE1 2.9Å; R50-E54 PolarHBondContact O-N 3.33Å
51	T	95.3	Very high	93.8	Very high	77 Å²	77	98.8 Å²	98.8	47%	0.472	51%	0.513	S	S	.	.	H	α-helix	trans	-64	-35.2	179.7	-53.6	0	0	0	0	111.8	M47 I48 E54 L55	M47-T51 PolarHBondContact O-N 3.39Å; M47-T51 PolarHBondContact O-OG1 3.35Å; I48-T51 PolarHBondContact O-N 3.29Å; T51-E54 PolarHBondContact O-N 2.95Å; T51-L55 WeakPolarHBondContact O-CG 3.45Å; T51-L55 PolarHBondContact O-N 2.9Å
52	G	94.3	Very high	92.8	Very high	27 Å²	27	98.1 Å²	98.1	28%	0.278	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-42.1	174.2	0	0	0	0	0	112.6	I48 R50 L55 L56	I48-G52 PolarHBondContact O-N 2.81Å; R50-G52 VanDerWaalsContact C-N 3.27Å; R50-G52 PolarHBondContact O-N 3.46Å; G52-L55 PolarHBondContact O-N 3.24Å; G52-L56 WeakPolarHBondContact O-CD1 3.39Å; G52-L56 WeakPolarHBondContact O-CG 3.3Å; G52-L56 PolarHBondContact O-N 3.23Å; G52-L56 VanDerWaalsContact O-N 3.07Å
53	A	92.8	Very high	91.5	Very high	47 Å²	47	96.6 Å²	96.6	39%	0.388	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-46.1	174.9	0	0	0	0	0	111.7	S49 R50 L55 L56 E57	S49-A53 PolarHBondContact O-N 3.28Å; R50-A53 PolarHBondContact O-N 3.14Å; A53-L55 VanDerWaalsContact C-N 3.33Å; A53-L55 PolarHBondContact O-N 2.85Å; A53-L56 PolarHBondContact O-N 3Å; A53-L56 VanDerWaalsContact O-N 3.11Å; A53-E57 PolarHBondContact O-N 3.05Å
54	E	92.2	Very high	90.2	Very high	91 Å²	91	94.5 Å²	94.5	43%	0.425	51%	0.505	S	S	.	.	H	α-helix	trans	-58.9	-41.8	176.5	-71.7	170.5	-177.7	0	0	111.8	R50 T51 L56 E57 E58	R50-E54 IonicContact CZ-OE1 3.56Å; R50-E54 IonicContact NE-OE1 2.89Å; R50-E54 PolarHBondContact NE-OE1 3.46Å; R50-E54 IonicContact NH2-OE1 3.28Å; R50-E54 PolarHBondContact NH2-OE1 2.9Å; R50-E54 PolarHBondContact O-N 3.33Å; T51-E54 PolarHBondContact O-N 2.95Å; E54-L56 VanDerWaalsContact C-N 3.34Å; E54-L56 PolarHBondContact O-N 3.35Å; E54-E57 PolarHBondContact O-N 3.45Å; E54-E58 PolarHBondContact O-N 2.78Å; E54-E58 VanDerWaalsContact O-N 3.1Å
55	L	92.7	Very high	88.9	Confident	83 Å²	83	98.9 Å²	98.9	44%	0.435	52%	0.521	S	S	.	.	H	α-helix	trans	-65.2	-36	175.3	-76.7	176.3	0	0	0	113	T51 G52 A53 E58 Y59	T51-L55 WeakPolarHBondContact O-CG 3.45Å; T51-L55 PolarHBondContact O-N 2.9Å; G52-L55 PolarHBondContact O-N 3.24Å; A53-L55 VanDerWaalsContact C-N 3.33Å; A53-L55 PolarHBondContact O-N 2.85Å; L55-E58 PolarHBondContact O-N 2.84Å; L55-Y59 WeakPolarHBondContact O-CD2 3.41Å; L55-Y59 PolarHBondContact O-N 2.9Å
56	L	91.5	Very high	87.6	Confident	64 Å²	64	105 Å²	105	34%	0.335	55%	0.545	S	S	.	.	H	α-helix	trans	-71.5	-33.9	-180	-72.5	163.9	0	0	0	112.4	G52 A53 E54 D60 I61 F62	G52-L56 WeakPolarHBondContact O-CD1 3.39Å; G52-L56 WeakPolarHBondContact O-CG 3.3Å; G52-L56 PolarHBondContact O-N 3.23Å; G52-L56 VanDerWaalsContact O-N 3.07Å; A53-L56 PolarHBondContact O-N 3Å; A53-L56 VanDerWaalsContact O-N 3.11Å; E54-L56 VanDerWaalsContact C-N 3.34Å; E54-L56 PolarHBondContact O-N 3.35Å; L56-D60 PolarHBondContact O-N 3.23Å; L56-I61 HydrophobicContact CD2-CB 4.12Å; L56-I61 HydrophobicContact CD2-CD1 3.99Å; L56-I61 HydrophobicContact CD2-CG2 4.09Å; L56-I61 PolarHBondContact O-N 3.09Å; L56-F62 HydrophobicContact CB-CB 4.32Å; L56-F62 HydrophobicContact CB-CD2 3.88Å; L56-F62 HydrophobicContact CD1-CD2 3.73Å; L56-F62 HydrophobicContact CD1-CE2 4.11Å; L56-F62 HydrophobicContact CD2-CD2 3.84Å; L56-F62 HydrophobicContact CD2-CE2 4.05Å; L56-F62 HydrophobicContact CG-CD2 3.99Å; L56-F62 PolarHBondContact O-N 2.88Å
57	E	88.1	Confident	85.6	Confident	106 Å²	106	112.6 Å²	112.6	50%	0.495	58%	0.581	S	S	.	*	H	α-helix	trans	-64.8	-41.8	169.9	-74.8	175.9	-162.8	0	0	110.9	A53 E54 Y59 D60 F62	A53-E57 PolarHBondContact O-N 3.05Å; E54-E57 PolarHBondContact O-N 3.45Å; E57-Y59 PolarHBondContact O-N 3.21Å; E57-D60 PolarHBondContact O-N 3.39Å; E57-F62 VanDerWaalsContact CG-O 3.32Å; E57-F62 WeakPolarHBondContact CG-O 3.34Å
58	E	88.4	Confident	85	Confident	150 Å²	150	113.1 Å²	113.1	70%	0.701	58%	0.584	S	S	*	*	H	α-helix	trans	-60.9	-32.1	178.1	-174.1	171.7	-168	0	0	113	E54 L55	E54-E58 PolarHBondContact O-N 2.78Å; E54-E58 VanDerWaalsContact O-N 3.1Å; L55-E58 PolarHBondContact O-N 2.84Å
59	Y	90.5	Very high	84.3	Confident	168 Å²	168	113 Å²	113	66%	0.659	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92	8.5	177.2	-70.2	-66.5	0	0	0	114.5	L55 E57 I61	L55-Y59 WeakPolarHBondContact O-CD2 3.41Å; L55-Y59 PolarHBondContact O-N 2.9Å; E57-Y59 PolarHBondContact O-N 3.21Å; Y59-I61 PolarHBondContact O-N 3.28Å
60	D	82.8	Confident	83.6	Confident	126 Å²	126	114.6 Å²	114.6	67%	0.674	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	50.9	29	-175.4	-163.7	31.5	0	0	0	112.7	L56 E57 T63	L56-D60 PolarHBondContact O-N 3.23Å; E57-D60 PolarHBondContact O-N 3.39Å; D60-T63 PolarHBondContact OD1-OG1 3.09Å
61	I	85.7	Confident	83	Confident	97 Å²	97	111.4 Å²	111.4	50%	0.497	58%	0.58	S	S	.	*	S	Bend	trans	-81.5	-40.3	177.9	-60.3	174.6	0	0	0	108.9	L56 Y59	L56-I61 HydrophobicContact CD2-CB 4.12Å; L56-I61 HydrophobicContact CD2-CD1 3.99Å; L56-I61 HydrophobicContact CD2-CG2 4.09Å; L56-I61 PolarHBondContact O-N 3.09Å; Y59-I61 PolarHBondContact O-N 3.28Å
62	F	77.1	Confident	82.2	Confident	135 Å²	135	113.6 Å²	113.6	59%	0.592	59%	0.587	S	S	*	*			trans	-135.3	102.6	176.4	-65.8	-68.4	0	0	0	108.9	L56 E57	L56-F62 HydrophobicContact CB-CB 4.32Å; L56-F62 HydrophobicContact CB-CD2 3.88Å; L56-F62 HydrophobicContact CD1-CD2 3.73Å; L56-F62 HydrophobicContact CD1-CE2 4.11Å; L56-F62 HydrophobicContact CD2-CD2 3.84Å; L56-F62 HydrophobicContact CD2-CE2 4.05Å; L56-F62 HydrophobicContact CG-CD2 3.99Å; L56-F62 PolarHBondContact O-N 2.88Å; E57-F62 VanDerWaalsContact CG-O 3.32Å; E57-F62 WeakPolarHBondContact CG-O 3.34Å
63	T	70.8	Confident	81.4	Confident	85 Å²	85	119.3 Å²	119.3	52%	0.521	61%	0.608	S	S	.	*			trans	-106.8	113.9	170.8	-52.7	0	0	0	0	106.2	D60 Q65	D60-T63 PolarHBondContact OD1-OG1 3.09Å; T63-Q65 PolarHBondContact O-N 3.32Å
64	P	69.6	Low	80.6	Confident	84 Å²	84	124.5 Å²	124.5	55%	0.545	62%	0.623	S	S	.	*			trans	-62.3	127	177.1	24.9	-30.6	0	0	0	108.5	D66	P64-D66 PolarHBondContact O-N 3.26Å
65	Q	71.7	Confident	79.7	Confident	169 Å²	169	127.1 Å²	127.1	79%	0.79	64%	0.639	S	S	*	*			trans	-77.8	115.1	170.1	-61.1	-146.6	-30	0	0	107.3	T63 D67	T63-Q65 PolarHBondContact O-N 3.32Å; Q65-D67 VanDerWaalsContact C-N 3.27Å; Q65-D67 PolarHBondContact O-N 3.28Å
66	D	70.4	Confident	78.6	Confident	165 Å²	165	130.8 Å²	130.8	88%	0.882	66%	0.656	S	S	*	*			trans	-70	84.7	171.1	-76.4	-33.8	0	0	0	108.7	P64	P64-D66 PolarHBondContact O-N 3.26Å
67	D	56.3	Low	77.4	Confident	220 Å²	220	136.8 Å²	136.8	100%	1.176	69%	0.685	S	S	*	*			trans	-95.2	0	161.8	-81	-25.2	0	0	0	110.8	Q65	Q65-D67 VanDerWaalsContact C-N 3.27Å; Q65-D67 PolarHBondContact O-N 3.28Å

Retrieved 67 of 67 residues in 37.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).