A0A3Q0KQG2_SCHMA Loading...

SMI1_KNR4 domain-containing protein AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KQG2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 43 aa.

						>A0A3Q0KQG2_SCHMA|A0A3Q0KQG2
MNRSNSFAKTTVQSDMSNKNGSSADSWNSRSNDIVNTGRRSKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.7	Low	65.9	Low	236 Å²	236	146.8 Å²	146.8	100%	1.163	78%	0.779	S	S	*	*				0	113.5	0	-157.6	174.6	-80.3	0	0	107.5
2	N	63.9	Low	65.6	Low	146 Å²	146	144.2 Å²	144.2	78%	0.781	77%	0.772	S	S	*	*			trans	-73.1	123.6	-167.4	-156.4	1.7	0	0	0	110.6	S4	N2-S4 PolarHBondContact OD1-OG 3.48Å
3	R	69.5	Low	64.8	Low	228 Å²	228	146.9 Å²	146.9	86%	0.86	78%	0.777	S	S	*	*			trans	-120.4	73.3	172	-72.9	-175.7	-178.8	148.5	-0.1	109	N5	R3-N5 VanDerWaalsContact C-N 3.34Å; R3-N5 PolarHBondContact O-N 3.02Å
4	S	70.2	Confident	64.5	Low	80 Å²	80	141.2 Å²	141.2	56%	0.559	76%	0.755	S	S	*	*			trans	-70.4	95.5	167	-38	0	0	0	0	107.4	N2 S6	N2-S4 PolarHBondContact OD1-OG 3.48Å; S4-S6 PolarHBondContact O-N 2.83Å
5	N	66.5	Low	64.3	Low	134 Å²	134	140.2 Å²	140.2	72%	0.717	75%	0.75	S	S	*	*			trans	-73.2	72.4	171.8	-119.7	20.7	0	0	0	108.3	R3 F7	R3-N5 VanDerWaalsContact C-N 3.34Å; R3-N5 PolarHBondContact O-N 3.02Å; N5-F7 HydrophobicContact CB-CD2 4.4Å; N5-F7 VanDerWaalsContact ND2-CE2 3.35Å; N5-F7 WeakPolarHBondContact ND2-CE2 3.35Å; N5-F7 PolarHBondContact O-N 2.9Å
6	S	64.9	Low	64	Low	105 Å²	105	138.4 Å²	138.4	73%	0.734	74%	0.737	S	S	*	*			trans	-74.7	69.7	172.2	-62.5	0	0	0	0	108.6	S4 A8	S4-S6 PolarHBondContact O-N 2.83Å; S6-A8 PolarHBondContact O-N 2.82Å
7	F	66.6	Low	63.8	Low	167 Å²	167	133.9 Å²	133.9	73%	0.732	72%	0.72	S	S	*	*			trans	-71.6	81.2	154.6	-70.3	-70.4	0	0	0	106.3	N5 K9	N5-F7 HydrophobicContact CB-CD2 4.4Å; N5-F7 VanDerWaalsContact ND2-CE2 3.35Å; N5-F7 WeakPolarHBondContact ND2-CE2 3.35Å; N5-F7 PolarHBondContact O-N 2.9Å; F7-K9 PolarHBondContact O-N 2.87Å
8	A	67.1	Low	63.4	Low	86 Å²	86	134.4 Å²	134.4	71%	0.711	72%	0.722	S	S	*	*			trans	-58	97	159.8	0	0	0	0	0	105.2	S6 T10	S6-A8 PolarHBondContact O-N 2.82Å; A8-T10 VanDerWaalsContact C-N 3.29Å; A8-T10 PolarHBondContact O-N 2.87Å
9	K	67.7	Low	63	Low	194 Å²	194	135.5 Å²	135.5	84%	0.843	72%	0.72	S	S	*	*			trans	-57.6	106.7	166	-70.2	174.5	-176.3	-103.5	0	103.6	F7 T11	F7-K9 PolarHBondContact O-N 2.87Å; K9-T11 PolarHBondContact O-N 2.9Å
10	T	62.7	Low	62.6	Low	117 Å²	117	136.2 Å²	136.2	72%	0.718	72%	0.723	S	S	*	*			trans	-46.8	111.6	172.3	51.2	0	0	0	0	105.5	A8 V12	A8-T10 VanDerWaalsContact C-N 3.29Å; A8-T10 PolarHBondContact O-N 2.87Å; T10-V12 PolarHBondContact O-N 2.67Å
11	T	62	Low	62.2	Low	122 Å²	122	132.2 Å²	132.2	75%	0.748	72%	0.715	S	S	*	*			trans	-56.6	105.8	165.7	-58.1	0	0	0	0	103	K9 Q13	K9-T11 PolarHBondContact O-N 2.9Å; T11-Q13 PolarHBondContact O-N 2.8Å
12	V	62.3	Low	61.8	Low	115 Å²	115	124.9 Å²	124.9	70%	0.697	69%	0.687	S	S	*	*			trans	-62	89	169.2	178.1	0	0	0	0	102.9	T10 S14	T10-V12 PolarHBondContact O-N 2.67Å; V12-S14 PolarHBondContact O-N 2.84Å
13	Q	55.6	Low	61.6	Low	180 Å²	180	123.1 Å²	123.1	84%	0.841	69%	0.686	S	S	*	*			trans	-65.4	76.1	155.1	-87.6	-179.5	-87.6	0	0	103.2	T11 D15	T11-Q13 PolarHBondContact O-N 2.8Å; Q13-D15 PolarHBondContact O-N 2.79Å
14	S	61	Low	61	Low	67 Å²	67	115.8 Å²	115.8	47%	0.469	68%	0.675	S	S	.	*			trans	-59.5	98.7	154.7	49.9	0	0	0	0	103	V12 M16	V12-S14 PolarHBondContact O-N 2.84Å; S14-M16 PolarHBondContact O-N 3.13Å; S14-M16 VanDerWaalsContact C-N 3.31Å
15	D	61.5	Low	60.4	Low	126 Å²	126	115.8 Å²	115.8	67%	0.674	67%	0.668	S	S	*	*			trans	-47.8	104.2	166	-175.9	-133.8	0	0	0	106.1	Q13 S17	Q13-D15 PolarHBondContact O-N 2.79Å; D15-S17 VanDerWaalsContact CG-OG 3.24Å; D15-S17 PolarHBondContact O-N 3.04Å; D15-S17 WeakPolarHBondContact OD1-CB 3.22Å; D15-S17 PolarHBondContact OD1-OG 2.86Å
16	M	58.9	Low	59.9	Low	111 Å²	111	113 Å²	113	55%	0.547	66%	0.659	S	S	.	*	G	3₁₀ helix	trans	-71.8	7.9	-177.2	-70.6	-88.6	178.9	0	0	111.1	S14 N18 K19	S14-M16 PolarHBondContact O-N 3.13Å; S14-M16 VanDerWaalsContact C-N 3.31Å; M16-N18 PolarHBondContact O-N 3.45Å; M16-N18 VanDerWaalsContact O-N 3.12Å; M16-K19 WeakPolarHBondContact O-CB 3.28Å; M16-K19 PolarHBondContact SD-NZ 3.27Å; M16-K19 HydrophobicContact SD-CG 4.48Å; M16-K19 WeakPolarHBondContact SD-CE 3.16Å; M16-K19 HydrophobicContact SD-CD 3.86Å; M16-K19 PolarHBondContact O-N 3.44Å; M16-K19 HydrophobicContact CB-CD 4.42Å
17	S	59.7	Low	59.5	Low	63 Å²	63	117.8 Å²	117.8	44%	0.441	66%	0.661	S	S	.	*	G	3₁₀ helix	trans	-55.2	-27.3	178.8	63.2	0	0	0	0	112.7	D15 K19	D15-S17 VanDerWaalsContact CG-OG 3.24Å; D15-S17 PolarHBondContact O-N 3.04Å; D15-S17 WeakPolarHBondContact OD1-CB 3.22Å; D15-S17 PolarHBondContact OD1-OG 2.86Å; S17-K19 VanDerWaalsContact C-N 3.29Å; S17-K19 PolarHBondContact O-N 2.49Å
18	N	56.6	Low	59.1	Low	143 Å²	143	114.2 Å²	114.2	77%	0.765	65%	0.65	S	S	*	*	G	3₁₀ helix	trans	-81	3.3	177.3	-95.4	19.1	0	0	0	115.2	M16 N20 G21	M16-N18 PolarHBondContact O-N 3.45Å; M16-N18 VanDerWaalsContact O-N 3.12Å; N18-N20 PolarHBondContact O-N 3.26Å; N18-G21 VanDerWaalsContact O-N 3.1Å; N18-G21 PolarHBondContact O-N 3.49Å
19	K	55.7	Low	58.7	Low	155 Å²	155	114 Å²	114	67%	0.674	64%	0.644	S	S	*	*	G	3₁₀ helix	trans	-69.3	-14.4	168.9	-76.8	-178.2	169.8	169.9	0	113.4	M16 S17 G21	M16-K19 WeakPolarHBondContact O-CB 3.28Å; M16-K19 PolarHBondContact SD-NZ 3.27Å; M16-K19 HydrophobicContact SD-CG 4.48Å; M16-K19 WeakPolarHBondContact SD-CE 3.16Å; M16-K19 HydrophobicContact SD-CD 3.86Å; M16-K19 PolarHBondContact O-N 3.44Å; M16-K19 HydrophobicContact CB-CD 4.42Å; S17-K19 VanDerWaalsContact C-N 3.29Å; S17-K19 PolarHBondContact O-N 2.49Å; K19-G21 VanDerWaalsContact C-N 3.28Å
20	N	56.4	Low	58.1	Low	148 Å²	148	112.6 Å²	112.6	79%	0.791	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-83.5	-4.7	171.4	-74.5	67.6	0	0	0	112.9	N18 S22	N18-N20 PolarHBondContact O-N 3.26Å; N20-S22 PolarHBondContact O-N 3.12Å
21	G	53	Low	57.9	Low	54 Å²	54	110.5 Å²	110.5	56%	0.557	62%	0.623	S	S	*	*	S	Bend	trans	-70.7	98.8	163.6	0	0	0	0	0	108.3	N18 K19 S23	N18-G21 VanDerWaalsContact O-N 3.1Å; N18-G21 PolarHBondContact O-N 3.49Å; K19-G21 VanDerWaalsContact C-N 3.28Å; G21-S23 PolarHBondContact O-N 3Å; G21-S23 VanDerWaalsContact O-N 3.12Å
22	S	55.9	Low	57.8	Low	81 Å²	81	110.2 Å²	110.2	57%	0.566	62%	0.617	S	S	*	*			trans	-29.9	115.2	177.3	-71.4	0	0	0	0	113	N20 A24 D25	N20-S22 PolarHBondContact O-N 3.12Å; S22-A24 PolarHBondContact O-N 3.35Å; S22-D25 PolarHBondContact O-N 3.1Å
23	S	59.3	Low	57.5	Low	110 Å²	110	110.5 Å²	110.5	77%	0.769	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.9	-5	168.6	-167.1	0	0	0	0	113.5	G21 D25	G21-S23 PolarHBondContact O-N 3Å; G21-S23 VanDerWaalsContact O-N 3.12Å; S23-D25 VanDerWaalsContact C-N 3.33Å; S23-D25 PolarHBondContact O-N 3.32Å
24	A	57.1	Low	57.6	Low	74 Å²	74	108 Å²	108	61%	0.612	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	-24.8	175.2	0	0	0	0	0	113.9	S22	S22-A24 PolarHBondContact O-N 3.35Å
25	D	57.1	Low	57.5	Low	80 Å²	80	109.6 Å²	109.6	43%	0.428	61%	0.612	S	S	.	*	H	α-helix	trans	-91.6	-2.7	-171.1	-68.2	-51.3	0	0	0	115.7	S22 S23 W27 N28 S29	S22-D25 PolarHBondContact O-N 3.1Å; S23-D25 VanDerWaalsContact C-N 3.33Å; S23-D25 PolarHBondContact O-N 3.32Å; D25-W27 PolarHBondContact O-N 3.46Å; D25-N28 HydrophobicContact CB-CB 4.33Å; D25-N28 PolarHBondContact O-N 3.14Å; D25-N28 PolarHBondContact OD1-ND2 3.24Å; D25-S29 VanDerWaalsContact O-OG 3.14Å; D25-S29 PolarHBondContact O-OG 3.35Å; D25-S29 PolarHBondContact O-N 3.36Å; D25-S29 VanDerWaalsContact O-N 3.07Å
26	S	56.4	Low	57.3	Low	76 Å²	76	109.8 Å²	109.8	53%	0.531	61%	0.613	S	S	.	*	H	α-helix	trans	-66	-26.1	174.9	-77.7	0	0	0	0	113
27	W	57.8	Low	57.1	Low	205 Å²	205	110.5 Å²	110.5	78%	0.777	62%	0.624	S	S	*	*	H	α-helix	trans	-91.2	-25.4	173.1	-60.9	93.4	0	0	0	112.4	D25 S31	D25-W27 PolarHBondContact O-N 3.46Å; W27-S31 PolarHBondContact O-OG 3.33Å
28	N	58	Low	57.3	Low	91 Å²	91	109.7 Å²	109.7	49%	0.487	63%	0.626	S	S	.	*	H	α-helix	trans	-72.3	-39.5	-179	-164.6	11.8	0	0	0	111.8	D25 R30 S31	D25-N28 HydrophobicContact CB-CB 4.33Å; D25-N28 PolarHBondContact O-N 3.14Å; D25-N28 PolarHBondContact OD1-ND2 3.24Å; N28-R30 VanDerWaalsContact C-N 3.35Å; N28-R30 PolarHBondContact O-N 3.07Å; N28-S31 PolarHBondContact O-N 3.21Å
29	S	58	Low	57.5	Low	83 Å²	83	113.2 Å²	113.2	58%	0.58	63%	0.629	S	S	*	*	H	α-helix	trans	-68.9	-29	-175.3	-58.4	0	0	0	0	113.9	D25	D25-S29 VanDerWaalsContact O-OG 3.14Å; D25-S29 PolarHBondContact O-OG 3.35Å; D25-S29 PolarHBondContact O-N 3.36Å; D25-S29 VanDerWaalsContact O-N 3.07Å
30	R	55	Low	57.5	Low	163 Å²	163	117 Å²	117	62%	0.615	64%	0.638	S	S	*	*	H	α-helix	trans	-78.6	-21	-179.3	-66.6	-178.2	-177.5	139.6	1.1	113.5	N28 N32 I34	N28-R30 VanDerWaalsContact C-N 3.35Å; N28-R30 PolarHBondContact O-N 3.07Å; R30-N32 PolarHBondContact O-N 3.48Å; R30-I34 WeakPolarHBondContact O-CG1 3.33Å; R30-I34 WeakPolarHBondContact O-CD1 3.47Å; R30-I34 VanDerWaalsContact O-CD1 3.28Å
31	S	58.2	Low	57.7	Low	74 Å²	74	115.5 Å²	115.5	52%	0.517	64%	0.64	S	S	.	*	H	α-helix	trans	-75.3	-24.5	-170.4	-61.9	0	0	0	0	113.1	W27 N28 V35	W27-S31 PolarHBondContact O-OG 3.33Å; N28-S31 PolarHBondContact O-N 3.21Å; S31-V35 WeakPolarHBondContact O-CG2 3.37Å
32	N	59.7	Low	57.9	Low	115 Å²	115	123 Å²	123	62%	0.615	66%	0.657	S	S	*	*	H	α-helix	trans	-86.3	-24.8	-179.6	-78.5	-28	0	0	0	114.3	R30	R30-N32 PolarHBondContact O-N 3.48Å
33	D	57	Low	57.7	Low	122 Å²	122	132.3 Å²	132.3	65%	0.652	69%	0.687	S	S	*	*	H	α-helix	trans	-81.4	-27	-179.5	-71.1	-25.3	0	0	0	112.9	V35 N36 T37	D33-V35 PolarHBondContact O-N 3.24Å; D33-N36 PolarHBondContact O-N 3.12Å; D33-T37 PolarHBondContact O-OG1 2.84Å
34	I	58.3	Low	57.7	Low	126 Å²	126	133.4 Å²	133.4	65%	0.646	68%	0.683	S	S	*	*	H	α-helix	trans	-70.5	-33.9	-177.1	-64.2	164.9	0	0	0	111.5	R30 N36	R30-I34 WeakPolarHBondContact O-CG1 3.33Å; R30-I34 WeakPolarHBondContact O-CD1 3.47Å; R30-I34 VanDerWaalsContact O-CD1 3.28Å; I34-N36 VanDerWaalsContact C-N 3.34Å
35	V	57.9	Low	57.7	Low	102 Å²	102	136.5 Å²	136.5	62%	0.618	69%	0.687	S	S	*	*	H	α-helix	trans	-75.6	-23.1	-179.5	-111.6	0	0	0	0	113.1	S31 D33	S31-V35 WeakPolarHBondContact O-CG2 3.37Å; D33-V35 PolarHBondContact O-N 3.24Å
36	N	57.4	Low	57.7	Low	129 Å²	129	139.7 Å²	139.7	69%	0.69	70%	0.701	S	S	*	*	H	α-helix	trans	-88.9	-8.8	-178.2	-92	-23.8	0	0	0	114.8	D33 I34 G38	D33-N36 PolarHBondContact O-N 3.12Å; I34-N36 VanDerWaalsContact C-N 3.34Å; N36-G38 VanDerWaalsContact C-N 3.25Å; N36-G38 PolarHBondContact O-N 3.07Å
37	T	55.4	Low	57.8	Low	126 Å²	126	143.4 Å²	143.4	77%	0.773	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	-0.6	171.6	9.6	0	0	0	0	113.5	D33	D33-T37 PolarHBondContact O-OG1 2.84Å
38	G	62.3	Low	57.8	Low	47 Å²	47	139.6 Å²	139.6	49%	0.485	71%	0.707	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.7	-4.3	-175.5	0	0	0	0	0	117.7	N36	N36-G38 VanDerWaalsContact C-N 3.25Å; N36-G38 PolarHBondContact O-N 3.07Å
39	R	61.5	Low	57.8	Low	216 Å²	216	142.8 Å²	142.8	82%	0.815	72%	0.722	S	S	*	*			trans	-119.2	82.2	-176.6	-72.1	-177.9	165.1	118	-4.2	110.7
40	R	55.2	Low	57.8	Low	234 Å²	234	147.1 Å²	147.1	88%	0.883	73%	0.732	S	S	*	*				41	116.6	100.9	-73.3	-174.8	165.2	99.2	-5.1	114.9
41	S	61	Low	58	Low	117 Å²	117	145.8 Å²	145.8	82%	0.818	74%	0.741	S	S	*	*				-144.6	116.7	111.7	52.5	0	0	0	0	109.3	K43	S41-K43 PolarHBondContact O-N 3.07Å
42	K	57.5	Low	58	Low	211 Å²	211	151.8 Å²	151.8	92%	0.917	76%	0.76	S	S	*	*			trans	-67.5	108.8	160.4	-79.2	177.6	170.3	176.5	0	105.9
43	K	52.8	Low	57.8	Low	277 Å²	277	155.2 Å²	155.2	100%	1.204	77%	0.773	S	S	*	*			trans	-163.9	0	148.2	-106.8	-178.1	-174.9	-172.3	0	108.8	S41	S41-K43 PolarHBondContact O-N 3.07Å

Retrieved 43 of 43 residues in 133 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).