A0A3Q0KQH5_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KQH5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 104 aa.

						>A0A3Q0KQH5_SCHMA|A0A3Q0KQH5
MVVPFLHAHRRSPILPEVEQNNNEDIGQGLSGIGLIPTTKEEDGNDVDDEKGEFNVSEVWGSNDIGGEKNHNIIININIDKLGSFEEIIDNDDDDKSIIVSFIE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.4	Very low	41	Very low	238 Å²	238	167.1 Å²	167.1	100%	1.172	83%	0.827	S	S	*	*				0	112.6	0	-179.5	177.3	-179.9	0	0	107.3
2	V	44.6	Very low	41.3	Very low	136 Å²	136	160.8 Å²	160.8	82%	0.824	81%	0.812	S	S	*	*			trans	-177.1	130.5	140.7	173.6	0	0	0	0	104.4
3	V	35.9	Very low	41.3	Very low	120 Å²	120	157.7 Å²	157.7	73%	0.727	81%	0.809	S	S	*	*			trans	-110	146.2	-172.3	-174.2	0	0	0	0	108.4	F5	V3-F5 PolarHBondContact O-N 2.9Å
4	P	41.2	Very low	41.7	Very low	119 Å²	119	157.6 Å²	157.6	77%	0.773	81%	0.808	S	S	*	*			trans	-59.3	135.2	-178.7	-20.6	30.8	0	0	0	112.4	L6	P4-L6 PolarHBondContact O-N 2.98Å
5	F	41.2	Very low	41.6	Very low	166 Å²	166	155.5 Å²	155.5	73%	0.728	80%	0.798	S	S	*	*			trans	-91	96	172.7	37.4	-87.8	0	0	0	109.1	V3 H7	V3-F5 PolarHBondContact O-N 2.9Å; F5-H7 AromaticContact CD2-CE1 3.94Å; F5-H7 PolarHBondContact O-N 2.94Å
6	L	43.8	Very low	41.4	Very low	160 Å²	160	153.6 Å²	153.6	84%	0.838	80%	0.799	S	S	*	*			trans	-77.7	109.8	162.7	-174.1	68.7	0	0	0	107.2	P4 A8	P4-L6 PolarHBondContact O-N 2.98Å; L6-A8 PolarHBondContact O-N 2.98Å
7	H	40.8	Very low	41.5	Very low	162 Å²	162	153.7 Å²	153.7	75%	0.75	80%	0.795	S	S	*	*			trans	-70.7	74.8	170.1	-74.6	101.1	0	0	0	109.4	F5 H9	F5-H7 AromaticContact CD2-CE1 3.94Å; F5-H7 PolarHBondContact O-N 2.94Å; H7-H9 PolarHBondContact O-N 3.49Å; H7-H9 VanDerWaalsContact O-N 3.16Å
8	A	43.7	Very low	41.6	Very low	76 Å²	76	152.6 Å²	152.6	63%	0.628	80%	0.796	S	S	*	*			trans	-70.6	107.6	165.7	0	0	0	0	0	107	L6 R10	L6-A8 PolarHBondContact O-N 2.98Å; A8-R10 VanDerWaalsContact C-N 3.34Å; A8-R10 PolarHBondContact O-N 3.43Å
9	H	42.1	Very low	41.4	Very low	187 Å²	187	152.7 Å²	152.7	87%	0.866	79%	0.792	S	S	*	*			trans	-53.4	102.6	166.5	-87.6	-93.6	0	0	0	107.9	H7 R11	H7-H9 PolarHBondContact O-N 3.49Å; H7-H9 VanDerWaalsContact O-N 3.16Å; H9-R11 PolarHBondContact O-N 3.47Å
10	R	36.7	Very low	41.2	Very low	234 Å²	234	153.1 Å²	153.1	88%	0.883	79%	0.79	S	S	*	*			trans	-63.7	110.1	161.5	-78.9	-174.5	174.3	174.9	-0.8	104.7	A8 S12	A8-R10 VanDerWaalsContact C-N 3.34Å; A8-R10 PolarHBondContact O-N 3.43Å; R10-S12 PolarHBondContact O-N 3.38Å
11	R	40.4	Very low	41	Very low	240 Å²	240	151.6 Å²	151.6	91%	0.906	78%	0.784	S	S	*	*			trans	-50.1	115	157.2	-80.7	-178	162	174.8	-5.5	105	H9	H9-R11 PolarHBondContact O-N 3.47Å
12	S	44.6	Very low	40.9	Very low	92 Å²	92	146.9 Å²	146.9	64%	0.643	76%	0.763	S	S	*	*			trans	-47.7	134.8	166.5	-60.9	0	0	0	0	106.4	R10 I14	R10-S12 PolarHBondContact O-N 3.38Å; S12-I14 PolarHBondContact O-N 2.73Å
13	P	42	Very low	40.6	Very low	120 Å²	120	147.2 Å²	147.2	78%	0.779	76%	0.76	S	S	*	*			trans	-59.1	94.3	161.5	-10.3	24.2	0	0	0	104.5	L15	P13-L15 PolarHBondContact O-N 3.46Å
14	I	46.4	Very low	40.8	Very low	156 Å²	156	150.7 Å²	150.7	80%	0.8	77%	0.768	S	S	*	*			trans	-64.1	98.4	159.7	-70.8	170.3	0	0	0	101.8	S12	S12-I14 PolarHBondContact O-N 2.73Å
15	L	39.6	Very low	40.8	Very low	126 Å²	126	151.8 Å²	151.8	66%	0.66	77%	0.768	S	S	*	*			trans	-45.7	145.8	160.8	-76.4	158.2	0	0	0	107.5	P13 E17	P13-L15 PolarHBondContact O-N 3.46Å; L15-E17 PolarHBondContact O-N 3.49Å
16	P	38.2	Very low	40.6	Very low	125 Å²	125	151 Å²	151	81%	0.812	77%	0.77	S	S	*	*	S	Bend	trans	-73.4	75.4	-177.1	32.5	-34.1	0	0	0	109.2
17	E	44.1	Very low	40	Very low	156 Å²	156	147 Å²	147	73%	0.729	77%	0.766	S	S	*	*			trans	-122.9	66.8	168.4	-67.3	-175	-171.7	0	0	106.6	L15 E19	L15-E17 PolarHBondContact O-N 3.49Å; E17-E19 PolarHBondContact O-N 3.16Å
18	V	43	Very low	39.4	Very low	133 Å²	133	147.3 Å²	147.3	81%	0.806	77%	0.768	S	S	*	*			trans	-66.4	66.5	151	-175.8	0	0	0	0	106.5	Q20	V18-Q20 VanDerWaalsContact C-N 3.28Å; V18-Q20 HydrophobicContact CG1-CG 4.1Å; V18-Q20 PolarHBondContact O-N 3.42Å
19	E	37.1	Very low	38.6	Very low	155 Å²	155	147.3 Å²	147.3	72%	0.724	78%	0.776	S	S	*	*			trans	-91	78.8	154.1	-86.5	-165.2	158.9	0	0	105.7	E17 N21	E17-E19 PolarHBondContact O-N 3.16Å; E19-N21 PolarHBondContact O-N 2.81Å
20	Q	38.2	Very low	38.4	Very low	160 Å²	160	146.3 Å²	146.3	75%	0.748	78%	0.776	S	S	*	*			trans	-70	81.1	154.6	-62.2	-140.5	-81.2	0	0	106.1	V18 N22	V18-Q20 VanDerWaalsContact C-N 3.28Å; V18-Q20 HydrophobicContact CG1-CG 4.1Å; V18-Q20 PolarHBondContact O-N 3.42Å; Q20-N22 PolarHBondContact O-N 2.86Å
21	N	37.5	Very low	38.2	Very low	123 Å²	123	141 Å²	141	66%	0.658	78%	0.775	S	S	*	*			trans	-69.4	87.9	165.5	56.5	-2.4	0	0	0	106.9	E19 N23	E19-N21 PolarHBondContact O-N 2.81Å; N21-N23 PolarHBondContact O-N 3.09Å
22	N	38.1	Very low	37.7	Very low	139 Å²	139	132.9 Å²	132.9	74%	0.743	77%	0.765	S	S	*	*			trans	-65.6	48.9	163.2	-71.7	0.5	0	0	0	110.4	Q20 E24	Q20-N22 PolarHBondContact O-N 2.86Å; N22-E24 PolarHBondContact O-N 3.15Å
23	N	37.7	Very low	37.5	Very low	142 Å²	142	137.1 Å²	137.1	76%	0.759	78%	0.779	S	S	*	*			trans	-78.2	78.7	161.2	-104.3	16.4	0	0	0	106.8	N21 D25	N21-N23 PolarHBondContact O-N 3.09Å; N23-D25 PolarHBondContact O-N 3.36Å
24	E	40.5	Very low	36.9	Very low	193 Å²	193	134.4 Å²	134.4	90%	0.902	77%	0.773	S	S	*	*			trans	-62.4	65.8	162.4	-162.8	169.9	-130.5	0	0	108.8	N22	N22-E24 PolarHBondContact O-N 3.15Å
25	D	40.7	Very low	36.3	Very low	143 Å²	143	134.6 Å²	134.6	77%	0.765	78%	0.775	S	S	*	*			trans	-161.4	60.9	171.5	-161.3	21	0	0	0	113.1	N23	N23-D25 PolarHBondContact O-N 3.36Å
26	I	37.9	Very low	36.2	Very low	150 Å²	150	135.8 Å²	135.8	77%	0.769	78%	0.78	S	S	*	*			trans	-137.3	96.1	157.4	-43	176.5	0	0	0	109	Q28	I26-Q28 PolarHBondContact O-N 2.89Å; I26-Q28 VanDerWaalsContact O-N 3.15Å
27	G	30.2	Very low	36	Very low	74 Å²	74	135 Å²	135	76%	0.763	78%	0.775	S	S	*	*			trans	-48.7	114.7	166.6	0	0	0	0	0	112.2
28	Q	29.4	Very low	35.6	Very low	169 Å²	169	132.6 Å²	132.6	79%	0.79	77%	0.771	S	S	*	*			trans	-133.8	89.6	154.2	-65.6	-172	-6.1	0	0	104.4	I26 L30	I26-Q28 PolarHBondContact O-N 2.89Å; I26-Q28 VanDerWaalsContact O-N 3.15Å; Q28-L30 PolarHBondContact O-N 3.08Å
29	G	27	Very low	35.1	Very low	76 Å²	76	132.6 Å²	132.6	78%	0.784	77%	0.772	S	S	*	*				66.9	15.8	57.2	0	0	0	0	0	112.1	S31	G29-S31 PolarHBondContact O-N 3.39Å
30	L	36.5	Very low	34.8	Very low	167 Å²	167	134.8 Å²	134.8	87%	0.874	78%	0.779	S	S	*	*			trans	-86.6	67	155.5	-65.5	-177.3	0	0	0	108.9	Q28	Q28-L30 PolarHBondContact O-N 3.08Å
31	S	33.5	Very low	34.9	Very low	122 Å²	122	136.4 Å²	136.4	85%	0.853	79%	0.786	S	S	*	*			trans	-59.7	126.3	156.7	-173.9	0	0	0	0	108.4	G29	G29-S31 PolarHBondContact O-N 3.39Å
32	G	30.4	Very low	34.9	Very low	69 Å²	69	139.5 Å²	139.5	71%	0.711	80%	0.797	S	S	*	*			trans	109.1	51.7	156.6	0	0	0	0	0	117.9
33	I	39.7	Very low	35	Very low	182 Å²	182	140.9 Å²	140.9	93%	0.933	80%	0.804	S	S	*	*	S	Bend	trans	-122.5	81.4	141.4	-45.3	163.7	0	0	0	103.8
34	G	28.6	Very low	34.7	Very low	63 Å²	63	137.3 Å²	137.3	65%	0.649	80%	0.801	S	S	*	*				106.9	78.8	90	0	0	0	0	0	106.2	I36	G34-I36 PolarHBondContact O-N 3.02Å
35	L	34.8	Very low	34.5	Very low	160 Å²	160	135 Å²	135	84%	0.838	80%	0.795	S	S	*	*			trans	-12	110.5	173.2	-62.5	158.2	0	0	0	114.4	P37	L35-P37 HydrophobicContact CB-CG 4.32Å; L35-P37 WeakPolarHBondContact O-CD 3.23Å
36	I	36.4	Very low	34.5	Very low	150 Å²	150	134 Å²	134	77%	0.769	79%	0.789	S	S	*	*			trans	-92.4	98.3	141.1	-61	171.2	0	0	0	104.4	G34 T38	G34-I36 PolarHBondContact O-N 3.02Å; I36-T38 HydrophobicContact CG2-CG2 4.03Å; I36-T38 PolarHBondContact O-N 2.82Å
37	P	34.2	Very low	34.8	Very low	109 Å²	109	132.7 Å²	132.7	71%	0.708	79%	0.788	S	S	*	*			trans	-82	104.8	171.8	18.1	-2	0	0	0	107.3	L35	L35-P37 HydrophobicContact CB-CG 4.32Å; L35-P37 WeakPolarHBondContact O-CD 3.23Å
38	T	37	Very low	35.4	Very low	106 Å²	106	135.4 Å²	135.4	65%	0.65	79%	0.785	S	S	*	*			trans	-127	109	163.8	51.5	0	0	0	0	108.5	I36	I36-T38 HydrophobicContact CG2-CG2 4.03Å; I36-T38 PolarHBondContact O-N 2.82Å
39	T	32.5	Very low	36.1	Very low	133 Å²	133	134.9 Å²	134.9	82%	0.816	79%	0.788	S	S	*	*			trans	51.5	109.4	145.8	52.1	0	0	0	0	117.5	E41	T39-E41 PolarHBondContact O-N 2.97Å
40	K	29.7	Very low	36.9	Very low	201 Å²	201	139.3 Å²	139.3	87%	0.874	79%	0.788	S	S	*	*			trans	-33.5	134.9	141.8	-61.7	175.1	173.9	-178.4	0	109.6
41	E	40.3	Very low	37.6	Very low	193 Å²	193	141 Å²	141	90%	0.902	79%	0.788	S	S	*	*				-147.7	138.6	117.7	-68.1	-147.6	161.2	0	0	107.5	T39	T39-E41 PolarHBondContact O-N 2.97Å
42	E	38.8	Very low	38	Very low	189 Å²	189	138.1 Å²	138.1	88%	0.883	78%	0.779	S	S	*	*			trans	-61.9	148.2	175.9	-69.5	167.7	152.2	0	0	109.2	G44	E42-G44 PolarHBondContact O-N 2.85Å; E42-G44 VanDerWaalsContact O-N 3.08Å
43	D	38.9	Very low	39	Very low	168 Å²	168	144.1 Å²	144.1	90%	0.898	79%	0.788	S	S	*	*	S	Bend	trans	-42.5	118.7	171.2	-145.4	-2.3	0	0	0	109.1	N45	D43-N45 PolarHBondContact O-N 2.97Å; D43-N45 VanDerWaalsContact O-N 3.09Å
44	G	32.8	Very low	39.5	Very low	67 Å²	67	144.2 Å²	144.2	69%	0.691	78%	0.782	S	S	*	*			trans	-49.9	118.2	-172.1	0	0	0	0	0	110.5	E42	E42-G44 PolarHBondContact O-N 2.85Å; E42-G44 VanDerWaalsContact O-N 3.08Å
45	N	35.6	Very low	40.5	Very low	143 Å²	143	148.7 Å²	148.7	77%	0.765	79%	0.791	S	S	*	*	S	Bend	trans	-64	134.5	160.7	-177	73.1	0	0	0	108.8	D43	D43-N45 PolarHBondContact O-N 2.97Å; D43-N45 VanDerWaalsContact O-N 3.09Å
46	D	39.7	Very low	41.3	Very low	123 Å²	123	144.9 Å²	144.9	66%	0.658	77%	0.774	S	S	*	*	S	Bend	trans	64.6	91.1	172.1	-83.7	-35.9	0	0	0	117.1	D48	D46-D48 PolarHBondContact O-N 2.7Å
47	V	45.7	Very low	41.9	Very low	122 Å²	122	142.6 Å²	142.6	74%	0.739	77%	0.772	S	S	*	*				7.9	103.4	120.7	-162.6	0	0	0	0	113	D49	V47-D49 PolarHBondContact O-N 3.06Å
48	D	41.8	Very low	42.5	Very low	131 Å²	131	143.5 Å²	143.5	70%	0.701	77%	0.766	S	S	*	*			trans	-55.5	106.9	167.6	-84.1	-37.7	0	0	0	109.9	D46 E50	D46-D48 PolarHBondContact O-N 2.7Å; D48-E50 PolarHBondContact O-N 2.87Å
49	D	44.8	Very low	43.2	Very low	159 Å²	159	144.3 Å²	144.3	85%	0.85	77%	0.771	S	S	*	*	S	Bend	trans	-75.7	-2.8	163.3	-87.1	-17.1	0	0	0	111.7	V47	V47-D49 PolarHBondContact O-N 3.06Å
50	E	44.4	Very low	44	Very low	169 Å²	169	147.6 Å²	147.6	79%	0.79	77%	0.768	S	S	*	*	S	Bend	trans	-110.4	87.6	168.9	-79.4	-174	160.8	0	0	111	D48 G52	D48-E50 PolarHBondContact O-N 2.87Å; E50-G52 PolarHBondContact O-N 2.85Å
51	K	50.4	Low	44.8	Very low	201 Å²	201	141.3 Å²	141.3	87%	0.874	76%	0.761	S	S	*	*			trans	-67	72.5	171.1	-65.1	-179	179.9	179.4	0	110.9
52	G	41.5	Very low	45.4	Very low	63 Å²	63	137.2 Å²	137.2	65%	0.649	75%	0.754	S	S	*	*			trans	-63.5	138.3	170.6	0	0	0	0	0	110.8	E50 F54	E50-G52 PolarHBondContact O-N 2.85Å; G52-F54 PolarHBondContact O-N 3.14Å
53	E	52.6	Low	45.8	Very low	194 Å²	194	134.7 Å²	134.7	91%	0.907	75%	0.746	S	S	*	*			trans	-39.7	119.3	175.5	-85.7	169.5	133.4	0	0	112.9	N55	E53-N55 PolarHBondContact O-N 3.09Å
54	F	49.2	Very low	46.7	Very low	184 Å²	184	133.9 Å²	133.9	81%	0.807	74%	0.742	S	S	*	*			trans	-64.4	92.3	172.9	-179.2	-126.1	0	0	0	109.6	G52 V56	G52-F54 PolarHBondContact O-N 3.14Å; F54-V56 HydrophobicContact CD1-CG2 3.12Å; F54-V56 HydrophobicContact CD2-CG2 4.37Å; F54-V56 HydrophobicContact CE1-CB 4.26Å; F54-V56 HydrophobicContact CE1-CG1 4.38Å; F54-V56 HydrophobicContact CE1-CG2 2.98Å; F54-V56 HydrophobicContact CE2-CG2 4.24Å; F54-V56 HydrophobicContact CG-CG2 3.85Å; F54-V56 HydrophobicContact CZ-CG1 4.36Å; F54-V56 HydrophobicContact CZ-CG2 3.58Å; F54-V56 PolarHBondContact O-N 2.72Å; F54-V56 VanDerWaalsContact O-N 3.12Å
55	N	49	Very low	47.5	Very low	158 Å²	158	137.8 Å²	137.8	85%	0.845	75%	0.745	S	S	*	*			trans	-84.1	85.9	178.4	-144.2	1.2	0	0	0	108.9	E53 S57	E53-N55 PolarHBondContact O-N 3.09Å; N55-S57 VanDerWaalsContact C-N 3.28Å; N55-S57 PolarHBondContact O-N 2.86Å
56	V	52.6	Low	47.8	Very low	79 Å²	79	133.9 Å²	133.9	48%	0.479	74%	0.739	S	S	.	*			trans	-71.6	83.9	178.2	-156.7	0	0	0	0	109.1	F54 E58	F54-V56 HydrophobicContact CD1-CG2 3.12Å; F54-V56 HydrophobicContact CD2-CG2 4.37Å; F54-V56 HydrophobicContact CE1-CB 4.26Å; F54-V56 HydrophobicContact CE1-CG1 4.38Å; F54-V56 HydrophobicContact CE1-CG2 2.98Å; F54-V56 HydrophobicContact CE2-CG2 4.24Å; F54-V56 HydrophobicContact CG-CG2 3.85Å; F54-V56 HydrophobicContact CZ-CG1 4.36Å; F54-V56 HydrophobicContact CZ-CG2 3.58Å; F54-V56 PolarHBondContact O-N 2.72Å; F54-V56 VanDerWaalsContact O-N 3.12Å; V56-E58 HydrophobicContact CG1-CB 3.87Å; V56-E58 HydrophobicContact CG1-CG 4.35Å; V56-E58 PolarHBondContact O-N 3.43Å
57	S	48.5	Very low	48.2	Very low	103 Å²	103	131.4 Å²	131.4	72%	0.72	74%	0.743	S	S	*	*			trans	-79.3	77.5	155.4	-160.9	0	0	0	0	107	N55 V59	N55-S57 VanDerWaalsContact C-N 3.28Å; N55-S57 PolarHBondContact O-N 2.86Å; S57-V59 VanDerWaalsContact C-N 3.3Å; S57-V59 PolarHBondContact O-N 2.79Å
58	E	47.3	Very low	48.3	Very low	127 Å²	127	135 Å²	135	59%	0.593	75%	0.752	S	S	*	*			trans	-66.5	93.8	169.8	-147.8	175.8	-164.6	0	0	106.5	V56 W60	V56-E58 HydrophobicContact CG1-CB 3.87Å; V56-E58 HydrophobicContact CG1-CG 4.35Å; V56-E58 PolarHBondContact O-N 3.43Å; E58-W60 VanDerWaalsContact CD-CE2 3.5Å; E58-W60 VanDerWaalsContact CG-NE1 3.28Å; E58-W60 PolarHBondContact O-N 2.9Å; E58-W60 PolarHBondContact OE2-NE1 2.88Å
59	V	50.6	Low	49	Very low	124 Å²	124	136.4 Å²	136.4	75%	0.752	75%	0.752	S	S	*	*			trans	-82.5	93.6	169.1	-177.6	0	0	0	0	106.1	S57 G61	S57-V59 VanDerWaalsContact C-N 3.3Å; S57-V59 PolarHBondContact O-N 2.79Å; V59-G61 PolarHBondContact O-N 3.2Å
60	W	50.7	Low	49.4	Very low	201 Å²	201	135.8 Å²	135.8	76%	0.761	75%	0.748	S	S	*	*			trans	-65.7	84.3	171.1	-68.1	68.6	0	0	0	109	E58 S62	E58-W60 VanDerWaalsContact CD-CE2 3.5Å; E58-W60 VanDerWaalsContact CG-NE1 3.28Å; E58-W60 PolarHBondContact O-N 2.9Å; E58-W60 PolarHBondContact OE2-NE1 2.88Å; W60-S62 VanDerWaalsContact C-N 3.34Å; W60-S62 PolarHBondContact O-N 2.95Å; W60-S62 VanDerWaalsContact O-N 3.09Å
61	G	45.7	Very low	49.6	Very low	70 Å²	70	135 Å²	135	72%	0.722	74%	0.744	S	S	*	*			trans	-75.3	87.6	167.2	0	0	0	0	0	109.8	V59 N63	V59-G61 PolarHBondContact O-N 3.2Å; G61-N63 PolarHBondContact O-N 3.47Å
62	S	53.7	Low	49.6	Very low	107 Å²	107	132.7 Å²	132.7	75%	0.748	74%	0.741	S	S	*	*			trans	5.6	102.4	163.8	-53	0	0	0	0	116.9	W60 D64	W60-S62 VanDerWaalsContact C-N 3.34Å; W60-S62 PolarHBondContact O-N 2.95Å; W60-S62 VanDerWaalsContact O-N 3.09Å; S62-D64 PolarHBondContact O-N 3.05Å; S62-D64 VanDerWaalsContact O-N 3.14Å
63	N	46.4	Very low	50.4	Low	135 Å²	135	135.5 Å²	135.5	72%	0.722	74%	0.74	S	S	*	*			trans	-75.1	94.5	166.7	-153.2	17.9	0	0	0	108.3	G61 I65	G61-N63 PolarHBondContact O-N 3.47Å; N63-I65 HydrophobicContact CB-CD1 4.43Å; N63-I65 HydrophobicContact CB-CG1 4.15Å; N63-I65 WeakPolarHBondContact ND2-CD1 3.33Å; N63-I65 WeakPolarHBondContact ND2-CG1 3.45Å; N63-I65 PolarHBondContact O-N 2.92Å
64	D	57.4	Low	50.6	Low	152 Å²	152	133.5 Å²	133.5	81%	0.813	73%	0.734	S	S	*	*			trans	-73.7	72.7	173.6	-105	-16.1	0	0	0	109.9	S62 G66	S62-D64 PolarHBondContact O-N 3.05Å; S62-D64 VanDerWaalsContact O-N 3.14Å; D64-G66 PolarHBondContact O-N 2.72Å
65	I	50.1	Low	51	Low	148 Å²	148	128.8 Å²	128.8	76%	0.759	72%	0.716	S	S	*	*			trans	-77.5	35.1	169.1	-44.8	174	0	0	0	110	N63	N63-I65 HydrophobicContact CB-CD1 4.43Å; N63-I65 HydrophobicContact CB-CG1 4.15Å; N63-I65 WeakPolarHBondContact ND2-CD1 3.33Å; N63-I65 WeakPolarHBondContact ND2-CG1 3.45Å; N63-I65 PolarHBondContact O-N 2.92Å
66	G	42.9	Very low	50.9	Low	62 Å²	62	128.1 Å²	128.1	64%	0.639	71%	0.713	S	S	*	*			trans	-151.1	84.2	-166.4	0	0	0	0	0	113	D64	D64-G66 PolarHBondContact O-N 2.72Å
67	G	46.7	Very low	51.1	Low	71 Å²	71	128.4 Å²	128.4	73%	0.732	71%	0.711	S	S	*	*			trans	-173.2	-3.7	172.9	0	0	0	0	0	119.2	K69	G67-K69 VanDerWaalsContact C-N 3.27Å; G67-K69 PolarHBondContact O-N 3.35Å
68	E	48	Very low	51.1	Low	197 Å²	197	130.4 Å²	130.4	92%	0.921	71%	0.714	S	S	*	*			trans	-77	85.4	175.3	-64.4	-164.1	-171.6	0	0	109.9	N70	E68-N70 PolarHBondContact O-N 3.32Å
69	K	57.1	Low	51.2	Low	161 Å²	161	130.2 Å²	130.2	70%	0.7	72%	0.715	S	S	*	*			trans	-71.7	117.4	170.2	-173.4	178	179.6	-177.4	0	107.3	G67 H71	G67-K69 VanDerWaalsContact C-N 3.27Å; G67-K69 PolarHBondContact O-N 3.35Å; K69-H71 PolarHBondContact O-CD2 3.27Å; K69-H71 PolarHBondContact O-N 3.21Å; K69-H71 VanDerWaalsContact O-N 3.08Å; K69-H71 PolarHBondContact O-NE2 3.15Å
70	N	52.5	Low	51.2	Low	146 Å²	146	129.7 Å²	129.7	78%	0.781	71%	0.708	S	S	*	*			trans	-59.8	116.3	171.8	-69.9	-33.5	0	0	0	109.6	E68	E68-N70 PolarHBondContact O-N 3.32Å
71	H	48.9	Very low	51.5	Low	152 Å²	152	130.7 Å²	130.7	70%	0.704	72%	0.718	S	S	*	*			trans	-92.9	97	176.9	-66.7	-90.2	0	0	0	109.8	K69	K69-H71 PolarHBondContact O-CD2 3.27Å; K69-H71 PolarHBondContact O-N 3.21Å; K69-H71 VanDerWaalsContact O-N 3.08Å; K69-H71 PolarHBondContact O-NE2 3.15Å
72	N	51.2	Low	51.9	Low	152 Å²	152	133.4 Å²	133.4	81%	0.813	72%	0.715	S	S	*	*			trans	-91.9	108.3	168.4	-75.5	-0.4	0	0	0	109
73	I	57.5	Low	51.7	Low	123 Å²	123	130.6 Å²	130.6	63%	0.631	70%	0.704	S	S	*	*			trans	-100.3	114.7	174.9	-54.1	176.1	0	0	0	107.6	I75	I73-I75 HydrophobicContact CG2-CD1 4.37Å; I73-I75 HydrophobicContact CG2-CG1 3.87Å
74	I	56.6	Low	51.8	Low	152 Å²	152	127.5 Å²	127.5	78%	0.779	69%	0.693	S	S	*	*			trans	-98.9	120.1	173.5	-58.5	175.4	0	0	0	107.5
75	I	58.1	Low	51.3	Low	84 Å²	84	125.5 Å²	125.5	43%	0.431	68%	0.677	S	S	.	*			trans	-112.4	116.9	-177.4	-52.3	159	0	0	0	108.1	I73 I77 I98	I73-I75 HydrophobicContact CG2-CD1 4.37Å; I73-I75 HydrophobicContact CG2-CG1 3.87Å; I75-I77 HydrophobicContact CG2-CG1 3.88Å; I75-I98 HydrophobicContact CD1-CD1 3.16Å; I75-I98 HydrophobicContact CG1-CD1 4.25Å
76	N	46.3	Very low	51.1	Low	145 Å²	145	123.9 Å²	123.9	78%	0.775	67%	0.666	S	S	*	*			trans	-90	106.4	172.9	-67.9	-32.4	0	0	0	108.6
77	I	56.2	Low	51.3	Low	84 Å²	84	126.8 Å²	126.8	43%	0.431	66%	0.663	S	S	.	*			trans	-94.4	116.4	177.2	-56	174.7	0	0	0	108.2	I75 I79	I75-I77 HydrophobicContact CG2-CG1 3.88Å; I77-I79 HydrophobicContact CG2-CG1 4.35Å
78	N	49.2	Very low	51.3	Low	146 Å²	146	126.7 Å²	126.7	78%	0.781	65%	0.645	S	S	*	*			trans	-81.7	116.9	170.1	-74	-31.4	0	0	0	108.7
79	I	50.5	Low	51.3	Low	122 Å²	122	122.2 Å²	122.2	63%	0.626	63%	0.626	S	S	*	*			trans	-94.7	112.9	-176.9	-56.5	171.5	0	0	0	108.7	I77	I77-I79 HydrophobicContact CG2-CG1 4.35Å
80	D	49.5	Very low	50.7	Low	114 Å²	114	117.3 Å²	117.3	61%	0.61	61%	0.608	S	S	*	*			trans	-72.5	159	165.8	-73.7	-31.3	0	0	0	110.9	L82 G83	D80-L82 PolarHBondContact O-N 3.12Å; D80-G83 PolarHBondContact O-N 2.88Å
81	K	56.6	Low	50.5	Low	221 Å²	221	115 Å²	115	96%	0.961	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.1	-18.6	-173.2	-72.6	-178.9	-179.5	174.3	0	115
82	L	55.8	Low	50.5	Low	127 Å²	127	113.4 Å²	113.4	67%	0.665	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85	-7.5	180	-64.2	172.4	0	0	0	113.4	D80 S84	D80-L82 PolarHBondContact O-N 3.12Å; L82-S84 PolarHBondContact O-N 2.85Å; L82-S84 PolarHBondContact O-OG 2.99Å
83	G	48.1	Very low	50.6	Low	49 Å²	49	113.5 Å²	113.5	51%	0.505	59%	0.592	S	S	.	*			trans	60.8	16.2	164.3	0	0	0	0	0	116.4	D80	D80-G83 PolarHBondContact O-N 2.88Å
84	S	48.3	Very low	50.4	Low	70 Å²	70	115 Å²	115	49%	0.49	60%	0.602	S	S	.	*			trans	-107.8	118.4	-174.9	-51	0	0	0	0	109.7	L82	L82-S84 PolarHBondContact O-N 2.85Å; L82-S84 PolarHBondContact O-OG 2.99Å
85	F	47.6	Very low	49.8	Very low	110 Å²	110	114.1 Å²	114.1	48%	0.482	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-132.3	139.4	166.8	53.4	-89.4	0	0	0	108.1
86	E	45.8	Very low	49.4	Very low	114 Å²	114	117.1 Å²	117.1	53%	0.533	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.4	115.4	169.1	-167	171.4	-158.8	0	0	106.9	I88	E86-I88 HydrophobicContact CG-CG1 4.32Å
87	E	46.2	Very low	49.3	Very low	122 Å²	122	112.8 Å²	112.8	57%	0.57	59%	0.589	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.7	106.7	173.4	-177.7	179.2	-171	0	0	107.9	I89	E87-I89 HydrophobicContact CG-CG1 4.07Å
88	I	47.2	Very low	49	Very low	69 Å²	69	112.2 Å²	112.2	35%	0.354	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.1	109.6	169.6	-54.3	173.9	0	0	0	106.7	E86 D90 I99	E86-I88 HydrophobicContact CG-CG1 4.32Å; I88-D90 PolarHBondContact O-N 2.9Å; I88-I99 HydrophobicContact CB-CB 4.26Å; I88-I99 PolarHBondContact N-O 2.97Å; I88-I99 PolarHBondContact O-N 3.44Å
89	I	47.5	Very low	49	Very low	103 Å²	103	109 Å²	109	53%	0.528	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.2	103.9	172	-55.3	175.2	0	0	0	106.7	E87	E87-I89 HydrophobicContact CG-CG1 4.07Å
90	D	45.2	Very low	48.9	Very low	58 Å²	58	106.2 Å²	106.2	31%	0.31	56%	0.557	S	S	.	*			trans	-83.8	116.4	167.5	-159.8	-14.8	0	0	0	108.7	I88 D92 S97	I88-D90 PolarHBondContact O-N 2.9Å; D90-D92 PolarHBondContact OD1-N 3.2Å; D90-D92 VanDerWaalsContact OD1-N 3.15Å; D90-S97 PolarHBondContact N-O 3.09Å
91	N	48.3	Very low	48.8	Very low	97 Å²	97	102.7 Å²	102.7	52%	0.519	54%	0.541	S	S	.	.			trans	-99.7	15.8	-179.8	-75.6	-51.1	0	0	0	111.7	D93	N91-D93 PolarHBondContact O-N 2.77Å
92	D	48.5	Very low	48.1	Very low	120 Å²	120	99.5 Å²	99.5	64%	0.642	53%	0.528	S	S	*	.			trans	-53.4	116.9	168.7	-97.4	-7.7	0	0	0	108.6	D90 D94 D95	D90-D92 PolarHBondContact OD1-N 3.2Å; D90-D92 VanDerWaalsContact OD1-N 3.15Å; D92-D94 PolarHBondContact O-N 3.5Å; D92-D95 PolarHBondContact O-N 3.08Å; D92-D95 VanDerWaalsContact O-N 3.09Å
93	D	53.6	Low	47.9	Very low	153 Å²	153	98.5 Å²	98.5	82%	0.818	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-12.6	-151.7	-86.1	-44.8	0	0	0	114.7	N91	N91-D93 PolarHBondContact O-N 2.77Å
94	D	54.4	Low	48	Very low	156 Å²	156	107.7 Å²	107.7	83%	0.834	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.5	-20.6	-176.4	-64.9	-31.5	0	0	0	113.8	D92	D92-D94 PolarHBondContact O-N 3.5Å
95	D	43.2	Very low	47.9	Very low	133 Å²	133	109.6 Å²	109.6	71%	0.711	56%	0.555	S	S	*	*			trans	-144.1	84.5	-176.5	-80.4	-40	0	0	0	110.5	D92 S97	D92-D95 PolarHBondContact O-N 3.08Å; D92-D95 VanDerWaalsContact O-N 3.09Å; D95-S97 PolarHBondContact O-N 3.26Å
96	K	49.5	Very low	48	Very low	147 Å²	147	109.6 Å²	109.6	64%	0.639	56%	0.559	S	S	*	*			trans	-65.1	86.7	170.9	-66.7	-168.7	-178.5	-170.9	0	110.1
97	S	43.7	Very low	48.1	Very low	53 Å²	53	109.3 Å²	109.3	37%	0.371	56%	0.56	S	S	.	*			trans	-87.6	135.2	172.5	66.1	0	0	0	0	109.3	D90 D95	D90-S97 PolarHBondContact N-O 3.09Å; D95-S97 PolarHBondContact O-N 3.26Å
98	I	50.8	Low	48.2	Very low	72 Å²	72	108.6 Å²	108.6	37%	0.369	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.4	108.6	173.2	-63.3	173	0	0	0	105.9	I75 V100	I75-I98 HydrophobicContact CD1-CD1 3.16Å; I75-I98 HydrophobicContact CG1-CD1 4.25Å; I98-V100 HydrophobicContact CG2-CG2 4.09Å
99	I	49	Very low	48.3	Very low	79 Å²	79	111.1 Å²	111.1	41%	0.405	57%	0.573	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-86.7	116	175	-56.3	172.1	0	0	0	106.8	I88	I88-I99 HydrophobicContact CB-CB 4.26Å; I88-I99 PolarHBondContact N-O 2.97Å; I88-I99 PolarHBondContact O-N 3.44Å
100	V	48	Very low	48.3	Very low	64 Å²	64	111.6 Å²	111.6	39%	0.388	58%	0.576	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.5	107.4	174.3	-177.3	0	0	0	0	108	I98 F102	I98-V100 HydrophobicContact CG2-CG2 4.09Å; V100-F102 HydrophobicContact CG1-CZ 4.49Å
101	S	47	Very low	48.5	Very low	39 Å²	39	115.4 Å²	115.4	27%	0.273	60%	0.595	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.7	136.2	175.8	-62.9	0	0	0	0	111
102	F	42.8	Very low	48.6	Very low	154 Å²	154	116.8 Å²	116.8	68%	0.675	60%	0.6	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.4	132.2	171.3	-61.1	-89.8	0	0	0	109.4	V100	V100-F102 HydrophobicContact CG1-CZ 4.49Å
103	I	51.2	Low	48.6	Very low	106 Å²	106	116.6 Å²	116.6	54%	0.544	60%	0.597	S	S	.	*	P	Polyproline II helix	trans	-101	120.8	172.8	-56.6	172.7	0	0	0	107
104	E	49.6	Very low	48.1	Very low	243 Å²	243	113.3 Å²	113.3	100%	1.136	58%	0.577	S	S	*	*			trans	-78.7	0	175.2	-165.7	176.1	-168.1	0	0	112.1

Retrieved 104 of 104 residues in 131.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).