A0A3Q0KQ80_SCHMA Loading...

Reverse transcriptase domain-containing protein

AlphaFold DB , UniProt , Accession A0A3Q0KQ80, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 73 aa.

						>A0A3Q0KQ80_SCHMA|A0A3Q0KQ80
MFILNSIAHASKRSDVQIPRISIFVNETAEAIKAEKRRKDAREDRINYLKHVIGNLDRRGNATTPGTSEKTDG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.6	Low	71.2	Confident	195 Å²	195	109.5 Å²	109.5	96%	0.961	60%	0.597	S	S	*	*				0	-32.4	0	-154.9	166.1	-177.5	0	0	113.6	I3	M1-I3 PolarHBondContact O-N 3.22Å
2	F	70.5	Confident	70.9	Confident	183 Å²	183	112.3 Å²	112.3	80%	0.803	60%	0.599	S	S	*	*	H	α-helix	trans	-61.2	-43.2	-179.3	-65	-79.1	0	0	0	115.1	L4 N5 S6	F2-L4 PolarHBondContact O-N 3.31Å; F2-N5 PolarHBondContact O-N 3.45Å; F2-S6 PolarHBondContact O-N 2.94Å; F2-S6 VanDerWaalsContact O-N 3.14Å; F2-S6 PolarHBondContact O-OG 3.4Å
3	I	71.1	Confident	70.7	Confident	129 Å²	129	116.8 Å²	116.8	66%	0.662	60%	0.602	S	S	*	*	H	α-helix	trans	-62.7	-41.2	-176	-59.9	-178.6	0	0	0	112.1	M1 N5 S6 I7	M1-I3 PolarHBondContact O-N 3.22Å; I3-N5 PolarHBondContact O-N 3.31Å; I3-S6 PolarHBondContact O-N 3.49Å; I3-I7 HydrophobicContact CG2-CD1 3.75Å; I3-I7 HydrophobicContact CG2-CG1 4.27Å; I3-I7 WeakPolarHBondContact O-CG1 3.36Å; I3-I7 PolarHBondContact O-N 3.14Å
4	L	70.7	Confident	70.5	Confident	128 Å²	128	111.8 Å²	111.8	67%	0.67	58%	0.583	S	S	*	*	H	α-helix	trans	-62.6	-41.8	179.6	-72.5	169.4	0	0	0	112	F2 I7 A8	F2-L4 PolarHBondContact O-N 3.31Å; L4-I7 PolarHBondContact O-N 2.96Å; L4-A8 WeakPolarHBondContact O-CB 3.41Å; L4-A8 PolarHBondContact O-N 3.03Å
5	N	77	Confident	70.3	Confident	109 Å²	109	111.1 Å²	111.1	58%	0.583	58%	0.58	S	S	*	*	H	α-helix	trans	-64.7	-40.2	175.9	-86.5	-6.1	0	0	0	111.6	F2 I3 A8 H9	F2-N5 PolarHBondContact O-N 3.45Å; I3-N5 PolarHBondContact O-N 3.31Å; N5-A8 PolarHBondContact O-N 3.4Å; N5-H9 WeakPolarHBondContact O-CB 3.44Å; N5-H9 PolarHBondContact O-N 3.34Å
6	S	72.9	Confident	70.1	Confident	81 Å²	81	109.3 Å²	109.3	57%	0.566	58%	0.575	S	S	*	*	H	α-helix	trans	-63.6	-43.7	176.3	-61.5	0	0	0	0	112.3	F2 I3 H9 A10	F2-S6 PolarHBondContact O-N 2.94Å; F2-S6 VanDerWaalsContact O-N 3.14Å; F2-S6 PolarHBondContact O-OG 3.4Å; I3-S6 PolarHBondContact O-N 3.49Å; S6-H9 PolarHBondContact O-N 2.96Å; S6-A10 WeakPolarHBondContact O-CB 3.38Å; S6-A10 PolarHBondContact O-N 2.89Å
7	I	72.7	Confident	70.2	Confident	98 Å²	98	109.6 Å²	109.6	50%	0.503	57%	0.572	S	S	.	*	H	α-helix	trans	-63.5	-47.8	176.8	-66.4	170	0	0	0	110.2	I3 L4 H9 A10 S11	I3-I7 HydrophobicContact CG2-CD1 3.75Å; I3-I7 HydrophobicContact CG2-CG1 4.27Å; I3-I7 WeakPolarHBondContact O-CG1 3.36Å; I3-I7 PolarHBondContact O-N 3.14Å; L4-I7 PolarHBondContact O-N 2.96Å; I7-H9 VanDerWaalsContact C-N 3.3Å; I7-H9 PolarHBondContact O-N 3.46Å; I7-A10 PolarHBondContact O-N 3.42Å; I7-A10 VanDerWaalsContact O-N 3.17Å; I7-S11 PolarHBondContact O-N 3.17Å; I7-S11 PolarHBondContact O-OG 3.48Å
8	A	73.5	Confident	70.2	Confident	46 Å²	46	109.4 Å²	109.4	38%	0.38	57%	0.571	S	S	.	*	H	α-helix	trans	-61.8	-36.9	179	0	0	0	0	0	112.6	L4 N5 K12	L4-A8 WeakPolarHBondContact O-CB 3.41Å; L4-A8 PolarHBondContact O-N 3.03Å; N5-A8 PolarHBondContact O-N 3.4Å; A8-K12 WeakPolarHBondContact O-CB 3.37Å; A8-K12 WeakPolarHBondContact O-CG 3.19Å; A8-K12 PolarHBondContact O-N 3.11Å
9	H	73.9	Confident	70.5	Confident	122 Å²	122	106.8 Å²	106.8	57%	0.565	56%	0.562	S	S	*	*	H	α-helix	trans	-68.8	-40.5	174.6	-116.9	55.2	0	0	0	112.5	N5 S6 I7 K12 R13	N5-H9 WeakPolarHBondContact O-CB 3.44Å; N5-H9 PolarHBondContact O-N 3.34Å; S6-H9 PolarHBondContact O-N 2.96Å; I7-H9 VanDerWaalsContact C-N 3.3Å; I7-H9 PolarHBondContact O-N 3.46Å; H9-K12 PolarHBondContact O-N 2.94Å; H9-R13 WeakPolarHBondContact O-CG 3.44Å; H9-R13 PolarHBondContact O-N 3.23Å
10	A	68.5	Low	70.8	Confident	59 Å²	59	110.4 Å²	110.4	49%	0.488	57%	0.567	S	S	.	*	H	α-helix	trans	-63.1	-44.6	175.6	0	0	0	0	0	111.3	S6 I7 R13 S14	S6-A10 WeakPolarHBondContact O-CB 3.38Å; S6-A10 PolarHBondContact O-N 2.89Å; I7-A10 PolarHBondContact O-N 3.42Å; I7-A10 VanDerWaalsContact O-N 3.17Å; A10-R13 PolarHBondContact O-N 3.03Å; A10-S14 PolarHBondContact O-N 2.75Å
11	S	69.5	Low	71.1	Confident	55 Å²	55	110 Å²	110	39%	0.385	57%	0.565	S	S	.	*	H	α-helix	trans	-62.8	-44.8	175.7	-63.3	0	0	0	0	112.4	I7 R13 S14 D15	I7-S11 PolarHBondContact O-N 3.17Å; I7-S11 PolarHBondContact O-OG 3.48Å; S11-R13 VanDerWaalsContact C-N 3.27Å; S11-R13 PolarHBondContact O-N 3.49Å; S11-S14 WeakPolarHBondContact CA-OG 3.35Å; S11-S14 PolarHBondContact O-N 3Å; S11-S14 VanDerWaalsContact O-N 3.11Å; S11-S14 PolarHBondContact O-OG 2.84Å; S11-D15 WeakPolarHBondContact O-CB 3.39Å; S11-D15 PolarHBondContact O-N 3.26Å
12	K	67.4	Low	71.8	Confident	143 Å²	143	103.9 Å²	103.9	62%	0.622	54%	0.542	S	S	*	.	H	α-helix	trans	-61.1	-37.4	175.4	-76.8	-178.5	-179.4	-175.5	0	112.5	A8 H9 V16	A8-K12 WeakPolarHBondContact O-CB 3.37Å; A8-K12 WeakPolarHBondContact O-CG 3.19Å; A8-K12 PolarHBondContact O-N 3.11Å; H9-K12 PolarHBondContact O-N 2.94Å; K12-V16 WeakPolarHBondContact O-CG2 3.5Å; K12-V16 PolarHBondContact O-N 2.94Å
13	R	68.8	Low	72.4	Confident	170 Å²	170	99.7 Å²	99.7	64%	0.642	53%	0.526	S	S	*	.	H	α-helix	trans	-66.1	-41.5	174.5	-75.9	-177.4	176.7	-163.1	0.4	111.3	H9 A10 S11 V16 Q17	H9-R13 WeakPolarHBondContact O-CG 3.44Å; H9-R13 PolarHBondContact O-N 3.23Å; A10-R13 PolarHBondContact O-N 3.03Å; S11-R13 VanDerWaalsContact C-N 3.27Å; S11-R13 PolarHBondContact O-N 3.49Å; R13-V16 PolarHBondContact O-N 3.31Å; R13-Q17 WeakPolarHBondContact O-CB 3.36Å; R13-Q17 WeakPolarHBondContact O-CG 3.5Å; R13-Q17 PolarHBondContact O-N 3.25Å
14	S	67.3	Low	72.8	Confident	47 Å²	47	100 Å²	100	33%	0.329	52%	0.523	S	S	.	.	H	α-helix	trans	-65	-43	175.7	59.5	0	0	0	0	112	A10 S11 V16 Q17 I18	A10-S14 PolarHBondContact O-N 2.75Å; S11-S14 WeakPolarHBondContact CA-OG 3.35Å; S11-S14 PolarHBondContact O-N 3Å; S11-S14 VanDerWaalsContact O-N 3.11Å; S11-S14 PolarHBondContact O-OG 2.84Å; S14-V16 PolarHBondContact O-N 2.96Å; S14-Q17 PolarHBondContact O-N 3.17Å; S14-Q17 VanDerWaalsContact O-N 3.12Å; S14-I18 WeakPolarHBondContact O-CB 3.36Å; S14-I18 WeakPolarHBondContact O-CD1 3.43Å; S14-I18 VanDerWaalsContact O-CG1 3.24Å; S14-I18 WeakPolarHBondContact O-CG1 3.48Å; S14-I18 PolarHBondContact O-N 3.23Å
15	D	67.7	Low	73.6	Confident	102 Å²	102	98.1 Å²	98.1	55%	0.545	52%	0.517	S	S	.	.	H	α-helix	trans	-63.8	-27.7	-178.3	-66.2	-17.8	0	0	0	112.8	S11 P19	S11-D15 WeakPolarHBondContact O-CB 3.39Å; S11-D15 PolarHBondContact O-N 3.26Å; D15-P19 WeakPolarHBondContact O-CD 3.11Å; D15-P19 WeakPolarHBondContact O-CG 2.83Å
16	V	68	Low	74.2	Confident	82 Å²	82	97.7 Å²	97.7	50%	0.497	52%	0.515	S	S	.	.	H	α-helix	trans	-87.8	-31.8	174.8	177.3	0	0	0	0	111.9	K12 R13 S14 R20	K12-V16 WeakPolarHBondContact O-CG2 3.5Å; K12-V16 PolarHBondContact O-N 2.94Å; R13-V16 PolarHBondContact O-N 3.31Å; S14-V16 PolarHBondContact O-N 2.96Å; V16-R20 WeakPolarHBondContact O-CG 3.47Å
17	Q	71.1	Confident	74.8	Confident	114 Å²	114	99.7 Å²	99.7	53%	0.533	52%	0.515	S	S	.	.	H	α-helix	trans	-75.4	-37.8	179.4	-73.9	177	29.4	0	0	112.6	R13 S14 R20 I21	R13-Q17 WeakPolarHBondContact O-CB 3.36Å; R13-Q17 WeakPolarHBondContact O-CG 3.5Å; R13-Q17 PolarHBondContact O-N 3.25Å; S14-Q17 PolarHBondContact O-N 3.17Å; S14-Q17 VanDerWaalsContact O-N 3.12Å; Q17-R20 PolarHBondContact O-N 2.87Å; Q17-I21 WeakPolarHBondContact O-CG1 3.49Å; Q17-I21 PolarHBondContact O-N 3.12Å
18	I	70.9	Confident	75.6	Confident	107 Å²	107	97.7 Å²	97.7	55%	0.549	51%	0.508	S	S	.	.	H	α-helix	trans	-58.3	-48.9	179.4	-68.4	162.2	0	0	0	111.5	S14 R20 I21 S22	S14-I18 WeakPolarHBondContact O-CB 3.36Å; S14-I18 WeakPolarHBondContact O-CD1 3.43Å; S14-I18 VanDerWaalsContact O-CG1 3.24Å; S14-I18 WeakPolarHBondContact O-CG1 3.48Å; S14-I18 PolarHBondContact O-N 3.23Å; I18-R20 VanDerWaalsContact C-N 3.33Å; I18-R20 PolarHBondContact O-N 2.92Å; I18-I21 PolarHBondContact O-N 3.43Å; I18-S22 PolarHBondContact O-N 3.28Å; I18-S22 PolarHBondContact O-OG 3Å
19	P	75.7	Confident	76.5	Confident	60 Å²	60	97.3 Å²	97.3	39%	0.39	50%	0.504	S	S	.	.	H	α-helix	trans	-62.1	-36.3	175	-25.1	34.2	0	0	0	113.7	D15 S22 I23	D15-P19 WeakPolarHBondContact O-CD 3.11Å; D15-P19 WeakPolarHBondContact O-CG 2.83Å; P19-S22 WeakPolarHBondContact CA-OG 3.24Å; P19-S22 PolarHBondContact O-N 3.33Å; P19-S22 PolarHBondContact O-OG 3.41Å; P19-I23 WeakPolarHBondContact O-CB 3.37Å; P19-I23 WeakPolarHBondContact O-CD1 3.3Å; P19-I23 WeakPolarHBondContact O-CG1 3.18Å; P19-I23 PolarHBondContact O-N 2.99Å
20	R	75.5	Confident	77.3	Confident	178 Å²	178	95.3 Å²	95.3	67%	0.672	50%	0.495	S	S	*	.	H	α-helix	trans	-66.8	-41.9	178	-73.1	-179.2	-179.8	-166.3	0	111.5	V16 Q17 I18 F24	V16-R20 WeakPolarHBondContact O-CG 3.47Å; Q17-R20 PolarHBondContact O-N 2.87Å; I18-R20 VanDerWaalsContact C-N 3.33Å; I18-R20 PolarHBondContact O-N 2.92Å; R20-F24 WeakPolarHBondContact O-CB 3.47Å; R20-F24 PolarHBondContact O-N 2.89Å
21	I	78	Confident	78.5	Confident	102 Å²	102	95.4 Å²	95.4	52%	0.523	50%	0.496	S	S	.	.	H	α-helix	trans	-65.9	-41.9	176.8	-65.5	168.2	0	0	0	110.1	Q17 I18 F24 V25	Q17-I21 WeakPolarHBondContact O-CG1 3.49Å; Q17-I21 PolarHBondContact O-N 3.12Å; I18-I21 PolarHBondContact O-N 3.43Å; I21-F24 PolarHBondContact O-N 3.19Å; I21-V25 HydrophobicContact CG2-CG2 4.28Å; I21-V25 VanDerWaalsContact O-CG2 3.3Å; I21-V25 WeakPolarHBondContact O-CG2 3.42Å; I21-V25 PolarHBondContact O-N 3.48Å
22	S	77.9	Confident	79.6	Confident	67 Å²	67	98.1 Å²	98.1	47%	0.469	51%	0.505	S	S	.	.	H	α-helix	trans	-65.5	-40.9	179	68	0	0	0	0	112.7	I18 P19 V25 N26	I18-S22 PolarHBondContact O-N 3.28Å; I18-S22 PolarHBondContact O-OG 3Å; P19-S22 WeakPolarHBondContact CA-OG 3.24Å; P19-S22 PolarHBondContact O-N 3.33Å; P19-S22 PolarHBondContact O-OG 3.41Å; S22-V25 PolarHBondContact O-N 3.42Å; S22-N26 WeakPolarHBondContact O-CB 3.43Å; S22-N26 PolarHBondContact O-N 3.44Å
23	I	81.4	Confident	80.8	Confident	94 Å²	94	96.9 Å²	96.9	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-59.5	-48.5	172.5	-68.2	164.2	0	0	0	110	P19 V25 N26 E27	P19-I23 WeakPolarHBondContact O-CB 3.37Å; P19-I23 WeakPolarHBondContact O-CD1 3.3Å; P19-I23 WeakPolarHBondContact O-CG1 3.18Å; P19-I23 PolarHBondContact O-N 2.99Å; I23-V25 PolarHBondContact O-N 2.97Å; I23-N26 PolarHBondContact O-N 2.87Å; I23-E27 HydrophobicContact CG2-CG 4.36Å; I23-E27 WeakPolarHBondContact CG2-OE1 3.32Å; I23-E27 WeakPolarHBondContact O-CG 3.29Å; I23-E27 PolarHBondContact O-N 3.42Å
24	F	81.2	Confident	82	Confident	135 Å²	135	90.1 Å²	90.1	59%	0.592	48%	0.48	S	S	*	.	H	α-helix	trans	-61	-42.4	179.5	-179.4	-99.4	0	0	0	112.9	R20 I21 N26 T28	R20-F24 WeakPolarHBondContact O-CB 3.47Å; R20-F24 PolarHBondContact O-N 2.89Å; I21-F24 PolarHBondContact O-N 3.19Å; F24-N26 VanDerWaalsContact C-N 3.35Å; F24-T28 VanDerWaalsContact O-CB 3.29Å; F24-T28 WeakPolarHBondContact O-CB 3.46Å; F24-T28 PolarHBondContact O-N 2.93Å; F24-T28 PolarHBondContact O-OG1 3.42Å
25	V	86.2	Confident	83.3	Confident	89 Å²	89	92 Å²	92	54%	0.539	48%	0.484	S	S	.	.	H	α-helix	trans	-63.6	-42.3	176.1	169.3	0	0	0	0	110.7	I21 S22 I23 T28 A29	I21-V25 HydrophobicContact CG2-CG2 4.28Å; I21-V25 VanDerWaalsContact O-CG2 3.3Å; I21-V25 WeakPolarHBondContact O-CG2 3.42Å; I21-V25 PolarHBondContact O-N 3.48Å; S22-V25 PolarHBondContact O-N 3.42Å; I23-V25 PolarHBondContact O-N 2.97Å; V25-T28 PolarHBondContact O-N 2.98Å; V25-A29 VanDerWaalsContact O-CB 3.32Å; V25-A29 WeakPolarHBondContact O-CB 3.39Å; V25-A29 PolarHBondContact O-N 2.74Å
26	N	89	Confident	84.6	Confident	101 Å²	101	93.7 Å²	93.7	54%	0.54	49%	0.486	S	S	.	.	H	α-helix	trans	-66.8	-45.4	179.5	-167.1	52.9	0	0	0	111.9	S22 I23 F24 T28 A29 E30	S22-N26 WeakPolarHBondContact O-CB 3.43Å; S22-N26 PolarHBondContact O-N 3.44Å; I23-N26 PolarHBondContact O-N 2.87Å; F24-N26 VanDerWaalsContact C-N 3.35Å; N26-T28 VanDerWaalsContact C-N 3.32Å; N26-T28 PolarHBondContact O-N 2.87Å; N26-A29 PolarHBondContact O-N 2.91Å; N26-E30 WeakPolarHBondContact O-CG 3.33Å; N26-E30 PolarHBondContact O-N 3.32Å
27	E	87.1	Confident	85.8	Confident	123 Å²	123	97.5 Å²	97.5	58%	0.575	49%	0.492	S	S	*	.	H	α-helix	trans	-60.1	-42.7	174.7	-73.8	178	-178.5	0	0	111.7	I23 E30 A31	I23-E27 HydrophobicContact CG2-CG 4.36Å; I23-E27 WeakPolarHBondContact CG2-OE1 3.32Å; I23-E27 WeakPolarHBondContact O-CG 3.29Å; I23-E27 PolarHBondContact O-N 3.42Å; E27-E30 PolarHBondContact O-N 3.35Å; E27-A31 WeakPolarHBondContact O-CB 3.39Å; E27-A31 PolarHBondContact O-N 3.38Å
28	T	89.2	Confident	86.9	Confident	56 Å²	56	100.4 Å²	100.4	34%	0.344	50%	0.498	S	S	.	.	H	α-helix	trans	-65.1	-42.6	177.2	-57.7	0	0	0	0	111.4	F24 V25 N26 A31 I32	F24-T28 VanDerWaalsContact O-CB 3.29Å; F24-T28 WeakPolarHBondContact O-CB 3.46Å; F24-T28 PolarHBondContact O-N 2.93Å; F24-T28 PolarHBondContact O-OG1 3.42Å; V25-T28 PolarHBondContact O-N 2.98Å; N26-T28 VanDerWaalsContact C-N 3.32Å; N26-T28 PolarHBondContact O-N 2.87Å; T28-A31 PolarHBondContact O-N 2.95Å; T28-I32 HydrophobicContact CG2-CD1 4.02Å; T28-I32 VanDerWaalsContact O-CG1 3.28Å; T28-I32 WeakPolarHBondContact O-CG1 3.4Å; T28-I32 PolarHBondContact O-N 2.86Å
29	A	92.2	Very high	88	Confident	38 Å²	38	101.4 Å²	101.4	31%	0.314	50%	0.498	S	S	.	.	H	α-helix	trans	-63.8	-42.1	177.5	0	0	0	0	0	111.8	V25 N26 I32 K33	V25-A29 VanDerWaalsContact O-CB 3.32Å; V25-A29 WeakPolarHBondContact O-CB 3.39Å; V25-A29 PolarHBondContact O-N 2.74Å; N26-A29 PolarHBondContact O-N 2.91Å; A29-I32 PolarHBondContact O-N 3.42Å; A29-K33 WeakPolarHBondContact O-CG 3.44Å; A29-K33 PolarHBondContact O-N 3.28Å
30	E	91.4	Very high	88.9	Confident	80 Å²	80	102.4 Å²	102.4	37%	0.374	50%	0.5	S	S	.	.	H	α-helix	trans	-66.9	-38.3	175.6	-72.1	-53.6	122.9	0	0	112.2	N26 E27 K33 A34	N26-E30 WeakPolarHBondContact O-CG 3.33Å; N26-E30 PolarHBondContact O-N 3.32Å; E27-E30 PolarHBondContact O-N 3.35Å; E30-K33 PolarHBondContact O-N 2.95Å; E30-K33 WeakPolarHBondContact OE1-CD 3.35Å; E30-K33 IonicContact OE1-NZ 2.76Å; E30-K33 PolarHBondContact OE1-NZ 3.29Å; E30-A34 WeakPolarHBondContact O-CB 3.37Å; E30-A34 PolarHBondContact O-N 3Å
31	A	92.2	Very high	89.8	Confident	60 Å²	60	96.7 Å²	96.7	50%	0.496	49%	0.491	S	S	.	.	H	α-helix	trans	-61.7	-43.4	173.1	0	0	0	0	0	112	E27 T28 A34 E35	E27-A31 WeakPolarHBondContact O-CB 3.39Å; E27-A31 PolarHBondContact O-N 3.38Å; T28-A31 PolarHBondContact O-N 2.95Å; A31-A34 PolarHBondContact O-N 3.33Å; A31-E35 WeakPolarHBondContact O-CB 3.4Å; A31-E35 PolarHBondContact O-N 2.9Å
32	I	92.7	Very high	90.7	Very high	112 Å²	112	100.7 Å²	100.7	57%	0.574	50%	0.499	S	S	*	.	H	α-helix	trans	-63.3	-44	176.4	-68.6	165.4	0	0	0	111	T28 A29 E35 K36	T28-I32 HydrophobicContact CG2-CD1 4.02Å; T28-I32 VanDerWaalsContact O-CG1 3.28Å; T28-I32 WeakPolarHBondContact O-CG1 3.4Å; T28-I32 PolarHBondContact O-N 2.86Å; A29-I32 PolarHBondContact O-N 3.42Å; I32-E35 PolarHBondContact O-N 3.23Å; I32-K36 PolarHBondContact O-N 2.94Å
33	K	93.9	Very high	91.6	Very high	117 Å²	117	102 Å²	102	51%	0.509	50%	0.498	S	S	.	.	H	α-helix	trans	-63.2	-41.1	175.8	-72.9	174.9	-170.9	166.9	0	112	A29 E30 K36 R37	A29-K33 WeakPolarHBondContact O-CG 3.44Å; A29-K33 PolarHBondContact O-N 3.28Å; E30-K33 PolarHBondContact O-N 2.95Å; E30-K33 WeakPolarHBondContact OE1-CD 3.35Å; E30-K33 IonicContact OE1-NZ 2.76Å; E30-K33 PolarHBondContact OE1-NZ 3.29Å; K33-K36 PolarHBondContact O-N 3.08Å; K33-R37 WeakPolarHBondContact O-CG 3.28Å; K33-R37 PolarHBondContact O-N 3.06Å
34	A	92.8	Very high	92.2	Very high	28 Å²	28	102.7 Å²	102.7	23%	0.231	50%	0.503	C	S	.	.	H	α-helix	trans	-64	-42.2	177	0	0	0	0	0	111.5	E30 A31 R37 R38	E30-A34 WeakPolarHBondContact O-CB 3.37Å; E30-A34 PolarHBondContact O-N 3Å; A31-A34 PolarHBondContact O-N 3.33Å; A34-R37 PolarHBondContact O-N 3.47Å; A34-R38 WeakPolarHBondContact O-CG 3.49Å; A34-R38 PolarHBondContact O-N 2.76Å; A34-R38 VanDerWaalsContact O-N 3.08Å
35	E	94.3	Very high	93	Very high	87 Å²	87	104.7 Å²	104.7	41%	0.407	51%	0.507	S	S	.	.	H	α-helix	trans	-64.3	-41.6	176.2	-177.2	57.9	-159.7	0	0	111.9	A31 I32 R37 R38 K39	A31-E35 WeakPolarHBondContact O-CB 3.4Å; A31-E35 PolarHBondContact O-N 2.9Å; I32-E35 PolarHBondContact O-N 3.23Å; E35-R37 PolarHBondContact O-N 3.37Å; E35-R38 PolarHBondContact O-N 3.09Å; E35-K39 PolarHBondContact O-N 3.07Å; E35-K39 WeakPolarHBondContact OE1-CE 3.45Å
36	K	95	Very high	93.4	Very high	138 Å²	138	103.4 Å²	103.4	60%	0.6	50%	0.496	S	S	*	.	H	α-helix	trans	-58.5	-47.9	173.9	-172.9	176.9	178.3	-179.2	0	111.6	I32 K33 R38 K39 D40	I32-K36 PolarHBondContact O-N 2.94Å; K33-K36 PolarHBondContact O-N 3.08Å; K36-R38 VanDerWaalsContact C-N 3.28Å; K36-R38 PolarHBondContact O-N 3.06Å; K36-K39 WeakPolarHBondContact O-CB 3.47Å; K36-K39 PolarHBondContact O-N 3.05Å; K36-K39 VanDerWaalsContact O-N 3.09Å; K36-D40 VanDerWaalsContact O-CG 3.3Å; K36-D40 PolarHBondContact O-N 3.34Å
37	R	93.9	Very high	93.8	Very high	162 Å²	162	102 Å²	102	61%	0.611	49%	0.489	S	S	*	.	H	α-helix	trans	-58.5	-37.4	176.9	-74.9	-173.6	-73.2	157.5	-7.5	113.1	K33 A34 E35 A41	K33-R37 WeakPolarHBondContact O-CG 3.28Å; K33-R37 PolarHBondContact O-N 3.06Å; A34-R37 PolarHBondContact O-N 3.47Å; E35-R37 PolarHBondContact O-N 3.37Å; R37-A41 WeakPolarHBondContact O-CB 3.35Å; R37-A41 PolarHBondContact O-N 3.43Å
38	R	94.1	Very high	94.2	Very high	175 Å²	175	103.7 Å²	103.7	66%	0.66	49%	0.491	S	S	*	.	H	α-helix	trans	-66.9	-39.3	176.1	-71.3	172.9	178.7	-177.8	-1.3	112.1	A34 E35 K36 R42	A34-R38 WeakPolarHBondContact O-CG 3.49Å; A34-R38 PolarHBondContact O-N 2.76Å; A34-R38 VanDerWaalsContact O-N 3.08Å; E35-R38 PolarHBondContact O-N 3.09Å; K36-R38 VanDerWaalsContact C-N 3.28Å; K36-R38 PolarHBondContact O-N 3.06Å; R38-R42 WeakPolarHBondContact O-CB 3.46Å; R38-R42 PolarHBondContact O-N 2.95Å
39	K	94.8	Very high	94.4	Very high	127 Å²	127	104.7 Å²	104.7	55%	0.552	49%	0.493	S	S	*	.	H	α-helix	trans	-65.9	-44.6	175.7	-71.3	-179.7	179.3	-179.7	0	111.5	E35 K36 R42 E43	E35-K39 PolarHBondContact O-N 3.07Å; E35-K39 WeakPolarHBondContact OE1-CE 3.45Å; K36-K39 WeakPolarHBondContact O-CB 3.47Å; K36-K39 PolarHBondContact O-N 3.05Å; K36-K39 VanDerWaalsContact O-N 3.09Å; K39-R42 WeakPolarHBondContact O-CB 3.49Å; K39-R42 PolarHBondContact O-N 2.98Å; K39-R42 VanDerWaalsContact O-N 3.16Å; K39-E43 PolarHBondContact O-N 2.95Å
40	D	94.6	Very high	94.5	Very high	82 Å²	82	109 Å²	109	44%	0.439	51%	0.505	S	S	.	.	H	α-helix	trans	-61.2	-47.3	178.2	-62.8	-18	0	0	0	110.7	K36 R42 E43 D44	K36-D40 VanDerWaalsContact O-CG 3.3Å; K36-D40 PolarHBondContact O-N 3.34Å; D40-R42 VanDerWaalsContact C-N 3.27Å; D40-R42 PolarHBondContact O-N 3.32Å; D40-E43 WeakPolarHBondContact O-CB 3.44Å; D40-E43 PolarHBondContact O-N 3.14Å; D40-E43 VanDerWaalsContact O-N 3.11Å; D40-D44 PolarHBondContact O-N 3.11Å
41	A	94.7	Very high	94.5	Very high	58 Å²	58	110.9 Å²	110.9	48%	0.479	51%	0.514	S	S	.	.	H	α-helix	trans	-62	-32.6	176	0	0	0	0	0	113.5	R37 R45	R37-A41 WeakPolarHBondContact O-CB 3.35Å; R37-A41 PolarHBondContact O-N 3.43Å; A41-R45 PolarHBondContact O-N 2.94Å; A41-R45 VanDerWaalsContact O-N 3.14Å
42	R	95.9	Very high	94.5	Very high	186 Å²	186	110.2 Å²	110.2	70%	0.702	50%	0.503	S	S	*	.	H	α-helix	trans	-68.5	-42.6	174.5	-176.2	-179.1	-178.2	-178.1	0.6	111	R38 K39 D40 R45 I46	R38-R42 WeakPolarHBondContact O-CB 3.46Å; R38-R42 PolarHBondContact O-N 2.95Å; K39-R42 WeakPolarHBondContact O-CB 3.49Å; K39-R42 PolarHBondContact O-N 2.98Å; K39-R42 VanDerWaalsContact O-N 3.16Å; D40-R42 VanDerWaalsContact C-N 3.27Å; D40-R42 PolarHBondContact O-N 3.32Å; R42-R45 PolarHBondContact O-N 3.27Å; R42-I46 HydrophobicContact CG-CD1 4.16Å; R42-I46 WeakPolarHBondContact O-CG1 3.43Å; R42-I46 PolarHBondContact O-N 3.16Å
43	E	96.8	Very high	94.4	Very high	93 Å²	93	110.2 Å²	110.2	44%	0.435	50%	0.503	S	S	.	.	H	α-helix	trans	-63.6	-43.9	177.8	-170.9	58.7	-153.5	0	0	111	K39 D40 R45 I46 N47	K39-E43 PolarHBondContact O-N 2.95Å; D40-E43 WeakPolarHBondContact O-CB 3.44Å; D40-E43 PolarHBondContact O-N 3.14Å; D40-E43 VanDerWaalsContact O-N 3.11Å; E43-R45 VanDerWaalsContact C-N 3.3Å; E43-R45 PolarHBondContact O-N 3.5Å; E43-I46 WeakPolarHBondContact O-CB 3.49Å; E43-I46 PolarHBondContact O-N 3.29Å; E43-I46 VanDerWaalsContact O-N 3.12Å; E43-N47 PolarHBondContact O-N 2.89Å; E43-N47 PolarHBondContact O-ND2 3.23Å
44	D	95.4	Very high	94.2	Very high	110 Å²	110	106.2 Å²	106.2	59%	0.588	50%	0.495	S	S	*	.	H	α-helix	trans	-57.7	-43.6	174.4	-73.2	-18.4	0	0	0	111.9	D40 I46 N47 Y48	D40-D44 PolarHBondContact O-N 3.11Å; D44-I46 PolarHBondContact O-N 2.88Å; D44-N47 PolarHBondContact O-N 3.28Å; D44-Y48 WeakPolarHBondContact O-CB 3.41Å; D44-Y48 PolarHBondContact O-N 2.9Å
45	R	96	Very high	93.9	Very high	177 Å²	177	107.9 Å²	107.9	67%	0.668	50%	0.5	S	S	*	.	H	α-helix	trans	-64.6	-39.3	176.7	-174	173.5	176.6	-115.4	-0.5	112.2	A41 R42 E43 L49	A41-R45 PolarHBondContact O-N 2.94Å; A41-R45 VanDerWaalsContact O-N 3.14Å; R42-R45 PolarHBondContact O-N 3.27Å; E43-R45 VanDerWaalsContact C-N 3.3Å; E43-R45 PolarHBondContact O-N 3.5Å; R45-L49 HydrophobicContact CG-CD1 4.46Å; R45-L49 VanDerWaalsContact O-CG 3.32Å; R45-L49 WeakPolarHBondContact O-CG 3.42Å; R45-L49 PolarHBondContact O-N 3.02Å
46	I	96.4	Very high	93.4	Very high	61 Å²	61	109 Å²	109	31%	0.313	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-44.6	175.4	-71.5	166.6	0	0	0	110.2	R42 E43 D44 Y48 L49 K50	R42-I46 HydrophobicContact CG-CD1 4.16Å; R42-I46 WeakPolarHBondContact O-CG1 3.43Å; R42-I46 PolarHBondContact O-N 3.16Å; E43-I46 WeakPolarHBondContact O-CB 3.49Å; E43-I46 PolarHBondContact O-N 3.29Å; E43-I46 VanDerWaalsContact O-N 3.12Å; D44-I46 PolarHBondContact O-N 2.88Å; I46-Y48 PolarHBondContact O-N 3.48Å; I46-L49 PolarHBondContact O-N 3.12Å; I46-K50 HydrophobicContact CG2-CD 4.26Å; I46-K50 HydrophobicContact CG2-CG 4.5Å; I46-K50 WeakPolarHBondContact O-CG 3.32Å; I46-K50 PolarHBondContact O-N 3.35Å
47	N	95.9	Very high	92.9	Very high	73 Å²	73	107.4 Å²	107.4	39%	0.39	51%	0.506	S	S	.	.	H	α-helix	trans	-64	-41.1	179	-72.5	-31.8	0	0	0	112.1	E43 D44 K50 H51	E43-N47 PolarHBondContact O-N 2.89Å; E43-N47 PolarHBondContact O-ND2 3.23Å; D44-N47 PolarHBondContact O-N 3.28Å; N47-K50 PolarHBondContact O-N 3.26Å; N47-H51 PolarHBondContact O-N 2.95Å
48	Y	95.4	Very high	92.1	Very high	157 Å²	157	107.9 Å²	107.9	62%	0.616	51%	0.508	S	S	*	.	H	α-helix	trans	-59.1	-47.3	171.9	178.7	-99.6	0	0	0	112	D44 I46 K50 H51 V52	D44-Y48 WeakPolarHBondContact O-CB 3.41Å; D44-Y48 PolarHBondContact O-N 2.9Å; I46-Y48 PolarHBondContact O-N 3.48Å; Y48-K50 PolarHBondContact O-N 3.41Å; Y48-H51 WeakPolarHBondContact O-CB 3.48Å; Y48-H51 PolarHBondContact O-N 3.48Å; Y48-V52 HydrophobicContact CD1-CG2 4.18Å; Y48-V52 HydrophobicContact CE1-CG2 3.72Å; Y48-V52 HydrophobicContact CE2-CG2 4.24Å; Y48-V52 WeakPolarHBondContact O-CG2 3.5Å; Y48-V52 PolarHBondContact O-N 3.4Å
49	L	94.5	Very high	91.2	Very high	77 Å²	77	108.6 Å²	108.6	40%	0.403	51%	0.511	S	S	.	.	H	α-helix	trans	-63.8	-41.4	179	-72.1	173.1	0	0	0	112.4	R45 I46 H51 V52 I53	R45-L49 HydrophobicContact CG-CD1 4.46Å; R45-L49 VanDerWaalsContact O-CG 3.32Å; R45-L49 WeakPolarHBondContact O-CG 3.42Å; R45-L49 PolarHBondContact O-N 3.02Å; I46-L49 PolarHBondContact O-N 3.12Å; L49-H51 VanDerWaalsContact C-N 3.28Å; L49-H51 PolarHBondContact O-N 2.9Å; L49-V52 PolarHBondContact O-N 3.18Å; L49-I53 WeakPolarHBondContact O-CB 3.28Å; L49-I53 VanDerWaalsContact O-CG1 3.28Å; L49-I53 WeakPolarHBondContact O-CG1 3.42Å; L49-I53 PolarHBondContact O-N 3.15Å
50	K	94.2	Very high	89.8	Confident	130 Å²	130	104.6 Å²	104.6	57%	0.565	51%	0.506	S	S	*	.	H	α-helix	trans	-57.5	-42.9	173.1	-75	175.9	-179.8	170.6	0	111.3	I46 N47 Y48 I53 G54	I46-K50 HydrophobicContact CG2-CD 4.26Å; I46-K50 HydrophobicContact CG2-CG 4.5Å; I46-K50 WeakPolarHBondContact O-CG 3.32Å; I46-K50 PolarHBondContact O-N 3.35Å; N47-K50 PolarHBondContact O-N 3.26Å; Y48-K50 PolarHBondContact O-N 3.41Å; K50-I53 PolarHBondContact O-N 3.34Å; K50-G54 PolarHBondContact O-N 3.21Å
51	H	92.2	Very high	88.3	Confident	119 Å²	119	106 Å²	106	55%	0.551	51%	0.513	S	S	*	.	H	α-helix	trans	-63.8	-45.1	177.2	-174.1	74.9	0	0	0	112.2	N47 Y48 L49 G54 N55	N47-H51 PolarHBondContact O-N 2.95Å; Y48-H51 WeakPolarHBondContact O-CB 3.48Å; Y48-H51 PolarHBondContact O-N 3.48Å; L49-H51 VanDerWaalsContact C-N 3.28Å; L49-H51 PolarHBondContact O-N 2.9Å; H51-G54 PolarHBondContact O-N 3.48Å; H51-N55 PolarHBondContact CD2-ND2 3.31Å; H51-N55 VanDerWaalsContact CD2-ND2 3.33Å; H51-N55 PolarHBondContact NE2-ND2 2.87Å; H51-N55 PolarHBondContact O-N 3.33Å; H51-N55 PolarHBondContact O-ND2 3.4Å
52	V	91.9	Very high	86.7	Confident	46 Å²	46	106.6 Å²	106.6	28%	0.279	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-47.1	176.6	172.9	0	0	0	0	111.2	Y48 L49 G54 N55 L56	Y48-V52 HydrophobicContact CD1-CG2 4.18Å; Y48-V52 HydrophobicContact CE1-CG2 3.72Å; Y48-V52 HydrophobicContact CE2-CG2 4.24Å; Y48-V52 WeakPolarHBondContact O-CG2 3.5Å; Y48-V52 PolarHBondContact O-N 3.4Å; L49-V52 PolarHBondContact O-N 3.18Å; V52-G54 PolarHBondContact O-N 3.48Å; V52-N55 PolarHBondContact O-N 3.39Å; V52-L56 HydrophobicContact CG1-CD1 4.06Å; V52-L56 HydrophobicContact CG1-CG 4.41Å; V52-L56 WeakPolarHBondContact O-CG 3.45Å; V52-L56 PolarHBondContact O-N 2.95Å
53	I	89.8	Confident	84.8	Confident	111 Å²	111	102.6 Å²	102.6	57%	0.569	52%	0.515	S	S	*	.	H	α-helix	trans	-60.9	-45.8	178.4	-68.2	164.9	0	0	0	110.7	L49 K50 N55 L56 D57	L49-I53 WeakPolarHBondContact O-CB 3.28Å; L49-I53 VanDerWaalsContact O-CG1 3.28Å; L49-I53 WeakPolarHBondContact O-CG1 3.42Å; L49-I53 PolarHBondContact O-N 3.15Å; K50-I53 PolarHBondContact O-N 3.34Å; I53-N55 VanDerWaalsContact C-N 3.28Å; I53-N55 PolarHBondContact O-N 2.91Å; I53-L56 PolarHBondContact O-N 3.02Å; I53-L56 VanDerWaalsContact O-N 3.15Å; I53-D57 PolarHBondContact O-N 2.93Å
54	G	89.3	Confident	82.7	Confident	33 Å²	33	103.7 Å²	103.7	34%	0.34	53%	0.528	S	S	.	.	H	α-helix	trans	-60.9	-35.7	177.1	0	0	0	0	0	113.3	K50 H51 V52 R58	K50-G54 PolarHBondContact O-N 3.21Å; H51-G54 PolarHBondContact O-N 3.48Å; V52-G54 PolarHBondContact O-N 3.48Å; G54-R58 WeakPolarHBondContact O-CB 3.37Å; G54-R58 PolarHBondContact O-N 2.99Å; G54-R58 VanDerWaalsContact O-N 3.09Å
55	N	86.8	Confident	80.6	Confident	63 Å²	63	103.4 Å²	103.4	34%	0.337	53%	0.532	S	S	.	.	H	α-helix	trans	-72	-36.7	174.6	-72	-24.9	0	0	0	112.6	H51 V52 I53 R58 R59	H51-N55 PolarHBondContact CD2-ND2 3.31Å; H51-N55 VanDerWaalsContact CD2-ND2 3.33Å; H51-N55 PolarHBondContact NE2-ND2 2.87Å; H51-N55 PolarHBondContact O-N 3.33Å; H51-N55 PolarHBondContact O-ND2 3.4Å; V52-N55 PolarHBondContact O-N 3.39Å; I53-N55 VanDerWaalsContact C-N 3.28Å; I53-N55 PolarHBondContact O-N 2.91Å; N55-R58 PolarHBondContact OD1-NH1 3.09Å; N55-R59 WeakPolarHBondContact O-CB 3.49Å; N55-R59 PolarHBondContact O-N 3Å
56	L	84.4	Confident	78.8	Confident	111 Å²	111	97.9 Å²	97.9	58%	0.581	53%	0.53	S	S	*	.	H	α-helix	trans	-65.2	-45.2	175.3	-71.9	173	0	0	0	111.4	V52 I53 R59 G60	V52-L56 HydrophobicContact CG1-CD1 4.06Å; V52-L56 HydrophobicContact CG1-CG 4.41Å; V52-L56 WeakPolarHBondContact O-CG 3.45Å; V52-L56 PolarHBondContact O-N 2.95Å; I53-L56 PolarHBondContact O-N 3.02Å; I53-L56 VanDerWaalsContact O-N 3.15Å; L56-R59 PolarHBondContact O-N 3.34Å; L56-G60 PolarHBondContact O-N 3.02Å
57	D	83	Confident	76.7	Confident	104 Å²	104	101 Å²	101	56%	0.556	55%	0.552	S	S	*	*	H	α-helix	trans	-60.6	-45.8	176.1	-175.3	46	0	0	0	111.3	I53 R59 G60 N61	I53-D57 PolarHBondContact O-N 2.93Å; D57-R59 VanDerWaalsContact C-N 3.31Å; D57-R59 PolarHBondContact O-N 3.15Å; D57-G60 PolarHBondContact O-N 3.34Å; D57-N61 WeakPolarHBondContact O-CB 3.44Å; D57-N61 VanDerWaalsContact O-CG 3.3Å; D57-N61 PolarHBondContact O-N 3Å; D57-N61 PolarHBondContact O-ND2 3.2Å; D57-N61 VanDerWaalsContact O-ND2 3.15Å; D57-N61 PolarHBondContact OD1-ND2 3.43Å
58	R	77.7	Confident	74.7	Confident	173 Å²	173	102.5 Å²	102.5	65%	0.653	57%	0.568	S	S	*	*	H	α-helix	trans	-59.2	-40.5	174.6	-169.2	-176.7	-63.1	136	2.3	112.5	G54 N55 A62	G54-R58 WeakPolarHBondContact O-CB 3.37Å; G54-R58 PolarHBondContact O-N 2.99Å; G54-R58 VanDerWaalsContact O-N 3.09Å; N55-R58 PolarHBondContact OD1-NH1 3.09Å; R58-A62 WeakPolarHBondContact O-CB 3.48Å; R58-A62 PolarHBondContact O-N 3.09Å; R58-A62 VanDerWaalsContact O-N 3.11Å
59	R	75.1	Confident	72.8	Confident	190 Å²	190	102.6 Å²	102.6	72%	0.717	57%	0.574	S	S	*	*	H	α-helix	trans	-70.8	-41.2	179.1	-170.1	178.3	-177.1	-171.2	0.6	112	N55 L56 D57 N61 A62 T63	N55-R59 WeakPolarHBondContact O-CB 3.49Å; N55-R59 PolarHBondContact O-N 3Å; L56-R59 PolarHBondContact O-N 3.34Å; D57-R59 VanDerWaalsContact C-N 3.31Å; D57-R59 PolarHBondContact O-N 3.15Å; R59-N61 VanDerWaalsContact C-N 3.29Å; R59-N61 PolarHBondContact O-N 3.38Å; R59-A62 PolarHBondContact O-N 3.48Å; R59-T63 PolarHBondContact O-N 3.47Å; R59-T63 PolarHBondContact O-OG1 3.45Å
60	G	66.2	Low	71.2	Confident	43 Å²	43	107.7 Å²	107.7	44%	0.443	59%	0.593	S	S	.	*	H	α-helix	trans	-59.9	-39.8	175.1	0	0	0	0	0	112.1	L56 D57 T63	L56-G60 PolarHBondContact O-N 3.02Å; D57-G60 PolarHBondContact O-N 3.34Å; G60-T63 PolarHBondContact O-OG1 3.22Å; G60-T63 VanDerWaalsContact O-OG1 3.09Å
61	N	62.5	Low	69.6	Low	110 Å²	110	107.4 Å²	107.4	59%	0.588	60%	0.602	S	S	*	*	H	α-helix	trans	-73.7	-26.1	176.9	-67.1	-30.1	0	0	0	113.6	D57 R59 T63	D57-N61 WeakPolarHBondContact O-CB 3.44Å; D57-N61 VanDerWaalsContact O-CG 3.3Å; D57-N61 PolarHBondContact O-N 3Å; D57-N61 PolarHBondContact O-ND2 3.2Å; D57-N61 VanDerWaalsContact O-ND2 3.15Å; D57-N61 PolarHBondContact OD1-ND2 3.43Å; R59-N61 VanDerWaalsContact C-N 3.29Å; R59-N61 PolarHBondContact O-N 3.38Å; N61-T63 VanDerWaalsContact C-N 3.34Å
62	A	61	Low	68	Low	71 Å²	71	109.7 Å²	109.7	59%	0.587	62%	0.619	S	S	*	*	H	α-helix	trans	-75.1	-19.7	178.7	0	0	0	0	0	113.6	R58 R59 T64	R58-A62 WeakPolarHBondContact O-CB 3.48Å; R58-A62 PolarHBondContact O-N 3.09Å; R58-A62 VanDerWaalsContact O-N 3.11Å; R59-A62 PolarHBondContact O-N 3.48Å; A62-T64 PolarHBondContact O-N 3.11Å
63	T	55.5	Low	66.6	Low	102 Å²	102	114.6 Å²	114.6	63%	0.626	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.3	14.7	-173.7	46.7	0	0	0	0	115.8	R59 G60 N61 P65	R59-T63 PolarHBondContact O-N 3.47Å; R59-T63 PolarHBondContact O-OG1 3.45Å; G60-T63 PolarHBondContact O-OG1 3.22Å; G60-T63 VanDerWaalsContact O-OG1 3.09Å; N61-T63 VanDerWaalsContact C-N 3.34Å; T63-P65 VanDerWaalsContact C-CD 3.48Å
64	T	54.2	Low	65.4	Low	116 Å²	116	114.8 Å²	114.8	71%	0.712	68%	0.684	S	S	*	*			trans	-126.1	70.1	164.8	28.7	0	0	0	0	112.1	A62 G66	A62-T64 PolarHBondContact O-N 3.11Å; T64-G66 VanDerWaalsContact C-N 3.27Å; T64-G66 PolarHBondContact O-N 2.92Å; T64-G66 VanDerWaalsContact O-N 3.14Å
65	P	51.5	Low	64.1	Low	104 Å²	104	119.1 Å²	119.1	68%	0.675	70%	0.703	S	S	*	*			trans	-65.5	103.9	140	6.6	11.4	0	0	0	104.7	T63 T67	T63-P65 VanDerWaalsContact C-CD 3.48Å; P65-T67 PolarHBondContact O-N 2.98Å
66	G	56.8	Low	62.9	Low	61 Å²	61	122.2 Å²	122.2	63%	0.629	72%	0.723	S	S	*	*			trans	-44.1	117.9	176	0	0	0	0	0	108.8	T64 S68	T64-G66 VanDerWaalsContact C-N 3.27Å; T64-G66 PolarHBondContact O-N 2.92Å; T64-G66 VanDerWaalsContact O-N 3.14Å; G66-S68 PolarHBondContact O-N 3.01Å
67	T	51.8	Low	61.6	Low	126 Å²	126	122.9 Å²	122.9	77%	0.773	73%	0.731	S	S	*	*			trans	-63.1	77.2	161.2	-33.3	0	0	0	0	105.5	P65 E69	P65-T67 PolarHBondContact O-N 2.98Å; T67-E69 HydrophobicContact CG2-CG 4.25Å; T67-E69 PolarHBondContact O-N 3.14Å
68	S	55.3	Low	60.3	Low	105 Å²	105	124.1 Å²	124.1	73%	0.734	74%	0.742	S	S	*	*			trans	-72.7	75.7	158.2	-74	0	0	0	0	105	G66 K70	G66-S68 PolarHBondContact O-N 3.01Å; S68-K70 PolarHBondContact O-N 2.86Å
69	E	55.2	Low	59.1	Low	159 Å²	159	120.8 Å²	120.8	74%	0.743	75%	0.748	S	S	*	*			trans	-56.1	91.5	147	-88.9	176.6	165.7	0	0	105.1	T67 T71	T67-E69 HydrophobicContact CG2-CG 4.25Å; T67-E69 PolarHBondContact O-N 3.14Å; E69-T71 PolarHBondContact O-N 2.73Å
70	K	60.9	Low	58	Low	185 Å²	185	115.9 Å²	115.9	80%	0.804	75%	0.75	S	S	*	*			trans	-68.8	93.5	150.8	-72.5	-172.7	178.3	-177	0	103.8	S68 D72	S68-K70 PolarHBondContact O-N 2.86Å; K70-D72 PolarHBondContact O-N 3.31Å
71	T	59.5	Low	57.4	Low	123 Å²	123	121.5 Å²	121.5	76%	0.755	77%	0.774	S	S	*	*			trans	-52.7	118.3	161.5	45.2	0	0	0	0	107.1	E69 G73	E69-T71 PolarHBondContact O-N 2.73Å; T71-G73 PolarHBondContact O-N 3.18Å
72	D	58.8	Low	56.9	Low	168 Å²	168	122.4 Å²	122.4	90%	0.898	79%	0.789	S	S	*	*			trans	-55	123.8	173.9	-59.2	-41.6	0	0	0	109.5	K70	K70-D72 PolarHBondContact O-N 3.31Å
73	G	62.6	Low	56.6	Low	149 Å²	149	127.1 Å²	127.1	100%	1.536	81%	0.808	S	S	*	*			trans	-152.5	0	168.6	0	0	0	0	0	108.5	T71	T71-G73 PolarHBondContact O-N 3.18Å

Retrieved 73 of 73 residues in 55.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).