A0A3Q0KSM2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KSM2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 55 aa.

						>A0A3Q0KSM2_SCHMA|A0A3Q0KSM2
MDNYIPNRVVLITNKLQVEMNAGHYFEKIFFTIVLSVLLQSACPKRTLPCGALVA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.6	Very low	63.5	Low	225 Å²	225	125.6 Å²	125.6	100%	1.108	64%	0.638	S	S	*	*				0	51.4	0	-104.2	-110.3	-160.2	0	0	108.1
2	D	54.9	Low	64.8	Low	124 Å²	124	123.5 Å²	123.5	66%	0.663	63%	0.628	S	S	*	*			trans	-136.9	-2.1	-158.9	-55.9	-76.7	0	0	0	114.5	Y4	D2-Y4 VanDerWaalsContact C-N 3.31Å; D2-Y4 PolarHBondContact O-N 3.49Å
3	N	58.4	Low	66	Low	151 Å²	151	119.2 Å²	119.2	81%	0.807	61%	0.612	S	S	*	*	S	Bend	trans	-85.3	1.6	177.8	-84.3	-5.1	0	0	0	114.3
4	Y	56.4	Low	67.3	Low	145 Å²	145	116.8 Å²	116.8	57%	0.569	60%	0.6	S	S	*	*	H	α-helix	trans	-87.7	-28.1	-176.5	-167.6	-116.7	0	0	0	113.6	D2 R8	D2-Y4 VanDerWaalsContact C-N 3.31Å; D2-Y4 PolarHBondContact O-N 3.49Å; Y4-R8 HydrophobicContact CE1-CG 4.13Å; Y4-R8 VanDerWaalsContact CE1-CZ 3.42Å; Y4-R8 PolarHBondContact O-N 3.45Å; Y4-R8 PolarHBondContact OH-NE 3.42Å; Y4-R8 PolarHBondContact OH-NH2 3.4Å
5	I	57.6	Low	68.2	Low	117 Å²	117	117.8 Å²	117.8	60%	0.6	60%	0.599	S	S	*	*	H	α-helix	trans	-68	-45.5	-176.3	-56.8	172.5	0	0	0	112.5	N7 R8 V9	I5-N7 VanDerWaalsContact C-N 3.31Å; I5-N7 PolarHBondContact O-N 2.91Å; I5-R8 PolarHBondContact O-N 3.36Å; I5-V9 PolarHBondContact O-N 3.34Å
6	P	61.9	Low	69.1	Low	73 Å²	73	116.1 Å²	116.1	47%	0.474	59%	0.591	S	S	.	*	H	α-helix	trans	-65.2	-35.8	-178	23.5	-32.4	0	0	0	112.4	R8 V9 V10	P6-R8 PolarHBondContact O-N 3.18Å; P6-V9 PolarHBondContact O-N 3.14Å; P6-V10 WeakPolarHBondContact O-CG2 3.32Å; P6-V10 PolarHBondContact O-N 2.73Å; P6-V10 VanDerWaalsContact O-N 3.14Å
7	N	66.8	Low	69.9	Low	121 Å²	121	115.8 Å²	115.8	65%	0.647	59%	0.586	S	S	*	*	H	α-helix	trans	-68.9	-34.3	-176.2	-133.1	9.8	0	0	0	112.4	I5 L11	I5-N7 VanDerWaalsContact C-N 3.31Å; I5-N7 PolarHBondContact O-N 2.91Å; N7-L11 PolarHBondContact O-N 3.1Å
8	R	65.9	Low	70.7	Confident	143 Å²	143	114.8 Å²	114.8	54%	0.54	59%	0.587	S	S	.	*	H	α-helix	trans	-69.3	-41.5	175.5	-77	-164.2	170.4	-155.2	11.3	112.5	Y4 I5 P6 L11 I12	Y4-R8 HydrophobicContact CE1-CG 4.13Å; Y4-R8 VanDerWaalsContact CE1-CZ 3.42Å; Y4-R8 PolarHBondContact O-N 3.45Å; Y4-R8 PolarHBondContact OH-NE 3.42Å; Y4-R8 PolarHBondContact OH-NH2 3.4Å; I5-R8 PolarHBondContact O-N 3.36Å; P6-R8 PolarHBondContact O-N 3.18Å; R8-L11 PolarHBondContact O-N 3.36Å; R8-I12 WeakPolarHBondContact O-CD1 3.3Å; R8-I12 VanDerWaalsContact O-CG1 3.3Å; R8-I12 WeakPolarHBondContact O-CG1 3.5Å; R8-I12 PolarHBondContact O-N 3.37Å; R8-I12 VanDerWaalsContact O-N 3.1Å
9	V	73	Confident	71.5	Confident	82 Å²	82	114.5 Å²	114.5	50%	0.497	58%	0.583	S	S	.	*	H	α-helix	trans	-64.5	-44.3	179.4	178.9	0	0	0	0	110.5	I5 P6 L11 I12 T13	I5-V9 PolarHBondContact O-N 3.34Å; P6-V9 PolarHBondContact O-N 3.14Å; V9-L11 VanDerWaalsContact C-N 3.32Å; V9-L11 PolarHBondContact O-N 3.37Å; V9-I12 PolarHBondContact O-N 3.27Å; V9-T13 HydrophobicContact CG1-CG2 4.37Å; V9-T13 WeakPolarHBondContact O-CG2 3.33Å; V9-T13 PolarHBondContact O-N 2.99Å; V9-T13 PolarHBondContact O-OG1 3Å
10	V	75.9	Confident	72	Confident	75 Å²	75	114.7 Å²	114.7	46%	0.455	58%	0.583	S	S	.	*	H	α-helix	trans	-61	-39.9	177.2	174.5	0	0	0	0	112	P6 T13 N14	P6-V10 WeakPolarHBondContact O-CG2 3.32Å; P6-V10 PolarHBondContact O-N 2.73Å; P6-V10 VanDerWaalsContact O-N 3.14Å; V10-T13 WeakPolarHBondContact CA-OG1 3.48Å; V10-T13 PolarHBondContact O-OG1 3.48Å; V10-N14 WeakPolarHBondContact O-CB 3.46Å; V10-N14 PolarHBondContact O-N 2.96Å; V10-N14 PolarHBondContact O-ND2 3.39Å
11	L	78.5	Confident	72.7	Confident	126 Å²	126	113.8 Å²	113.8	66%	0.66	58%	0.58	S	S	*	*	H	α-helix	trans	-64	-42.3	176.5	-172.2	70.4	0	0	0	111.7	N7 R8 V9 K15	N7-L11 PolarHBondContact O-N 3.1Å; R8-L11 PolarHBondContact O-N 3.36Å; V9-L11 VanDerWaalsContact C-N 3.32Å; V9-L11 PolarHBondContact O-N 3.37Å; L11-K15 WeakPolarHBondContact O-CB 3.39Å; L11-K15 PolarHBondContact O-N 2.92Å
12	I	79.3	Confident	74.4	Confident	100 Å²	100	105 Å²	105	51%	0.513	54%	0.542	S	S	.	.	H	α-helix	trans	-66.5	-45.4	178.8	-65.7	163.6	0	0	0	110.6	R8 V9 N14 K15 L16	R8-I12 WeakPolarHBondContact O-CD1 3.3Å; R8-I12 VanDerWaalsContact O-CG1 3.3Å; R8-I12 WeakPolarHBondContact O-CG1 3.5Å; R8-I12 PolarHBondContact O-N 3.37Å; R8-I12 VanDerWaalsContact O-N 3.1Å; V9-I12 PolarHBondContact O-N 3.27Å; I12-N14 PolarHBondContact O-N 3.23Å; I12-K15 PolarHBondContact O-N 2.9Å; I12-L16 HydrophobicContact CG2-CD1 3.89Å; I12-L16 HydrophobicContact CG2-CG 4.38Å; I12-L16 WeakPolarHBondContact O-CG 3.39Å; I12-L16 PolarHBondContact O-N 3.04Å
13	T	80.1	Confident	75.9	Confident	68 Å²	68	100.9 Å²	100.9	42%	0.417	53%	0.53	S	S	.	.	H	α-helix	trans	-63.9	-41.3	179	53.3	0	0	0	0	111.9	V9 V10 L16 Q17	V9-T13 HydrophobicContact CG1-CG2 4.37Å; V9-T13 WeakPolarHBondContact O-CG2 3.33Å; V9-T13 PolarHBondContact O-N 2.99Å; V9-T13 PolarHBondContact O-OG1 3Å; V10-T13 WeakPolarHBondContact CA-OG1 3.48Å; V10-T13 PolarHBondContact O-OG1 3.48Å; T13-L16 PolarHBondContact O-N 3.35Å; T13-Q17 WeakPolarHBondContact O-CB 3.31Å; T13-Q17 PolarHBondContact O-N 3.37Å
14	N	83.8	Confident	77.4	Confident	85 Å²	85	98.3 Å²	98.3	46%	0.455	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-43.6	175.3	-82.4	-27.4	0	0	0	111.5	V10 I12 Q17 V18	V10-N14 WeakPolarHBondContact O-CB 3.46Å; V10-N14 PolarHBondContact O-N 2.96Å; V10-N14 PolarHBondContact O-ND2 3.39Å; I12-N14 PolarHBondContact O-N 3.23Å; N14-Q17 PolarHBondContact O-N 2.92Å; N14-V18 VanDerWaalsContact O-CG2 3.32Å; N14-V18 WeakPolarHBondContact O-CG2 3.14Å; N14-V18 PolarHBondContact O-N 3.19Å
15	K	81.5	Confident	78.8	Confident	132 Å²	132	98.6 Å²	98.6	57%	0.574	51%	0.514	S	S	*	.	H	α-helix	trans	-61	-47.4	176.5	-170.4	-174.9	175	-162.8	0	111.3	L11 I12 Q17 V18 E19	L11-K15 WeakPolarHBondContact O-CB 3.39Å; L11-K15 PolarHBondContact O-N 2.92Å; I12-K15 PolarHBondContact O-N 2.9Å; K15-Q17 VanDerWaalsContact C-N 3.34Å; K15-Q17 PolarHBondContact O-N 3.41Å; K15-V18 PolarHBondContact O-N 3.28Å; K15-E19 WeakPolarHBondContact CE-OE1 3.39Å; K15-E19 IonicContact NZ-OE1 3.68Å; K15-E19 WeakPolarHBondContact O-CG 3.25Å; K15-E19 PolarHBondContact O-N 2.84Å
16	L	82.8	Confident	80.3	Confident	91 Å²	91	99.8 Å²	99.8	48%	0.476	52%	0.515	S	S	.	.	H	α-helix	trans	-60.6	-42.3	177.4	-72.2	169.6	0	0	0	111.8	I12 T13 V18 E19 M20	I12-L16 HydrophobicContact CG2-CD1 3.89Å; I12-L16 HydrophobicContact CG2-CG 4.38Å; I12-L16 WeakPolarHBondContact O-CG 3.39Å; I12-L16 PolarHBondContact O-N 3.04Å; T13-L16 PolarHBondContact O-N 3.35Å; L16-V18 PolarHBondContact O-N 3.45Å; L16-E19 PolarHBondContact O-N 2.89Å; L16-M20 WeakPolarHBondContact O-CB 3.35Å; L16-M20 VanDerWaalsContact O-CG 3.25Å; L16-M20 WeakPolarHBondContact O-CG 3.37Å; L16-M20 PolarHBondContact O-N 2.96Å
17	Q	81.9	Confident	81.7	Confident	110 Å²	110	102.2 Å²	102.2	51%	0.514	52%	0.52	S	S	.	.	H	α-helix	trans	-64.4	-39.9	178.1	-175.7	175.2	-17.7	0	0	112.1	T13 N14 K15 N21	T13-Q17 WeakPolarHBondContact O-CB 3.31Å; T13-Q17 PolarHBondContact O-N 3.37Å; N14-Q17 PolarHBondContact O-N 2.92Å; K15-Q17 VanDerWaalsContact C-N 3.34Å; K15-Q17 PolarHBondContact O-N 3.41Å; Q17-N21 VanDerWaalsContact O-CB 3.31Å; Q17-N21 WeakPolarHBondContact O-CB 3.36Å; Q17-N21 PolarHBondContact O-N 2.93Å; Q17-N21 PolarHBondContact O-ND2 3.48Å
18	V	84.1	Confident	82.8	Confident	99 Å²	99	103.5 Å²	103.5	60%	0.6	52%	0.52	S	S	*	.	H	α-helix	trans	-65.9	-44.5	175.2	173.3	0	0	0	0	110.9	N14 K15 L16 N21 A22	N14-V18 VanDerWaalsContact O-CG2 3.32Å; N14-V18 WeakPolarHBondContact O-CG2 3.14Å; N14-V18 PolarHBondContact O-N 3.19Å; K15-V18 PolarHBondContact O-N 3.28Å; L16-V18 PolarHBondContact O-N 3.45Å; V18-N21 PolarHBondContact O-N 2.88Å; V18-A22 WeakPolarHBondContact O-CB 3.49Å; V18-A22 PolarHBondContact O-N 3.36Å
19	E	85.4	Confident	84	Confident	109 Å²	109	99.7 Å²	99.7	51%	0.509	51%	0.509	S	S	.	.	H	α-helix	trans	-63.9	-41.4	177.3	-73.3	180	168.7	0	0	111.9	K15 L16 A22 G23	K15-E19 WeakPolarHBondContact CE-OE1 3.39Å; K15-E19 IonicContact NZ-OE1 3.68Å; K15-E19 WeakPolarHBondContact O-CG 3.25Å; K15-E19 PolarHBondContact O-N 2.84Å; L16-E19 PolarHBondContact O-N 2.89Å; E19-A22 PolarHBondContact O-N 3.44Å; E19-G23 PolarHBondContact O-N 3.33Å
20	M	82.2	Confident	85	Confident	117 Å²	117	102.7 Å²	102.7	58%	0.576	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-46.8	174.2	-73.9	179.2	71.2	0	0	111.7	L16 A22 G23 H24	L16-M20 WeakPolarHBondContact O-CB 3.35Å; L16-M20 VanDerWaalsContact O-CG 3.25Å; L16-M20 WeakPolarHBondContact O-CG 3.37Å; L16-M20 PolarHBondContact O-N 2.96Å; M20-A22 VanDerWaalsContact C-N 3.33Å; M20-A22 PolarHBondContact O-N 3.28Å; M20-G23 PolarHBondContact O-N 3.39Å; M20-H24 PolarHBondContact O-CD2 2.95Å; M20-H24 PolarHBondContact O-N 2.9Å
21	N	87.6	Confident	85.8	Confident	97 Å²	97	105.6 Å²	105.6	52%	0.519	52%	0.523	S	S	.	.	H	α-helix	trans	-62.9	-40.8	178.6	-74.8	-12.7	0	0	0	111.8	Q17 V18 Y25	Q17-N21 VanDerWaalsContact O-CB 3.31Å; Q17-N21 WeakPolarHBondContact O-CB 3.36Å; Q17-N21 PolarHBondContact O-N 2.93Å; Q17-N21 PolarHBondContact O-ND2 3.48Å; V18-N21 PolarHBondContact O-N 2.88Å; N21-Y25 VanDerWaalsContact O-CB 3.3Å; N21-Y25 WeakPolarHBondContact O-CB 3.47Å; N21-Y25 PolarHBondContact O-N 3.45Å
22	A	84.2	Confident	86.4	Confident	39 Å²	39	103.5 Å²	103.5	32%	0.322	52%	0.515	S	S	.	.	H	α-helix	trans	-62.5	-47.1	174	0	0	0	0	0	110.8	V18 E19 M20 H24 Y25 F26	V18-A22 WeakPolarHBondContact O-CB 3.49Å; V18-A22 PolarHBondContact O-N 3.36Å; E19-A22 PolarHBondContact O-N 3.44Å; M20-A22 VanDerWaalsContact C-N 3.33Å; M20-A22 PolarHBondContact O-N 3.28Å; A22-H24 PolarHBondContact O-N 2.92Å; A22-Y25 WeakPolarHBondContact O-CB 3.04Å; A22-Y25 PolarHBondContact O-N 3.47Å; A22-F26 HydrophobicContact CB-CE2 4.41Å; A22-F26 WeakPolarHBondContact O-CD2 3.36Å; A22-F26 PolarHBondContact O-N 3.12Å
23	G	87.2	Confident	86.9	Confident	39 Å²	39	103.4 Å²	103.4	40%	0.402	52%	0.515	S	S	.	.	H	α-helix	trans	-55.7	-50.9	176.2	0	0	0	0	0	112.7	E19 M20 Y25 F26 E27	E19-G23 PolarHBondContact O-N 3.33Å; M20-G23 PolarHBondContact O-N 3.39Å; G23-Y25 VanDerWaalsContact C-N 3.31Å; G23-Y25 PolarHBondContact O-N 2.89Å; G23-F26 PolarHBondContact O-N 3.36Å; G23-E27 WeakPolarHBondContact O-CB 3.3Å; G23-E27 PolarHBondContact O-N 3.17Å
24	H	88.5	Confident	87.4	Confident	96 Å²	96	102.8 Å²	102.8	44%	0.444	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-34.3	176.8	-76.5	-65.3	0	0	0	113.1	M20 A22 E27 K28	M20-H24 PolarHBondContact O-CD2 2.95Å; M20-H24 PolarHBondContact O-N 2.9Å; A22-H24 PolarHBondContact O-N 2.92Å; H24-E27 IonicContact ND1-OE2 3.67Å; H24-K28 WeakPolarHBondContact O-CG 3.42Å; H24-K28 PolarHBondContact O-N 3.24Å
25	Y	86.8	Confident	87.8	Confident	151 Å²	151	102.5 Å²	102.5	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-66.6	-45.3	175.6	-176.2	-103.5	0	0	0	111.4	N21 A22 G23 K28 I29	N21-Y25 VanDerWaalsContact O-CB 3.3Å; N21-Y25 WeakPolarHBondContact O-CB 3.47Å; N21-Y25 PolarHBondContact O-N 3.45Å; A22-Y25 WeakPolarHBondContact O-CB 3.04Å; A22-Y25 PolarHBondContact O-N 3.47Å; G23-Y25 VanDerWaalsContact C-N 3.31Å; G23-Y25 PolarHBondContact O-N 2.89Å; Y25-K28 PolarHBondContact O-N 3.23Å; Y25-I29 HydrophobicContact CD1-CD1 3.62Å; Y25-I29 HydrophobicContact CE1-CD1 3.15Å; Y25-I29 HydrophobicContact CE1-CG1 4.31Å; Y25-I29 HydrophobicContact CE2-CD1 4.27Å; Y25-I29 HydrophobicContact CG-CD1 4.36Å; Y25-I29 WeakPolarHBondContact O-CG1 3.44Å; Y25-I29 PolarHBondContact O-N 3.36Å
26	F	89.2	Confident	88	Confident	143 Å²	143	98.6 Å²	98.6	63%	0.627	50%	0.498	S	S	*	.	H	α-helix	trans	-64	-40	175.2	-75.7	-64.6	0	0	0	112.3	A22 G23 I29 F30	A22-F26 HydrophobicContact CB-CE2 4.41Å; A22-F26 WeakPolarHBondContact O-CD2 3.36Å; A22-F26 PolarHBondContact O-N 3.12Å; G23-F26 PolarHBondContact O-N 3.36Å; F26-I29 PolarHBondContact O-N 3.03Å; F26-F30 WeakPolarHBondContact O-CB 3.46Å; F26-F30 PolarHBondContact O-N 3.39Å
27	E	90.4	Very high	88.2	Confident	123 Å²	123	98.4 Å²	98.4	58%	0.575	50%	0.501	S	S	*	.	H	α-helix	trans	-60.3	-46.9	176	-171.1	-171.9	170.2	0	0	111.4	G23 H24 I29 F30 F31	G23-E27 WeakPolarHBondContact O-CB 3.3Å; G23-E27 PolarHBondContact O-N 3.17Å; H24-E27 IonicContact ND1-OE2 3.67Å; E27-I29 PolarHBondContact O-N 3.03Å; E27-F30 PolarHBondContact O-N 3.04Å; E27-F31 WeakPolarHBondContact O-CB 3.31Å; E27-F31 PolarHBondContact O-N 2.87Å
28	K	90.7	Very high	88.5	Confident	149 Å²	149	97.9 Å²	97.9	65%	0.648	50%	0.501	S	S	*	.	H	α-helix	trans	-60.9	-46.1	176.5	-75.4	-179.5	-179.1	-176.8	0	111.9	H24 Y25 F31 T32	H24-K28 WeakPolarHBondContact O-CG 3.42Å; H24-K28 PolarHBondContact O-N 3.24Å; Y25-K28 PolarHBondContact O-N 3.23Å; K28-F31 PolarHBondContact O-N 3.42Å; K28-T32 PolarHBondContact O-N 2.91Å; K28-T32 PolarHBondContact O-OG1 3.49Å
29	I	91.4	Very high	88.4	Confident	62 Å²	62	98.3 Å²	98.3	32%	0.318	50%	0.499	S	S	.	.	H	α-helix	trans	-60.9	-48.1	177.5	-71.9	171.4	0	0	0	110.8	Y25 F26 E27 F31 T32 I33	Y25-I29 HydrophobicContact CD1-CD1 3.62Å; Y25-I29 HydrophobicContact CE1-CD1 3.15Å; Y25-I29 HydrophobicContact CE1-CG1 4.31Å; Y25-I29 HydrophobicContact CE2-CD1 4.27Å; Y25-I29 HydrophobicContact CG-CD1 4.36Å; Y25-I29 WeakPolarHBondContact O-CG1 3.44Å; Y25-I29 PolarHBondContact O-N 3.36Å; F26-I29 PolarHBondContact O-N 3.03Å; E27-I29 PolarHBondContact O-N 3.03Å; I29-F31 VanDerWaalsContact C-N 3.33Å; I29-F31 PolarHBondContact O-N 2.95Å; I29-T32 PolarHBondContact O-N 3.4Å; I29-I33 HydrophobicContact CG2-CD1 3.6Å; I29-I33 HydrophobicContact CG2-CG1 4.27Å; I29-I33 VanDerWaalsContact O-CG1 3.31Å; I29-I33 WeakPolarHBondContact O-CG1 3.48Å; I29-I33 PolarHBondContact O-N 2.93Å
30	F	92.9	Very high	88.2	Confident	145 Å²	145	100 Å²	100	64%	0.636	51%	0.507	S	S	*	.	H	α-helix	trans	-58.1	-47.4	179.8	178.9	-99.4	0	0	0	111	F26 E27 T32 I33 V34	F26-F30 WeakPolarHBondContact O-CB 3.46Å; F26-F30 PolarHBondContact O-N 3.39Å; E27-F30 PolarHBondContact O-N 3.04Å; F30-T32 PolarHBondContact O-N 2.93Å; F30-I33 PolarHBondContact O-N 3.43Å; F30-V34 HydrophobicContact CD1-CG2 4.17Å; F30-V34 HydrophobicContact CD2-CG2 4.37Å; F30-V34 HydrophobicContact CE1-CG2 3.77Å; F30-V34 HydrophobicContact CE2-CG2 3.99Å; F30-V34 HydrophobicContact CG-CG2 4.47Å; F30-V34 HydrophobicContact CZ-CG2 3.67Å; F30-V34 WeakPolarHBondContact O-CG2 3.36Å; F30-V34 PolarHBondContact O-N 3.28Å
31	F	92.8	Very high	87.9	Confident	136 Å²	136	98.7 Å²	98.7	60%	0.596	51%	0.51	S	S	*	.	H	α-helix	trans	-60.4	-45.5	177.1	-174.2	-96.8	0	0	0	112.2	E27 K28 I29 I33 V34 L35	E27-F31 WeakPolarHBondContact O-CB 3.31Å; E27-F31 PolarHBondContact O-N 2.87Å; K28-F31 PolarHBondContact O-N 3.42Å; I29-F31 VanDerWaalsContact C-N 3.33Å; I29-F31 PolarHBondContact O-N 2.95Å; F31-I33 VanDerWaalsContact C-N 3.34Å; F31-I33 PolarHBondContact O-N 3.17Å; F31-V34 PolarHBondContact O-N 3.32Å; F31-L35 HydrophobicContact CE1-CD2 4.09Å; F31-L35 VanDerWaalsContact O-CB 3.25Å; F31-L35 WeakPolarHBondContact O-CB 3.33Å; F31-L35 PolarHBondContact O-N 2.7Å
32	T	90.9	Very high	87	Confident	83 Å²	83	97.7 Å²	97.7	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-60.5	-42.5	176.9	-60.6	0	0	0	0	112	K28 I29 F30 S36	K28-T32 PolarHBondContact O-N 2.91Å; K28-T32 PolarHBondContact O-OG1 3.49Å; I29-T32 PolarHBondContact O-N 3.4Å; F30-T32 PolarHBondContact O-N 2.93Å; T32-S36 VanDerWaalsContact O-CB 3.31Å; T32-S36 WeakPolarHBondContact O-CB 3.32Å; T32-S36 PolarHBondContact O-N 2.93Å; T32-S36 PolarHBondContact O-OG 3.06Å
33	I	91.3	Very high	86	Confident	98 Å²	98	97.5 Å²	97.5	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-64.4	-50.5	177.6	-67.6	169.3	0	0	0	110.1	I29 F30 F31 L35 S36 V37	I29-I33 HydrophobicContact CG2-CD1 3.6Å; I29-I33 HydrophobicContact CG2-CG1 4.27Å; I29-I33 VanDerWaalsContact O-CG1 3.31Å; I29-I33 WeakPolarHBondContact O-CG1 3.48Å; I29-I33 PolarHBondContact O-N 2.93Å; F30-I33 PolarHBondContact O-N 3.43Å; F31-I33 VanDerWaalsContact C-N 3.34Å; F31-I33 PolarHBondContact O-N 3.17Å; I33-L35 VanDerWaalsContact C-N 3.34Å; I33-L35 PolarHBondContact O-N 3.47Å; I33-S36 WeakPolarHBondContact O-CB 3.32Å; I33-S36 PolarHBondContact O-N 3.42Å; I33-V37 HydrophobicContact CG2-CG2 4.45Å; I33-V37 WeakPolarHBondContact O-CG2 3.25Å; I33-V37 PolarHBondContact O-N 2.93Å
34	V	90.9	Very high	84.6	Confident	55 Å²	55	100 Å²	100	33%	0.333	52%	0.519	S	S	.	.	H	α-helix	trans	-59.2	-46.2	179.9	171.8	0	0	0	0	110.8	F30 F31 S36 V37 L38	F30-V34 HydrophobicContact CD1-CG2 4.17Å; F30-V34 HydrophobicContact CD2-CG2 4.37Å; F30-V34 HydrophobicContact CE1-CG2 3.77Å; F30-V34 HydrophobicContact CE2-CG2 3.99Å; F30-V34 HydrophobicContact CG-CG2 4.47Å; F30-V34 HydrophobicContact CZ-CG2 3.67Å; F30-V34 WeakPolarHBondContact O-CG2 3.36Å; F30-V34 PolarHBondContact O-N 3.28Å; F31-V34 PolarHBondContact O-N 3.32Å; V34-S36 VanDerWaalsContact C-N 3.33Å; V34-S36 PolarHBondContact O-N 2.9Å; V34-V37 PolarHBondContact O-N 3.35Å; V34-L38 HydrophobicContact CG1-CD1 3.98Å; V34-L38 HydrophobicContact CG1-CG 4.36Å; V34-L38 WeakPolarHBondContact O-CB 3.31Å; V34-L38 VanDerWaalsContact O-CG 3.32Å; V34-L38 WeakPolarHBondContact O-CG 3.25Å; V34-L38 PolarHBondContact O-N 3.44Å
35	L	90.6	Very high	83.2	Confident	78 Å²	78	105.8 Å²	105.8	41%	0.408	54%	0.543	S	S	.	.	H	α-helix	trans	-61.3	-42.1	177.4	-176.5	63.2	0	0	0	111.7	F31 I33 V37 L38 L39	F31-L35 HydrophobicContact CE1-CD2 4.09Å; F31-L35 VanDerWaalsContact O-CB 3.25Å; F31-L35 WeakPolarHBondContact O-CB 3.33Å; F31-L35 PolarHBondContact O-N 2.7Å; I33-L35 VanDerWaalsContact C-N 3.34Å; I33-L35 PolarHBondContact O-N 3.47Å; L35-V37 PolarHBondContact O-N 2.86Å; L35-L38 PolarHBondContact O-N 3.37Å; L35-L39 HydrophobicContact CD1-CD1 4.4Å; L35-L39 HydrophobicContact CD1-CG 4.47Å; L35-L39 HydrophobicContact CG-CD1 4.11Å; L35-L39 WeakPolarHBondContact O-CB 3.48Å; L35-L39 WeakPolarHBondContact O-CG 3.32Å; L35-L39 PolarHBondContact O-N 3.26Å
36	S	87.3	Confident	81.6	Confident	51 Å²	51	109.9 Å²	109.9	36%	0.357	56%	0.558	S	S	.	*	H	α-helix	trans	-62.9	-41.1	177.1	-59.7	0	0	0	0	112	T32 I33 V34 Q40	T32-S36 VanDerWaalsContact O-CB 3.31Å; T32-S36 WeakPolarHBondContact O-CB 3.32Å; T32-S36 PolarHBondContact O-N 2.93Å; T32-S36 PolarHBondContact O-OG 3.06Å; I33-S36 WeakPolarHBondContact O-CB 3.32Å; I33-S36 PolarHBondContact O-N 3.42Å; V34-S36 VanDerWaalsContact C-N 3.33Å; V34-S36 PolarHBondContact O-N 2.9Å; S36-Q40 WeakPolarHBondContact O-CB 3.5Å; S36-Q40 VanDerWaalsContact O-CG 3.25Å; S36-Q40 WeakPolarHBondContact O-CG 3.35Å; S36-Q40 PolarHBondContact O-N 2.91Å; S36-Q40 PolarHBondContact O-NE2 3.28Å
37	V	86.9	Confident	79.8	Confident	86 Å²	86	107.6 Å²	107.6	52%	0.521	56%	0.556	S	S	.	*	H	α-helix	trans	-67	-44.1	176.7	172.6	0	0	0	0	110.8	I33 V34 L35 Q40 S41	I33-V37 HydrophobicContact CG2-CG2 4.45Å; I33-V37 WeakPolarHBondContact O-CG2 3.25Å; I33-V37 PolarHBondContact O-N 2.93Å; V34-V37 PolarHBondContact O-N 3.35Å; L35-V37 PolarHBondContact O-N 2.86Å; V37-Q40 PolarHBondContact O-N 3.46Å; V37-S41 PolarHBondContact O-N 2.84Å; V37-S41 PolarHBondContact O-OG 3.48Å
38	L	86.5	Confident	78.2	Confident	100 Å²	100	109.2 Å²	109.2	52%	0.524	57%	0.568	S	S	.	*	H	α-helix	trans	-60.1	-48.4	177.5	-73.3	173.9	0	0	0	111.2	V34 L35 Q40 S41 A42	V34-L38 HydrophobicContact CG1-CD1 3.98Å; V34-L38 HydrophobicContact CG1-CG 4.36Å; V34-L38 WeakPolarHBondContact O-CB 3.31Å; V34-L38 VanDerWaalsContact O-CG 3.32Å; V34-L38 WeakPolarHBondContact O-CG 3.25Å; V34-L38 PolarHBondContact O-N 3.44Å; L35-L38 PolarHBondContact O-N 3.37Å; L38-Q40 VanDerWaalsContact C-N 3.32Å; L38-Q40 PolarHBondContact O-N 3.4Å; L38-S41 PolarHBondContact O-N 2.77Å; L38-S41 VanDerWaalsContact O-N 3.14Å; L38-S41 PolarHBondContact O-OG 3.14Å; L38-A42 WeakPolarHBondContact O-CB 3.46Å; L38-A42 PolarHBondContact O-N 2.93Å
39	L	83.5	Confident	76.4	Confident	107 Å²	107	107 Å²	107	56%	0.56	57%	0.568	S	S	*	*	H	α-helix	trans	-59.8	-41.9	177	-73	169.2	0	0	0	111.9	L35 S41 A42 C43	L35-L39 HydrophobicContact CD1-CD1 4.4Å; L35-L39 HydrophobicContact CD1-CG 4.47Å; L35-L39 HydrophobicContact CG-CD1 4.11Å; L35-L39 WeakPolarHBondContact O-CB 3.48Å; L35-L39 WeakPolarHBondContact O-CG 3.32Å; L35-L39 PolarHBondContact O-N 3.26Å; L39-S41 VanDerWaalsContact C-N 3.35Å; L39-S41 PolarHBondContact O-N 3.39Å; L39-A42 PolarHBondContact O-N 3.35Å; L39-C43 PolarHBondContact O-N 2.78Å; L39-C43 PolarHBondContact O-SG 2.01Å
40	Q	79.8	Confident	74.8	Confident	146 Å²	146	108 Å²	108	68%	0.682	58%	0.58	S	S	*	*	H	α-helix	trans	-63.3	-38.7	175.4	-74.9	174.6	56.9	0	0	112.7	S36 V37 L38	S36-Q40 WeakPolarHBondContact O-CB 3.5Å; S36-Q40 VanDerWaalsContact O-CG 3.25Å; S36-Q40 WeakPolarHBondContact O-CG 3.35Å; S36-Q40 PolarHBondContact O-N 2.91Å; S36-Q40 PolarHBondContact O-NE2 3.28Å; V37-Q40 PolarHBondContact O-N 3.46Å; L38-Q40 VanDerWaalsContact C-N 3.32Å; L38-Q40 PolarHBondContact O-N 3.4Å
41	S	76.3	Confident	73.1	Confident	89 Å²	89	104.3 Å²	104.3	62%	0.622	58%	0.582	S	S	*	*	H	α-helix	trans	-74.4	-31.3	177.2	67.5	0	0	0	0	113.8	V37 L38 L39 C43	V37-S41 PolarHBondContact O-N 2.84Å; V37-S41 PolarHBondContact O-OG 3.48Å; L38-S41 PolarHBondContact O-N 2.77Å; L38-S41 VanDerWaalsContact O-N 3.14Å; L38-S41 PolarHBondContact O-OG 3.14Å; L39-S41 VanDerWaalsContact C-N 3.35Å; L39-S41 PolarHBondContact O-N 3.39Å; S41-C43 PolarHBondContact O-N 3.19Å
42	A	68.7	Low	71.3	Confident	75 Å²	75	101.6 Å²	101.6	62%	0.62	59%	0.585	S	S	*	*	H	α-helix	trans	-74.1	-14.8	177.7	0	0	0	0	0	112.1	L38 L39 P44	L38-A42 WeakPolarHBondContact O-CB 3.46Å; L38-A42 PolarHBondContact O-N 2.93Å; L39-A42 PolarHBondContact O-N 3.35Å; A42-P44 WeakPolarHBondContact O-CD 3Å
43	C	63.1	Low	69.6	Low	36 Å²	36	105.4 Å²	105.4	24%	0.243	60%	0.602	C	S	.	*	S	Bend	trans	-84	106.8	175.4	-71.5	0	0	0	0	111.2	L39 S41 K45 C50	L39-C43 PolarHBondContact O-N 2.78Å; L39-C43 PolarHBondContact O-SG 2.01Å; S41-C43 PolarHBondContact O-N 3.19Å; C43-K45 PolarHBondContact O-N 3.2Å; C43-C50 HydrophobicContact CB-CB 4.07Å; C43-C50 WeakPolarHBondContact CB-SG 3.14Å; C43-C50 WeakPolarHBondContact SG-CB 2.99Å; C43-C50 CovalentContact SG-SG 2.01Å; C43-C50 PolarHBondContact SG-SG 3.4Å
44	P	58.8	Low	67.7	Low	90 Å²	90	107.5 Å²	107.5	58%	0.584	62%	0.619	S	S	*	*			trans	-63.6	131.3	173.8	27.2	-32.5	0	0	0	108.7	A42 R46	A42-P44 WeakPolarHBondContact O-CD 3Å; P44-R46 PolarHBondContact O-N 2.68Å
45	K	57.9	Low	65.2	Low	219 Å²	219	112.6 Å²	112.6	95%	0.952	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.9	20.4	-177.3	-82.5	178.8	172.7	173.1	0	116.2	C43	C43-K45 PolarHBondContact O-N 3.2Å
46	R	54.9	Low	64	Low	236 Å²	236	114.4 Å²	114.4	89%	0.891	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-138.4	-2.3	-173.7	-83.1	-162.1	161.7	135.1	-1.1	118.5	P44	P44-R46 PolarHBondContact O-N 2.68Å
47	T	50.2	Low	62.7	Low	96 Å²	96	117.7 Å²	117.7	59%	0.589	70%	0.697	S	S	*	*	S	Bend	trans	-150	111.5	-177	38.4	0	0	0	0	112.3
48	L	56.3	Low	61.4	Low	157 Å²	157	119.4 Å²	119.4	82%	0.822	71%	0.706	S	S	*	*	S	Bend	trans	70.3	143.4	170.1	-71.9	103.6	0	0	0	118.1	C50	L48-C50 PolarHBondContact O-N 3.34Å
49	P	53.9	Low	59.9	Low	101 Å²	101	120.6 Å²	120.6	66%	0.656	72%	0.717	S	S	*	*			trans	-72.2	114.6	-178.8	29.8	-31.3	0	0	0	109	G51 A52	P49-G51 PolarHBondContact O-N 3.24Å; P49-A52 PolarHBondContact O-N 3.38Å
50	C	58.4	Low	58.4	Low	84 Å²	84	121.4 Å²	121.4	57%	0.568	73%	0.727	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	19.2	169.9	-68	0	0	0	0	114.3	C43 L48	C43-C50 HydrophobicContact CB-CB 4.07Å; C43-C50 WeakPolarHBondContact CB-SG 3.14Å; C43-C50 WeakPolarHBondContact SG-CB 2.99Å; C43-C50 CovalentContact SG-SG 2.01Å; C43-C50 PolarHBondContact SG-SG 3.4Å; L48-C50 PolarHBondContact O-N 3.34Å
51	G	55.9	Low	57	Low	67 Å²	67	119.8 Å²	119.8	69%	0.691	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.8	8.6	173	0	0	0	0	0	114.7	P49	P49-G51 PolarHBondContact O-N 3.24Å
52	A	55.8	Low	55.6	Low	79 Å²	79	122 Å²	122	65%	0.653	74%	0.738	S	S	*	*	S	Bend	trans	-102	-0.7	-179.3	0	0	0	0	0	115.2	P49	P49-A52 PolarHBondContact O-N 3.38Å
53	L	54	Low	54.6	Low	163 Å²	163	125.6 Å²	125.6	85%	0.853	75%	0.747	S	S	*	*	S	Bend	trans	-106.1	11.8	-178.1	-87.8	158.9	0	0	0	114
54	V	52	Low	53.9	Low	143 Å²	143	133.1 Å²	133.1	87%	0.867	79%	0.789	S	S	*	*			trans	-107.6	63.4	172.3	-171.4	0	0	0	0	108.5
55	A	39	Very low	53.5	Low	162 Å²	162	137 Å²	137	100%	1.339	81%	0.807	S	S	*	*			trans	-138	0	159.2	0	0	0	0	0	106

Retrieved 55 of 55 residues in 92.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).