A0A3Q0KQR1_SCHMA Loading...

IS5/IS1182 family transposase AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KQR1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 42 aa.

						>A0A3Q0KQR1_SCHMA|A0A3Q0KQR1
AAYSTSAWDKKTRWQRFRIWLQLVLEFLCCLLDIEYRNNRIN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	46.1	Very low	62.3	Low	141 Å²	141	120.9 Å²	120.9	100%	1.165	68%	0.679	S	S	*	*				0	116.9	0	0	0	0	0	0	108.2	Y3	A1-Y3 PolarHBondContact O-N 3.15Å
2	A	60.1	Low	63.7	Low	104 Å²	104	115 Å²	115	86%	0.86	65%	0.648	S	S	*	*			trans	-61.8	121.9	173.4	0	0	0	0	0	108.3	S4	A2-S4 PolarHBondContact O-N 3.1Å; A2-S4 VanDerWaalsContact O-N 3.08Å
3	Y	59.5	Low	65.2	Low	213 Å²	213	119.8 Å²	119.8	84%	0.835	65%	0.65	S	S	*	*			trans	-58.4	119.2	177.5	-75.5	-91.1	0	0	0	108.5	A1 T5	A1-Y3 PolarHBondContact O-N 3.15Å; Y3-T5 PolarHBondContact O-N 3.24Å
4	S	59.8	Low	66.6	Low	87 Å²	87	124 Å²	124	61%	0.608	65%	0.652	S	S	*	*			trans	-62.3	79.5	170.9	156.5	0	0	0	0	109.1	A2 S6	A2-S4 PolarHBondContact O-N 3.1Å; A2-S4 VanDerWaalsContact O-N 3.08Å; S4-S6 PolarHBondContact O-N 3.39Å
5	T	63.6	Low	68	Low	95 Å²	95	122.7 Å²	122.7	58%	0.583	64%	0.641	S	S	*	*			trans	-75	-13.1	176.5	49.8	0	0	0	0	112.4	Y3 A7 W8 D9	Y3-T5 PolarHBondContact O-N 3.24Å; T5-A7 PolarHBondContact O-N 3.27Å; T5-W8 PolarHBondContact O-N 3.46Å; T5-D9 VanDerWaalsContact O-CB 3.31Å; T5-D9 WeakPolarHBondContact O-CB 3.38Å; T5-D9 PolarHBondContact O-N 2.86Å
6	S	65.2	Low	69.3	Low	75 Å²	75	126.4 Å²	126.4	52%	0.524	64%	0.644	S	S	.	*	H	α-helix	trans	-64.9	-34.6	-171.1	67.5	0	0	0	0	114.3	S4 K10	S4-S6 PolarHBondContact O-N 3.39Å; S6-K10 WeakPolarHBondContact O-CB 3.43Å; S6-K10 VanDerWaalsContact O-CG 3.29Å; S6-K10 WeakPolarHBondContact O-CG 3.41Å; S6-K10 PolarHBondContact O-N 3.08Å
7	A	63	Low	70.6	Confident	62 Å²	62	124.9 Å²	124.9	51%	0.512	63%	0.632	S	S	.	*	H	α-helix	trans	-75.4	-40.6	177.9	0	0	0	0	0	112.4	T5 K11	T5-A7 PolarHBondContact O-N 3.27Å; A7-K11 PolarHBondContact O-N 3.34Å; A7-K11 VanDerWaalsContact O-N 3.15Å
8	W	60.8	Low	71.8	Confident	193 Å²	193	126.8 Å²	126.8	73%	0.731	63%	0.63	S	S	*	*	H	α-helix	trans	-65	-43.8	175.5	-79.2	92.5	0	0	0	111.3	T5 K10 K11 T12	T5-W8 PolarHBondContact O-N 3.46Å; W8-K10 PolarHBondContact O-N 3.5Å; W8-K11 PolarHBondContact O-N 2.82Å; W8-T12 PolarHBondContact O-N 3.43Å; W8-T12 PolarHBondContact O-OG1 2.93Å
9	D	64.1	Low	72.9	Confident	87 Å²	87	125.4 Å²	125.4	47%	0.465	62%	0.624	S	S	.	*	H	α-helix	trans	-62.2	-44.3	178.2	-159.6	-47.5	0	0	0	111.6	T5 K11 T12 R13	T5-D9 VanDerWaalsContact O-CB 3.31Å; T5-D9 WeakPolarHBondContact O-CB 3.38Å; T5-D9 PolarHBondContact O-N 2.86Å; D9-K11 PolarHBondContact O-N 3.48Å; D9-T12 PolarHBondContact O-N 3.25Å; D9-R13 WeakPolarHBondContact O-CB 3.26Å; D9-R13 PolarHBondContact O-N 2.91Å
10	K	68.7	Low	74	Confident	140 Å²	140	127 Å²	127	61%	0.609	62%	0.623	S	S	*	*	H	α-helix	trans	-58	-46.3	174.3	-78.4	178.1	-177.1	-177.1	0	111.9	S6 W8 T12 R13 W14	S6-K10 WeakPolarHBondContact O-CB 3.43Å; S6-K10 VanDerWaalsContact O-CG 3.29Å; S6-K10 WeakPolarHBondContact O-CG 3.41Å; S6-K10 PolarHBondContact O-N 3.08Å; W8-K10 PolarHBondContact O-N 3.5Å; K10-T12 VanDerWaalsContact C-N 3.34Å; K10-T12 PolarHBondContact O-N 2.9Å; K10-R13 PolarHBondContact O-N 3.36Å; K10-W14 PolarHBondContact O-N 3.5Å; K10-W14 VanDerWaalsContact O-N 3.1Å
11	K	74	Confident	75	Confident	133 Å²	133	124 Å²	124	58%	0.578	61%	0.609	S	S	*	*	H	α-helix	trans	-62.3	-43.3	179.5	-166.1	176.1	-176.6	-178.1	0	111.1	A7 W8 D9 W14 Q15	A7-K11 PolarHBondContact O-N 3.34Å; A7-K11 VanDerWaalsContact O-N 3.15Å; W8-K11 PolarHBondContact O-N 2.82Å; D9-K11 PolarHBondContact O-N 3.48Å; K11-W14 PolarHBondContact O-N 3.36Å; K11-Q15 WeakPolarHBondContact O-CG 3.49Å; K11-Q15 PolarHBondContact O-N 2.92Å
12	T	79.7	Confident	77.3	Confident	50 Å²	50	123.2 Å²	123.2	31%	0.307	58%	0.581	S	S	.	*	H	α-helix	trans	-65.6	-38.2	176.5	-58.1	0	0	0	0	112.1	W8 D9 K10 Q15 R16	W8-T12 PolarHBondContact O-N 3.43Å; W8-T12 PolarHBondContact O-OG1 2.93Å; D9-T12 PolarHBondContact O-N 3.25Å; K10-T12 VanDerWaalsContact C-N 3.34Å; K10-T12 PolarHBondContact O-N 2.9Å; T12-Q15 PolarHBondContact O-N 2.82Å; T12-R16 HydrophobicContact CG2-CG 4.27Å; T12-R16 WeakPolarHBondContact O-CB 3.19Å; T12-R16 VanDerWaalsContact O-CG 3.27Å; T12-R16 WeakPolarHBondContact O-CG 3.42Å; T12-R16 PolarHBondContact O-N 3.5Å
13	R	82.8	Confident	79.1	Confident	177 Å²	177	123.2 Å²	123.2	67%	0.668	57%	0.566	S	S	*	*	H	α-helix	trans	-62.5	-45.2	176.8	-170.7	177.2	-65.8	-178.1	-0.9	112	D9 K10 R16 F17	D9-R13 WeakPolarHBondContact O-CB 3.26Å; D9-R13 PolarHBondContact O-N 2.91Å; K10-R13 PolarHBondContact O-N 3.36Å; R13-R16 PolarHBondContact O-N 2.91Å; R13-F17 WeakPolarHBondContact O-CB 3.28Å; R13-F17 PolarHBondContact O-N 3.29Å
14	W	84.5	Confident	80.8	Confident	179 Å²	179	115.4 Å²	115.4	68%	0.678	54%	0.541	S	S	*	.	H	α-helix	trans	-64.7	-40.7	175.7	-74.6	113.8	0	0	0	112.3	K10 K11 F17 R18	K10-W14 PolarHBondContact O-N 3.5Å; K10-W14 VanDerWaalsContact O-N 3.1Å; K11-W14 PolarHBondContact O-N 3.36Å; W14-F17 PolarHBondContact O-N 3.31Å; W14-R18 VanDerWaalsContact O-CG 3.23Å; W14-R18 WeakPolarHBondContact O-CG 3.42Å; W14-R18 PolarHBondContact O-N 3.09Å
15	Q	88.2	Confident	82.6	Confident	105 Å²	105	115.8 Å²	115.8	49%	0.491	54%	0.535	S	S	.	.	H	α-helix	trans	-63.6	-43.9	174.5	-75.1	178.5	-38	0	0	112.2	K11 T12 F17 R18 I19	K11-Q15 WeakPolarHBondContact O-CG 3.49Å; K11-Q15 PolarHBondContact O-N 2.92Å; T12-Q15 PolarHBondContact O-N 2.82Å; Q15-F17 VanDerWaalsContact C-N 3.33Å; Q15-F17 PolarHBondContact O-N 3.02Å; Q15-R18 WeakPolarHBondContact O-CB 3.42Å; Q15-R18 PolarHBondContact O-N 3.34Å; Q15-I19 WeakPolarHBondContact O-CG1 3.45Å; Q15-I19 PolarHBondContact O-N 3.35Å
16	R	88.5	Confident	84.1	Confident	181 Å²	181	117.5 Å²	117.5	68%	0.683	54%	0.537	S	S	*	.	H	α-helix	trans	-60.9	-43.3	175.3	-75.5	177.6	-178.6	-173.1	2.9	111.5	T12 R13 R18 I19 W20	T12-R16 HydrophobicContact CG2-CG 4.27Å; T12-R16 WeakPolarHBondContact O-CB 3.19Å; T12-R16 VanDerWaalsContact O-CG 3.27Å; T12-R16 WeakPolarHBondContact O-CG 3.42Å; T12-R16 PolarHBondContact O-N 3.5Å; R13-R16 PolarHBondContact O-N 2.91Å; R16-R18 VanDerWaalsContact C-N 3.32Å; R16-R18 PolarHBondContact O-N 3.41Å; R16-I19 PolarHBondContact O-N 3.47Å; R16-W20 WeakPolarHBondContact O-CB 3.34Å; R16-W20 PolarHBondContact O-N 3.31Å
17	F	92.1	Very high	85.6	Confident	101 Å²	101	120.4 Å²	120.4	44%	0.443	54%	0.54	S	S	.	.	H	α-helix	trans	-61.7	-40.9	175.1	-176.8	-99.7	0	0	0	111.8	R13 W14 Q15 W20 L21	R13-F17 WeakPolarHBondContact O-CB 3.28Å; R13-F17 PolarHBondContact O-N 3.29Å; W14-F17 PolarHBondContact O-N 3.31Å; Q15-F17 VanDerWaalsContact C-N 3.33Å; Q15-F17 PolarHBondContact O-N 3.02Å; F17-W20 HydrophobicContact CD2-CE3 4.42Å; F17-W20 HydrophobicContact CE2-CE3 4.2Å; F17-W20 HydrophobicContact CE2-CZ3 4.31Å; F17-W20 PolarHBondContact O-N 3.3Å; F17-L21 HydrophobicContact CE1-CD2 4.43Å; F17-L21 VanDerWaalsContact O-CB 3.25Å; F17-L21 WeakPolarHBondContact O-CB 3.37Å; F17-L21 PolarHBondContact O-N 2.96Å
18	R	91.7	Very high	87.2	Confident	160 Å²	160	122 Å²	122	60%	0.604	54%	0.539	S	S	*	.	H	α-helix	trans	-62	-44.6	175.4	-71.8	-78.2	-69	-167.5	-1.6	112.2	W14 Q15 R16 L21 Q22	W14-R18 VanDerWaalsContact O-CG 3.23Å; W14-R18 WeakPolarHBondContact O-CG 3.42Å; W14-R18 PolarHBondContact O-N 3.09Å; Q15-R18 WeakPolarHBondContact O-CB 3.42Å; Q15-R18 PolarHBondContact O-N 3.34Å; R16-R18 VanDerWaalsContact C-N 3.32Å; R16-R18 PolarHBondContact O-N 3.41Å; R18-L21 PolarHBondContact O-N 2.86Å; R18-Q22 WeakPolarHBondContact O-CB 3.49Å; R18-Q22 WeakPolarHBondContact O-CG 3.33Å; R18-Q22 PolarHBondContact O-N 3.47Å
19	I	93.1	Very high	88.9	Confident	99 Å²	99	116.5 Å²	116.5	51%	0.508	53%	0.529	S	S	.	.	H	α-helix	trans	-64.1	-45.2	176.8	-65.6	164.2	0	0	0	110.3	Q15 R16 L21 Q22 L23	Q15-I19 WeakPolarHBondContact O-CG1 3.45Å; Q15-I19 PolarHBondContact O-N 3.35Å; R16-I19 PolarHBondContact O-N 3.47Å; I19-L21 VanDerWaalsContact C-N 3.31Å; I19-L21 PolarHBondContact O-N 3.25Å; I19-Q22 PolarHBondContact O-N 2.94Å; I19-L23 HydrophobicContact CG2-CD1 4.07Å; I19-L23 WeakPolarHBondContact O-CG 3.27Å; I19-L23 PolarHBondContact O-N 2.9Å
20	W	94.4	Very high	90.4	Very high	158 Å²	158	115.8 Å²	115.8	60%	0.598	53%	0.53	S	S	*	.	H	α-helix	trans	-59.4	-43.9	175.8	-175.5	80.3	0	0	0	111.5	R16 F17 L23 V24	R16-W20 WeakPolarHBondContact O-CB 3.34Å; R16-W20 PolarHBondContact O-N 3.31Å; F17-W20 HydrophobicContact CD2-CE3 4.42Å; F17-W20 HydrophobicContact CE2-CE3 4.2Å; F17-W20 HydrophobicContact CE2-CZ3 4.31Å; F17-W20 PolarHBondContact O-N 3.3Å; W20-L23 PolarHBondContact O-N 3.4Å; W20-V24 HydrophobicContact CD2-CG2 4.13Å; W20-V24 HydrophobicContact CE3-CG2 4.34Å; W20-V24 HydrophobicContact CH2-CG2 4.19Å; W20-V24 HydrophobicContact CZ2-CG2 3.95Å; W20-V24 HydrophobicContact CZ3-CG2 4.37Å; W20-V24 VanDerWaalsContact O-CG2 3.31Å; W20-V24 WeakPolarHBondContact O-CG2 3.25Å; W20-V24 PolarHBondContact O-N 3.34Å
21	L	95.4	Very high	91.6	Very high	64 Å²	64	113 Å²	113	34%	0.335	52%	0.522	S	S	.	.	H	α-helix	trans	-63.8	-41.5	176.4	-171.9	68.9	0	0	0	112	F17 R18 I19 V24 L25	F17-L21 HydrophobicContact CE1-CD2 4.43Å; F17-L21 VanDerWaalsContact O-CB 3.25Å; F17-L21 WeakPolarHBondContact O-CB 3.37Å; F17-L21 PolarHBondContact O-N 2.96Å; R18-L21 PolarHBondContact O-N 2.86Å; I19-L21 VanDerWaalsContact C-N 3.31Å; I19-L21 PolarHBondContact O-N 3.25Å; L21-V24 PolarHBondContact O-N 3.42Å; L21-L25 HydrophobicContact CD1-CD1 4.47Å; L21-L25 HydrophobicContact CG-CD1 4.03Å; L21-L25 WeakPolarHBondContact O-CB 3.45Å; L21-L25 PolarHBondContact O-N 2.91Å
22	Q	95.1	Very high	92.6	Very high	124 Å²	124	112.4 Å²	112.4	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-61.8	-44.5	175.3	-77.1	177	-92.4	0	0	111.5	R18 I19 L25 E26	R18-Q22 WeakPolarHBondContact O-CB 3.49Å; R18-Q22 WeakPolarHBondContact O-CG 3.33Å; R18-Q22 PolarHBondContact O-N 3.47Å; I19-Q22 PolarHBondContact O-N 2.94Å; Q22-L25 PolarHBondContact O-N 3.43Å; Q22-E26 WeakPolarHBondContact O-CB 3.31Å; Q22-E26 PolarHBondContact O-N 3.34Å
23	L	96.2	Very high	93.3	Very high	104 Å²	104	113.5 Å²	113.5	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-62.9	-43.4	176.9	-73.9	166.3	0	0	0	112	I19 W20 E26 F27	I19-L23 HydrophobicContact CG2-CD1 4.07Å; I19-L23 WeakPolarHBondContact O-CG 3.27Å; I19-L23 PolarHBondContact O-N 2.9Å; W20-L23 PolarHBondContact O-N 3.4Å; L23-E26 PolarHBondContact O-N 3.33Å; L23-F27 WeakPolarHBondContact O-CB 3.34Å; L23-F27 PolarHBondContact O-N 2.96Å
24	V	96.7	Very high	93.8	Very high	50 Å²	50	109.5 Å²	109.5	30%	0.303	52%	0.519	S	S	.	.	H	α-helix	trans	-64.1	-42.5	176.6	171.3	0	0	0	0	110.9	W20 L21 F27 L28	W20-V24 HydrophobicContact CD2-CG2 4.13Å; W20-V24 HydrophobicContact CE3-CG2 4.34Å; W20-V24 HydrophobicContact CH2-CG2 4.19Å; W20-V24 HydrophobicContact CZ2-CG2 3.95Å; W20-V24 HydrophobicContact CZ3-CG2 4.37Å; W20-V24 VanDerWaalsContact O-CG2 3.31Å; W20-V24 WeakPolarHBondContact O-CG2 3.25Å; W20-V24 PolarHBondContact O-N 3.34Å; L21-V24 PolarHBondContact O-N 3.42Å; V24-F27 PolarHBondContact O-N 2.9Å; V24-L28 HydrophobicContact CG1-CD1 4Å; V24-L28 HydrophobicContact CG1-CG 4.38Å; V24-L28 WeakPolarHBondContact O-CB 3.5Å; V24-L28 VanDerWaalsContact O-CG 3.27Å; V24-L28 WeakPolarHBondContact O-CG 3.46Å; V24-L28 PolarHBondContact O-N 3.34Å
25	L	96.7	Very high	94.2	Very high	94 Å²	94	107.3 Å²	107.3	49%	0.492	52%	0.517	S	S	.	.	H	α-helix	trans	-61.9	-46.2	175.7	-99.5	143.5	0	0	0	112.2	L21 Q22 F27 L28 C29	L21-L25 HydrophobicContact CD1-CD1 4.47Å; L21-L25 HydrophobicContact CG-CD1 4.03Å; L21-L25 WeakPolarHBondContact O-CB 3.45Å; L21-L25 PolarHBondContact O-N 2.91Å; Q22-L25 PolarHBondContact O-N 3.43Å; L25-F27 VanDerWaalsContact C-N 3.32Å; L25-F27 PolarHBondContact O-N 2.86Å; L25-L28 PolarHBondContact O-N 3.38Å; L25-C29 WeakPolarHBondContact O-CB 3.38Å; L25-C29 PolarHBondContact O-N 3.47Å; L25-C29 PolarHBondContact O-SG 3.38Å
26	E	96	Very high	94.4	Very high	132 Å²	132	109.8 Å²	109.8	62%	0.617	52%	0.523	S	S	*	.	H	α-helix	trans	-62.1	-42.5	177.5	-169.7	172.7	95.8	0	0	111.2	Q22 L23 C29 C30	Q22-E26 WeakPolarHBondContact O-CB 3.31Å; Q22-E26 PolarHBondContact O-N 3.34Å; L23-E26 PolarHBondContact O-N 3.33Å; E26-C29 PolarHBondContact O-N 3.43Å; E26-C30 PolarHBondContact O-N 2.88Å; E26-C30 PolarHBondContact O-SG 3.32Å; E26-C30 VanDerWaalsContact O-SG 3.34Å
27	F	95.9	Very high	94.6	Very high	135 Å²	135	108.5 Å²	108.5	59%	0.592	52%	0.518	S	S	*	.	H	α-helix	trans	-61.6	-45.6	175	-176.6	-105.3	0	0	0	112.4	L23 V24 L25 C30 L31	L23-F27 WeakPolarHBondContact O-CB 3.34Å; L23-F27 PolarHBondContact O-N 2.96Å; V24-F27 PolarHBondContact O-N 2.9Å; L25-F27 VanDerWaalsContact C-N 3.32Å; L25-F27 PolarHBondContact O-N 2.86Å; F27-C30 PolarHBondContact O-N 3.24Å; F27-L31 HydrophobicContact CD1-CD1 4.01Å; F27-L31 HydrophobicContact CE1-CD1 3.5Å; F27-L31 VanDerWaalsContact CE1-CD1 3.5Å; F27-L31 HydrophobicContact CE1-CG 4.19Å; F27-L31 HydrophobicContact CZ-CD1 3.95Å; F27-L31 HydrophobicContact CZ-CD2 4.43Å; F27-L31 HydrophobicContact CZ-CG 4.29Å; F27-L31 WeakPolarHBondContact O-CG 3.23Å; F27-L31 PolarHBondContact O-N 2.95Å
28	L	96.5	Very high	94.5	Very high	96 Å²	96	107.9 Å²	107.9	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-63.9	-41.1	176.3	-71.8	174	0	0	0	112	V24 L25 C30 L31 L32	V24-L28 HydrophobicContact CG1-CD1 4Å; V24-L28 HydrophobicContact CG1-CG 4.38Å; V24-L28 WeakPolarHBondContact O-CB 3.5Å; V24-L28 VanDerWaalsContact O-CG 3.27Å; V24-L28 WeakPolarHBondContact O-CG 3.46Å; V24-L28 PolarHBondContact O-N 3.34Å; L25-L28 PolarHBondContact O-N 3.38Å; L28-C30 VanDerWaalsContact C-N 3.33Å; L28-C30 PolarHBondContact O-N 2.92Å; L28-L31 PolarHBondContact O-N 3.47Å; L28-L32 WeakPolarHBondContact O-CB 3.44Å; L28-L32 PolarHBondContact O-N 2.93Å
29	C	95.8	Very high	94.4	Very high	77 Å²	77	106.1 Å²	106.1	52%	0.52	52%	0.522	S	S	.	.	H	α-helix	trans	-60.9	-41.7	174.7	-73.4	0	0	0	0	111.7	L25 E26 L32 D33	L25-C29 WeakPolarHBondContact O-CB 3.38Å; L25-C29 PolarHBondContact O-N 3.47Å; L25-C29 PolarHBondContact O-SG 3.38Å; E26-C29 PolarHBondContact O-N 3.43Å; C29-L32 PolarHBondContact O-N 2.82Å; C29-D33 PolarHBondContact O-N 2.83Å
30	C	95.7	Very high	94	Very high	72 Å²	72	110.8 Å²	110.8	49%	0.486	53%	0.533	S	S	.	.	H	α-helix	trans	-63	-43.8	175.5	-74	0	0	0	0	112.2	E26 F27 L28 L32 D33 I34	E26-C30 PolarHBondContact O-N 2.88Å; E26-C30 PolarHBondContact O-SG 3.32Å; E26-C30 VanDerWaalsContact O-SG 3.34Å; F27-C30 PolarHBondContact O-N 3.24Å; L28-C30 VanDerWaalsContact C-N 3.33Å; L28-C30 PolarHBondContact O-N 2.92Å; C30-L32 VanDerWaalsContact C-N 3.33Å; C30-L32 PolarHBondContact O-N 3.39Å; C30-D33 PolarHBondContact O-N 3.02Å; C30-I34 WeakPolarHBondContact O-CG1 3.41Å; C30-I34 PolarHBondContact O-N 2.93Å; C30-I34 VanDerWaalsContact O-N 3.09Å
31	L	95.1	Very high	93	Very high	81 Å²	81	109.8 Å²	109.8	42%	0.424	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-42.5	175.3	-70.6	179	0	0	0	111.6	F27 L28 D33 I34 E35	F27-L31 HydrophobicContact CD1-CD1 4.01Å; F27-L31 HydrophobicContact CE1-CD1 3.5Å; F27-L31 VanDerWaalsContact CE1-CD1 3.5Å; F27-L31 HydrophobicContact CE1-CG 4.19Å; F27-L31 HydrophobicContact CZ-CD1 3.95Å; F27-L31 HydrophobicContact CZ-CD2 4.43Å; F27-L31 HydrophobicContact CZ-CG 4.29Å; F27-L31 WeakPolarHBondContact O-CG 3.23Å; F27-L31 PolarHBondContact O-N 2.95Å; L28-L31 PolarHBondContact O-N 3.47Å; L31-D33 PolarHBondContact O-N 3.34Å; L31-I34 PolarHBondContact O-N 3.19Å; L31-E35 PolarHBondContact O-N 3.15Å
32	L	94.9	Very high	91.3	Very high	121 Å²	121	115.5 Å²	115.5	63%	0.634	57%	0.569	S	S	*	*	H	α-helix	trans	-65.4	-37.8	178.6	-149.3	102.5	0	0	0	111.9	L28 C29 C30 E35 Y36	L28-L32 WeakPolarHBondContact O-CB 3.44Å; L28-L32 PolarHBondContact O-N 2.93Å; C29-L32 PolarHBondContact O-N 2.82Å; C30-L32 VanDerWaalsContact C-N 3.33Å; C30-L32 PolarHBondContact O-N 3.39Å; L32-E35 PolarHBondContact O-N 3.41Å; L32-Y36 WeakPolarHBondContact O-CB 3.37Å; L32-Y36 PolarHBondContact O-N 3.18Å
33	D	94.1	Very high	91.1	Very high	74 Å²	74	115.1 Å²	115.1	40%	0.396	57%	0.568	S	S	.	*	H	α-helix	trans	-64.9	-40.8	175.2	-168.8	68.7	0	0	0	111.4	C29 C30 L31 Y36 R37	C29-D33 PolarHBondContact O-N 2.83Å; C30-D33 PolarHBondContact O-N 3.02Å; L31-D33 PolarHBondContact O-N 3.34Å; D33-Y36 PolarHBondContact O-N 3.49Å; D33-R37 WeakPolarHBondContact O-CB 3.49Å; D33-R37 VanDerWaalsContact O-CG 3.28Å; D33-R37 WeakPolarHBondContact O-CG 3.29Å; D33-R37 PolarHBondContact O-N 3.26Å; D33-R37 IonicContact OD1-NE 3.97Å; D33-R37 IonicContact OD2-CZ 3.55Å; D33-R37 IonicContact OD2-NE 2.82Å; D33-R37 PolarHBondContact OD2-NE 2.9Å; D33-R37 IonicContact OD2-NH2 3.41Å; D33-R37 PolarHBondContact OD2-NH2 3.45Å
34	I	93.1	Very high	90.8	Very high	93 Å²	93	115.7 Å²	115.7	48%	0.477	57%	0.569	S	S	.	*	H	α-helix	trans	-62.9	-47.9	175	-67	164.4	0	0	0	110.4	C30 L31 R37 N38	C30-I34 WeakPolarHBondContact O-CG1 3.41Å; C30-I34 PolarHBondContact O-N 2.93Å; C30-I34 VanDerWaalsContact O-N 3.09Å; L31-I34 PolarHBondContact O-N 3.19Å; I34-R37 PolarHBondContact O-N 3.1Å; I34-N38 WeakPolarHBondContact O-CB 3.5Å; I34-N38 PolarHBondContact O-N 3.17Å; I34-N38 PolarHBondContact O-ND2 2.85Å
35	E	93.8	Very high	90.5	Very high	133 Å²	133	119.3 Å²	119.3	62%	0.621	58%	0.584	S	S	*	*	H	α-helix	trans	-63.1	-43.6	178.8	-172.4	172.7	-176.2	0	0	111.5	L31 L32 R37 N38 N39	L31-E35 PolarHBondContact O-N 3.15Å; L32-E35 PolarHBondContact O-N 3.41Å; E35-R37 PolarHBondContact O-N 3.24Å; E35-N38 PolarHBondContact O-N 3.48Å; E35-N39 WeakPolarHBondContact O-CB 3.37Å; E35-N39 PolarHBondContact O-N 3.28Å
36	Y	92	Very high	90.2	Very high	157 Å²	157	120.8 Å²	120.8	62%	0.616	59%	0.59	S	S	*	*	H	α-helix	trans	-61.6	-42.6	176.6	-177.4	-101.3	0	0	0	112.2	L32 D33 R40	L32-Y36 WeakPolarHBondContact O-CB 3.37Å; L32-Y36 PolarHBondContact O-N 3.18Å; D33-Y36 PolarHBondContact O-N 3.49Å; Y36-R40 WeakPolarHBondContact O-CB 3.31Å; Y36-R40 PolarHBondContact O-N 3.45Å; Y36-R40 VanDerWaalsContact O-N 3.1Å
37	R	92.1	Very high	89.8	Confident	153 Å²	153	120.1 Å²	120.1	58%	0.577	59%	0.588	S	S	*	*	H	α-helix	trans	-64	-44.3	174	-74.6	176.2	-170.9	-112.1	0.7	111.7	D33 I34 E35 N39 R40 I41	D33-R37 WeakPolarHBondContact O-CB 3.49Å; D33-R37 VanDerWaalsContact O-CG 3.28Å; D33-R37 WeakPolarHBondContact O-CG 3.29Å; D33-R37 PolarHBondContact O-N 3.26Å; D33-R37 IonicContact OD1-NE 3.97Å; D33-R37 IonicContact OD2-CZ 3.55Å; D33-R37 IonicContact OD2-NE 2.82Å; D33-R37 PolarHBondContact OD2-NE 2.9Å; D33-R37 IonicContact OD2-NH2 3.41Å; D33-R37 PolarHBondContact OD2-NH2 3.45Å; I34-R37 PolarHBondContact O-N 3.1Å; E35-R37 PolarHBondContact O-N 3.24Å; R37-N39 PolarHBondContact O-N 3.32Å; R37-R40 PolarHBondContact O-N 3.32Å; R37-I41 WeakPolarHBondContact O-CD1 3.39Å; R37-I41 VanDerWaalsContact O-CG1 3.26Å; R37-I41 WeakPolarHBondContact O-CG1 3.27Å; R37-I41 PolarHBondContact O-N 3.08Å; R37-I41 VanDerWaalsContact O-N 3.08Å
38	N	91.1	Very high	89.4	Confident	89 Å²	89	119.1 Å²	119.1	48%	0.476	59%	0.588	S	S	.	*	H	α-helix	trans	-63.2	-42.6	179.2	-72.8	-19	0	0	0	111.6	I34 E35 R40 I41 N42	I34-N38 WeakPolarHBondContact O-CB 3.5Å; I34-N38 PolarHBondContact O-N 3.17Å; I34-N38 PolarHBondContact O-ND2 2.85Å; E35-N38 PolarHBondContact O-N 3.48Å; N38-R40 VanDerWaalsContact C-N 3.27Å; N38-R40 PolarHBondContact O-N 2.77Å; N38-I41 PolarHBondContact O-N 3.3Å; N38-N42 PolarHBondContact O-N 3Å; N38-N42 VanDerWaalsContact O-N 3.15Å
39	N	89.1	Confident	88.9	Confident	122 Å²	122	120.8 Å²	120.8	65%	0.652	59%	0.594	S	S	*	*	H	α-helix	trans	-72.1	-19.3	178.9	-162.8	50.8	0	0	0	113.5	E35 R37	E35-N39 WeakPolarHBondContact O-CB 3.37Å; E35-N39 PolarHBondContact O-N 3.28Å; R37-N39 PolarHBondContact O-N 3.32Å
40	R	84	Confident	88.3	Confident	198 Å²	198	124.2 Å²	124.2	75%	0.747	60%	0.599	S	S	*	*	H	α-helix	trans	-84.1	-26.5	172.2	-175.5	179.6	178.3	-158.8	0.3	112.9	Y36 R37 N38	Y36-R40 WeakPolarHBondContact O-CB 3.31Å; Y36-R40 PolarHBondContact O-N 3.45Å; Y36-R40 VanDerWaalsContact O-N 3.1Å; R37-R40 PolarHBondContact O-N 3.32Å; N38-R40 VanDerWaalsContact C-N 3.27Å; N38-R40 PolarHBondContact O-N 2.77Å
41	I	73.2	Confident	87.7	Confident	137 Å²	137	128.5 Å²	128.5	70%	0.703	61%	0.609	S	S	*	*	H	α-helix	trans	-79.7	-33.7	178.9	-68.1	165	0	0	0	110.9	R37 N38	R37-I41 WeakPolarHBondContact O-CD1 3.39Å; R37-I41 VanDerWaalsContact O-CG1 3.26Å; R37-I41 WeakPolarHBondContact O-CG1 3.27Å; R37-I41 PolarHBondContact O-N 3.08Å; R37-I41 VanDerWaalsContact O-N 3.08Å; N38-I41 PolarHBondContact O-N 3.3Å
42	N	60.2	Low	87.1	Confident	184 Å²	184	132.8 Å²	132.8	98%	0.984	63%	0.626	S	S	*	*			trans	-74.9	0	168.3	-69.7	-11.8	0	0	0	111.8	N38	N38-N42 PolarHBondContact O-N 3Å; N38-N42 VanDerWaalsContact O-N 3.15Å

Retrieved 42 of 42 residues in 35 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).