A0A3Q0KSR9_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KSR9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 122 aa.

						>A0A3Q0KSR9_SCHMA|A0A3Q0KSR9
MTLDAQDEYKMKKEDIELYKRIRREVEQEFMAKSEPVDYRSVTKVDFHKDVVRLSPRPEPMLHEMVREQPVTFWTEHRDKMHGNTHYSTNRTTPFGRNAAFTTPIGQYLNSRMPCEMQVFSR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.3	Low	76	Confident	229 Å²	229	130.7 Å²	130.7	100%	1.128	66%	0.661	S	S	*	*				0	57.6	0	-69.1	173.5	173.6	0	0	109.8
2	T	63.5	Low	77.3	Confident	117 Å²	117	131.8 Å²	131.8	72%	0.718	66%	0.658	S	S	*	*			trans	-124.7	-0.4	-174.4	37.9	0	0	0	0	113.3
3	L	62.4	Low	78.5	Confident	129 Å²	129	130.5 Å²	130.5	68%	0.675	65%	0.645	S	S	*	*	H	α-helix	trans	-75	-37.1	-179.2	-75.9	157.8	0	0	0	111.8	A5 Q6 D7	L3-A5 VanDerWaalsContact C-N 3.3Å; L3-A5 PolarHBondContact O-N 3.14Å; L3-Q6 PolarHBondContact O-N 3.27Å; L3-Q6 VanDerWaalsContact O-N 3.12Å; L3-D7 PolarHBondContact O-N 3.47Å; L3-D7 VanDerWaalsContact O-N 3.1Å
4	D	76.4	Confident	79.6	Confident	119 Å²	119	128.6 Å²	128.6	64%	0.636	63%	0.634	S	S	*	*	H	α-helix	trans	-61.3	-36.4	-177.5	-52.6	-29.3	0	0	0	113	D7 E8	D4-D7 PolarHBondContact O-N 3.39Å; D4-E8 PolarHBondContact O-N 2.94Å
5	A	78.8	Confident	80.6	Confident	67 Å²	67	126.5 Å²	126.5	55%	0.554	63%	0.626	S	S	*	*	H	α-helix	trans	-71.3	-32.1	178.8	0	0	0	0	0	113	L3 Y9	L3-A5 VanDerWaalsContact C-N 3.3Å; L3-A5 PolarHBondContact O-N 3.14Å; A5-Y9 WeakPolarHBondContact O-CB 3.43Å; A5-Y9 PolarHBondContact O-N 3.45Å; A5-Y9 VanDerWaalsContact O-N 3.14Å
6	Q	78.6	Confident	81.5	Confident	145 Å²	145	124.4 Å²	124.4	68%	0.678	62%	0.617	S	S	*	*	H	α-helix	trans	-72.7	-39.5	174.7	-77.1	-133.9	-49.6	0	0	111.4	L3 Y9 K10	L3-Q6 PolarHBondContact O-N 3.27Å; L3-Q6 VanDerWaalsContact O-N 3.12Å; Q6-Y9 PolarHBondContact O-N 3.1Å; Q6-K10 WeakPolarHBondContact O-CB 3.35Å; Q6-K10 PolarHBondContact O-N 2.98Å
7	D	80.6	Confident	82.4	Confident	102 Å²	102	123.7 Å²	123.7	55%	0.545	61%	0.612	S	S	.	*	H	α-helix	trans	-67.5	-41.1	176.7	-80.7	-19.5	0	0	0	111.7	L3 D4 Y9 K10 M11	L3-D7 PolarHBondContact O-N 3.47Å; L3-D7 VanDerWaalsContact O-N 3.1Å; D4-D7 PolarHBondContact O-N 3.39Å; D7-Y9 PolarHBondContact O-N 3.12Å; D7-K10 PolarHBondContact O-N 3.24Å; D7-M11 WeakPolarHBondContact O-CB 3.37Å; D7-M11 PolarHBondContact O-N 3.08Å
8	E	81.8	Confident	83.2	Confident	134 Å²	134	121.9 Å²	121.9	63%	0.626	61%	0.605	S	S	*	*	H	α-helix	trans	-60.1	-44.5	171.9	-83.4	-164.8	158.8	0	0	112.3	D4 K10 M11 K12	D4-E8 PolarHBondContact O-N 2.94Å; E8-K10 VanDerWaalsContact C-N 3.32Å; E8-K10 PolarHBondContact O-N 3.35Å; E8-M11 PolarHBondContact O-N 3.47Å; E8-K12 WeakPolarHBondContact O-CG 3.39Å; E8-K12 PolarHBondContact O-N 3.01Å
9	Y	87.6	Confident	83.9	Confident	173 Å²	173	124.2 Å²	124.2	68%	0.678	61%	0.607	S	S	*	*	H	α-helix	trans	-62.1	-41.8	178.1	178.7	-99.6	0	0	0	111.8	A5 Q6 D7 K13	A5-Y9 WeakPolarHBondContact O-CB 3.43Å; A5-Y9 PolarHBondContact O-N 3.45Å; A5-Y9 VanDerWaalsContact O-N 3.14Å; Q6-Y9 PolarHBondContact O-N 3.1Å; D7-Y9 PolarHBondContact O-N 3.12Å; Y9-K13 PolarHBondContact O-N 3.31Å; Y9-K13 VanDerWaalsContact O-N 3.08Å
10	K	87.9	Confident	84.5	Confident	121 Å²	121	124.2 Å²	124.2	53%	0.526	60%	0.603	S	S	.	*	H	α-helix	trans	-63.8	-46.3	177	-171.3	-177	174.4	-160.5	0	111.1	Q6 D7 E8 K12 K13 E14	Q6-K10 WeakPolarHBondContact O-CB 3.35Å; Q6-K10 PolarHBondContact O-N 2.98Å; D7-K10 PolarHBondContact O-N 3.24Å; E8-K10 VanDerWaalsContact C-N 3.32Å; E8-K10 PolarHBondContact O-N 3.35Å; K10-K12 PolarHBondContact O-N 3.45Å; K10-K13 WeakPolarHBondContact O-CB 3.39Å; K10-K13 PolarHBondContact O-N 2.95Å; K10-K13 VanDerWaalsContact O-N 3.12Å; K10-E14 VanDerWaalsContact CE-OE1 3.29Å; K10-E14 WeakPolarHBondContact CE-OE1 3.45Å; K10-E14 WeakPolarHBondContact O-CG 3.41Å; K10-E14 PolarHBondContact O-N 3.12Å
11	M	85.5	Confident	85.1	Confident	102 Å²	102	125.7 Å²	125.7	50%	0.502	60%	0.603	S	S	.	*	H	α-helix	trans	-63.3	-42.2	179.8	-162.6	-96.6	-72	0	0	111.6	D7 E8 K13 E14 D15	D7-M11 WeakPolarHBondContact O-CB 3.37Å; D7-M11 PolarHBondContact O-N 3.08Å; E8-M11 PolarHBondContact O-N 3.47Å; M11-K13 VanDerWaalsContact C-N 3.3Å; M11-K13 PolarHBondContact O-N 2.94Å; M11-E14 PolarHBondContact O-N 3.35Å; M11-D15 PolarHBondContact O-N 2.89Å
12	K	90.8	Very high	87.1	Confident	144 Å²	144	118.8 Å²	118.8	63%	0.626	57%	0.569	S	S	*	*	H	α-helix	trans	-61.3	-37	172.8	-71.3	-138.5	178.5	-176.2	0	113.3	E8 K10 I16	E8-K12 WeakPolarHBondContact O-CG 3.39Å; E8-K12 PolarHBondContact O-N 3.01Å; K10-K12 PolarHBondContact O-N 3.45Å; K12-I16 WeakPolarHBondContact O-CD1 3.42Å; K12-I16 WeakPolarHBondContact O-CG1 3.19Å; K12-I16 PolarHBondContact O-N 2.9Å; K12-I16 VanDerWaalsContact O-N 3.08Å
13	K	93.3	Very high	88.6	Confident	114 Å²	114	120.1 Å²	120.1	50%	0.496	56%	0.561	S	S	.	*	H	α-helix	trans	-66.8	-42.5	177.7	-170.2	-174.4	173.4	-167.3	0	111.2	Y9 K10 M11 I16 E17	Y9-K13 PolarHBondContact O-N 3.31Å; Y9-K13 VanDerWaalsContact O-N 3.08Å; K10-K13 WeakPolarHBondContact O-CB 3.39Å; K10-K13 PolarHBondContact O-N 2.95Å; K10-K13 VanDerWaalsContact O-N 3.12Å; M11-K13 VanDerWaalsContact C-N 3.3Å; M11-K13 PolarHBondContact O-N 2.94Å; K13-I16 PolarHBondContact O-N 2.86Å; K13-E17 WeakPolarHBondContact CE-OE1 3.29Å; K13-E17 PolarHBondContact O-N 3Å
14	E	93.7	Very high	90.1	Very high	104 Å²	104	121 Å²	121	49%	0.486	56%	0.556	S	S	.	*	H	α-helix	trans	-62.5	-44.3	176.8	-70.5	173.2	-176.9	0	0	111.3	K10 M11 I16 E17 L18	K10-E14 VanDerWaalsContact CE-OE1 3.29Å; K10-E14 WeakPolarHBondContact CE-OE1 3.45Å; K10-E14 WeakPolarHBondContact O-CG 3.41Å; K10-E14 PolarHBondContact O-N 3.12Å; M11-E14 PolarHBondContact O-N 3.35Å; E14-I16 PolarHBondContact O-N 3.23Å; E14-E17 PolarHBondContact O-N 3.44Å; E14-L18 WeakPolarHBondContact O-CB 3.43Å; E14-L18 PolarHBondContact O-N 3.36Å
15	D	94.5	Very high	90.9	Very high	97 Å²	97	120.2 Å²	120.2	52%	0.519	55%	0.548	S	S	.	.	H	α-helix	trans	-60.3	-43	175.1	-98.7	6.2	0	0	0	112.5	M11 E17 L18 Y19	M11-D15 PolarHBondContact O-N 2.89Å; D15-E17 VanDerWaalsContact C-N 3.34Å; D15-E17 PolarHBondContact O-N 3.08Å; D15-L18 PolarHBondContact O-N 3.37Å; D15-Y19 WeakPolarHBondContact O-CB 3.39Å; D15-Y19 PolarHBondContact O-N 3.49Å
16	I	95.9	Very high	91.5	Very high	94 Å²	94	120 Å²	120	48%	0.482	54%	0.54	S	S	.	.	H	α-helix	trans	-64.2	-40.8	177.2	-69.9	164.6	0	0	0	110.9	K12 K13 E14 K20	K12-I16 WeakPolarHBondContact O-CD1 3.42Å; K12-I16 WeakPolarHBondContact O-CG1 3.19Å; K12-I16 PolarHBondContact O-N 2.9Å; K12-I16 VanDerWaalsContact O-N 3.08Å; K13-I16 PolarHBondContact O-N 2.86Å; E14-I16 PolarHBondContact O-N 3.23Å; I16-K20 HydrophobicContact CG2-CD 4.29Å; I16-K20 VanDerWaalsContact O-CG 3.31Å; I16-K20 WeakPolarHBondContact O-CG 3.25Å; I16-K20 PolarHBondContact O-N 3.38Å; I16-K20 VanDerWaalsContact O-N 3.07Å
17	E	96.2	Very high	92.2	Very high	112 Å²	112	117.5 Å²	117.5	52%	0.523	53%	0.528	S	S	.	.	H	α-helix	trans	-67.8	-40.5	177.2	-77.6	-176.3	-171.8	0	0	111.8	K13 E14 D15 K20 R21	K13-E17 WeakPolarHBondContact CE-OE1 3.29Å; K13-E17 PolarHBondContact O-N 3Å; E14-E17 PolarHBondContact O-N 3.44Å; D15-E17 VanDerWaalsContact C-N 3.34Å; D15-E17 PolarHBondContact O-N 3.08Å; E17-K20 PolarHBondContact O-N 3.48Å; E17-R21 PolarHBondContact O-N 2.99Å
18	L	96.4	Very high	92.5	Very high	92 Å²	92	119.1 Å²	119.1	48%	0.482	53%	0.532	S	S	.	.	H	α-helix	trans	-61.3	-47.7	174.9	-178.4	61.2	0	0	0	111.1	E14 D15 K20 R21 I22	E14-L18 WeakPolarHBondContact O-CB 3.43Å; E14-L18 PolarHBondContact O-N 3.36Å; D15-L18 PolarHBondContact O-N 3.37Å; L18-K20 VanDerWaalsContact C-N 3.32Å; L18-K20 PolarHBondContact O-N 3.14Å; L18-R21 PolarHBondContact O-N 3.37Å; L18-R21 VanDerWaalsContact O-N 3.14Å; L18-I22 HydrophobicContact CD1-CD1 3.99Å; L18-I22 HydrophobicContact CD1-CG1 4.29Å; L18-I22 HydrophobicContact CG-CD1 3.87Å; L18-I22 WeakPolarHBondContact O-CG1 3.31Å; L18-I22 PolarHBondContact O-N 2.75Å
19	Y	96.9	Very high	92.7	Very high	165 Å²	165	120.2 Å²	120.2	65%	0.647	54%	0.538	S	S	*	.	H	α-helix	trans	-59.5	-42.4	177.4	-170.1	-92.3	0	0	0	112	D15 R21 I22 R23	D15-Y19 WeakPolarHBondContact O-CB 3.39Å; D15-Y19 PolarHBondContact O-N 3.49Å; Y19-R21 PolarHBondContact O-N 3.07Å; Y19-I22 PolarHBondContact O-N 2.89Å; Y19-R23 VanDerWaalsContact O-CB 3.25Å; Y19-R23 WeakPolarHBondContact O-CB 3.45Å; Y19-R23 PolarHBondContact O-N 2.94Å
20	K	96.7	Very high	92.5	Very high	124 Å²	124	120.2 Å²	120.2	54%	0.539	54%	0.541	S	S	.	.	H	α-helix	trans	-63.8	-37.9	176.2	-75.7	173.3	-178	176.1	0	112.7	I16 E17 L18 R24	I16-K20 HydrophobicContact CG2-CD 4.29Å; I16-K20 VanDerWaalsContact O-CG 3.31Å; I16-K20 WeakPolarHBondContact O-CG 3.25Å; I16-K20 PolarHBondContact O-N 3.38Å; I16-K20 VanDerWaalsContact O-N 3.07Å; E17-K20 PolarHBondContact O-N 3.48Å; L18-K20 VanDerWaalsContact C-N 3.32Å; L18-K20 PolarHBondContact O-N 3.14Å; K20-R24 WeakPolarHBondContact O-CB 3.29Å; K20-R24 PolarHBondContact O-N 2.89Å; K20-R24 VanDerWaalsContact O-N 3.17Å
21	R	96.3	Very high	92	Very high	156 Å²	156	121.9 Å²	121.9	59%	0.589	55%	0.553	S	S	*	*	H	α-helix	trans	-66	-52.4	176.2	176.4	-179	-107.9	164.2	-4.4	110.5	E17 L18 Y19 R23 R24 E25	E17-R21 PolarHBondContact O-N 2.99Å; L18-R21 PolarHBondContact O-N 3.37Å; L18-R21 VanDerWaalsContact O-N 3.14Å; Y19-R21 PolarHBondContact O-N 3.07Å; R21-R23 VanDerWaalsContact C-N 3.31Å; R21-R23 PolarHBondContact O-N 3.47Å; R21-R24 WeakPolarHBondContact O-CB 3.26Å; R21-R24 PolarHBondContact O-N 3.25Å; R21-E25 WeakPolarHBondContact CG-OE1 3.42Å; R21-E25 PolarHBondContact O-N 3.3Å
22	I	96	Very high	91	Very high	83 Å²	83	120.4 Å²	120.4	43%	0.426	56%	0.557	S	S	.	*	H	α-helix	trans	-58.3	-46	179.9	-66.2	169.4	0	0	0	110.1	L18 Y19 R24 E25 V26	L18-I22 HydrophobicContact CD1-CD1 3.99Å; L18-I22 HydrophobicContact CD1-CG1 4.29Å; L18-I22 HydrophobicContact CG-CD1 3.87Å; L18-I22 WeakPolarHBondContact O-CG1 3.31Å; L18-I22 PolarHBondContact O-N 2.75Å; Y19-I22 PolarHBondContact O-N 2.89Å; I22-R24 VanDerWaalsContact C-N 3.28Å; I22-R24 PolarHBondContact O-N 3.34Å; I22-E25 PolarHBondContact O-N 3.48Å; I22-V26 HydrophobicContact CG2-CG2 4.17Å; I22-V26 WeakPolarHBondContact O-CB 3.4Å; I22-V26 VanDerWaalsContact O-CG2 3.26Å; I22-V26 WeakPolarHBondContact O-CG2 3.27Å; I22-V26 PolarHBondContact O-N 3.06Å
23	R	94.7	Very high	90	Very high	145 Å²	145	123.4 Å²	123.4	55%	0.547	57%	0.57	S	S	.	*	H	α-helix	trans	-56.2	-42.5	176.6	178.4	176.3	173.1	177.9	0.1	112.2	Y19 R21 E27	Y19-R23 VanDerWaalsContact O-CB 3.25Å; Y19-R23 WeakPolarHBondContact O-CB 3.45Å; Y19-R23 PolarHBondContact O-N 2.94Å; R21-R23 VanDerWaalsContact C-N 3.31Å; R21-R23 PolarHBondContact O-N 3.47Å; R23-E27 HydrophobicContact CG-CG 4.36Å; R23-E27 IonicContact CZ-OE1 3.76Å; R23-E27 IonicContact NE-OE1 2.75Å; R23-E27 PolarHBondContact NE-OE1 2.82Å; R23-E27 IonicContact NH2-OE1 3.3Å; R23-E27 PolarHBondContact NH2-OE1 2.8Å; R23-E27 VanDerWaalsContact O-CB 3.32Å; R23-E27 WeakPolarHBondContact O-CB 3.32Å; R23-E27 VanDerWaalsContact O-CG 3.27Å; R23-E27 WeakPolarHBondContact O-CG 3.46Å; R23-E27 PolarHBondContact O-N 2.99Å
24	R	94.5	Very high	89	Confident	149 Å²	149	123 Å²	123	56%	0.562	58%	0.582	S	S	*	*	H	α-helix	trans	-68.9	-40.9	-179.5	-165.3	-171.4	-54.1	137.3	5.9	112.2	K20 R21 I22 E27 Q28	K20-R24 WeakPolarHBondContact O-CB 3.29Å; K20-R24 PolarHBondContact O-N 2.89Å; K20-R24 VanDerWaalsContact O-N 3.17Å; R21-R24 WeakPolarHBondContact O-CB 3.26Å; R21-R24 PolarHBondContact O-N 3.25Å; I22-R24 VanDerWaalsContact C-N 3.28Å; I22-R24 PolarHBondContact O-N 3.34Å; R24-E27 PolarHBondContact O-N 2.81Å; R24-Q28 WeakPolarHBondContact O-CB 3.43Å; R24-Q28 PolarHBondContact O-N 2.86Å
25	E	92.8	Very high	88.2	Confident	102 Å²	102	126.2 Å²	126.2	48%	0.477	60%	0.596	S	S	.	*	H	α-helix	trans	-64	-45.9	176	-74.1	170.8	-169.9	0	0	110.6	R21 I22 Q28 E29	R21-E25 WeakPolarHBondContact CG-OE1 3.42Å; R21-E25 PolarHBondContact O-N 3.3Å; I22-E25 PolarHBondContact O-N 3.48Å; E25-Q28 PolarHBondContact O-N 3.01Å; E25-E29 PolarHBondContact O-N 3.19Å
26	V	91.8	Very high	87.7	Confident	63 Å²	63	127.5 Å²	127.5	38%	0.382	61%	0.61	S	S	.	*	H	α-helix	trans	-61.4	-47.7	174.5	172.9	0	0	0	0	110.9	I22 Q28 E29 F30	I22-V26 HydrophobicContact CG2-CG2 4.17Å; I22-V26 WeakPolarHBondContact O-CB 3.4Å; I22-V26 VanDerWaalsContact O-CG2 3.26Å; I22-V26 WeakPolarHBondContact O-CG2 3.27Å; I22-V26 PolarHBondContact O-N 3.06Å; V26-Q28 VanDerWaalsContact C-N 3.27Å; V26-Q28 PolarHBondContact O-N 3.17Å; V26-E29 PolarHBondContact O-N 2.9Å; V26-F30 HydrophobicContact CG1-CD2 3.56Å; V26-F30 HydrophobicContact CG1-CE2 3.76Å; V26-F30 WeakPolarHBondContact O-CB 3.24Å; V26-F30 VanDerWaalsContact O-CD2 3.29Å; V26-F30 WeakPolarHBondContact O-CD2 3.37Å; V26-F30 PolarHBondContact O-N 3.32Å
27	E	91.2	Very high	87.2	Confident	91 Å²	91	127.8 Å²	127.8	43%	0.425	62%	0.616	S	S	.	*	H	α-helix	trans	-59.3	-37.6	176.2	-77.8	172.7	176.7	0	0	111.6	R23 R24 M31	R23-E27 HydrophobicContact CG-CG 4.36Å; R23-E27 IonicContact CZ-OE1 3.76Å; R23-E27 IonicContact NE-OE1 2.75Å; R23-E27 PolarHBondContact NE-OE1 2.82Å; R23-E27 IonicContact NH2-OE1 3.3Å; R23-E27 PolarHBondContact NH2-OE1 2.8Å; R23-E27 VanDerWaalsContact O-CB 3.32Å; R23-E27 WeakPolarHBondContact O-CB 3.32Å; R23-E27 VanDerWaalsContact O-CG 3.27Å; R23-E27 WeakPolarHBondContact O-CG 3.46Å; R23-E27 PolarHBondContact O-N 2.99Å; R24-E27 PolarHBondContact O-N 2.81Å; E27-M31 WeakPolarHBondContact O-CB 3.47Å; E27-M31 VanDerWaalsContact O-CG 3.24Å; E27-M31 WeakPolarHBondContact O-CG 3.44Å; E27-M31 PolarHBondContact O-N 2.92Å
28	Q	88.3	Confident	86.9	Confident	137 Å²	137	126.5 Å²	126.5	64%	0.64	61%	0.613	S	S	*	*	H	α-helix	trans	-69.3	-37.4	175.2	-86.5	-179	-22.4	0	0	113.6	R24 E25 V26	R24-Q28 WeakPolarHBondContact O-CB 3.43Å; R24-Q28 PolarHBondContact O-N 2.86Å; E25-Q28 PolarHBondContact O-N 3.01Å; V26-Q28 VanDerWaalsContact C-N 3.27Å; V26-Q28 PolarHBondContact O-N 3.17Å
29	E	85.6	Confident	86.7	Confident	157 Å²	157	132 Å²	132	73%	0.734	63%	0.629	S	S	*	*	H	α-helix	trans	-69.2	-39.4	174.3	-74.4	-173.2	167.9	0	0	111.9	E25 V26	E25-E29 PolarHBondContact O-N 3.19Å; V26-E29 PolarHBondContact O-N 2.9Å
30	F	82.7	Confident	86.4	Confident	173 Å²	173	131.4 Å²	131.4	76%	0.759	63%	0.625	S	S	*	*	H	α-helix	trans	-78.5	-21.4	178	-85.3	-86.2	0	0	0	113.6	V26 A32	V26-F30 HydrophobicContact CG1-CD2 3.56Å; V26-F30 HydrophobicContact CG1-CE2 3.76Å; V26-F30 WeakPolarHBondContact O-CB 3.24Å; V26-F30 VanDerWaalsContact O-CD2 3.29Å; V26-F30 WeakPolarHBondContact O-CD2 3.37Å; V26-F30 PolarHBondContact O-N 3.32Å; F30-A32 PolarHBondContact O-N 3.2Å
31	M	78.1	Confident	86.2	Confident	155 Å²	155	128.7 Å²	128.7	76%	0.764	62%	0.622	S	S	*	*	S	Bend	trans	-70.1	66.8	157.1	-72.3	-162.3	107.9	0	0	108.3	E27 K33	E27-M31 WeakPolarHBondContact O-CB 3.47Å; E27-M31 VanDerWaalsContact O-CG 3.24Å; E27-M31 WeakPolarHBondContact O-CG 3.44Å; E27-M31 PolarHBondContact O-N 2.92Å; M31-K33 PolarHBondContact O-N 2.6Å
32	A	65	Low	85.9	Confident	71 Å²	71	126 Å²	126	59%	0.587	62%	0.623	S	S	*	*			trans	-45.3	136.6	165.5	0	0	0	0	0	107.3	F30 S34	F30-A32 PolarHBondContact O-N 3.2Å; A32-S34 PolarHBondContact O-N 3.31Å
33	K	70.2	Confident	85.7	Confident	208 Å²	208	126.6 Å²	126.6	90%	0.904	63%	0.63	S	S	*	*			trans	-56.4	81.1	171.6	-75.4	174.2	178.9	173.3	0	107.9	M31 E35	M31-K33 PolarHBondContact O-N 2.6Å; K33-E35 PolarHBondContact O-N 3.11Å
34	S	70.8	Confident	85.3	Confident	106 Å²	106	126.2 Å²	126.2	74%	0.741	63%	0.632	S	S	*	*			trans	-70.9	106.6	-179.9	58	0	0	0	0	104.3	A32	A32-S34 PolarHBondContact O-N 3.31Å
35	E	77.9	Confident	85	Confident	170 Å²	170	122.6 Å²	122.6	79%	0.794	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-53.5	137.1	167.6	-66.2	-172.6	171.2	0	0	107.6	K33 V37	K33-E35 PolarHBondContact O-N 3.11Å; E35-V37 PolarHBondContact O-N 2.99Å; E35-V37 VanDerWaalsContact O-N 3.11Å
36	P	83.2	Confident	84.8	Confident	124 Å²	124	122.6 Å²	122.6	81%	0.805	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-56.3	124.4	179.2	23	-31.9	0	0	0	108.7	D38	P36-D38 PolarHBondContact O-N 3.21Å
37	V	86	Confident	84.5	Confident	100 Å²	100	127 Å²	127	61%	0.606	64%	0.644	S	S	*	*	P	Polyproline II helix	trans	-63.9	120.9	179.9	178.7	0	0	0	0	108.6	E35 Y39	E35-V37 PolarHBondContact O-N 2.99Å; E35-V37 VanDerWaalsContact O-N 3.11Å; V37-Y39 HydrophobicContact CB-CE2 4.04Å; V37-Y39 HydrophobicContact CG1-CD1 4.44Å; V37-Y39 HydrophobicContact CG1-CE1 4.06Å; V37-Y39 HydrophobicContact CG1-CE2 4.17Å; V37-Y39 VanDerWaalsContact O-CD2 3.25Å; V37-Y39 WeakPolarHBondContact O-CD2 3.26Å; V37-Y39 WeakPolarHBondContact O-CE2 3.2Å; V37-Y39 PolarHBondContact O-N 2.79Å
38	D	89.2	Confident	83.8	Confident	86 Å²	86	127.3 Å²	127.3	46%	0.46	65%	0.646	S	S	.	*			trans	-79.4	113.8	172.8	-161.9	-14.1	0	0	0	109.8	P36 R40	P36-D38 PolarHBondContact O-N 3.21Å; D38-R40 VanDerWaalsContact C-N 3.32Å; D38-R40 WeakPolarHBondContact OD1-CB 3.43Å; D38-R40 VanDerWaalsContact OD1-CG 3.26Å; D38-R40 WeakPolarHBondContact OD1-CG 3.25Å; D38-R40 IonicContact OD1-CZ 3.08Å; D38-R40 PolarHBondContact OD1-N 3.29Å; D38-R40 IonicContact OD1-NE 2.8Å; D38-R40 PolarHBondContact OD1-NE 2.91Å; D38-R40 IonicContact OD1-NH2 2.93Å; D38-R40 IonicContact OD2-CZ 3.35Å; D38-R40 VanDerWaalsContact OD2-CZ 3.3Å; D38-R40 IonicContact OD2-NE 3.69Å; D38-R40 PolarHBondContact OD2-NE 3.41Å; D38-R40 VanDerWaalsContact OD2-NE 3.08Å; D38-R40 IonicContact OD2-NH2 3.18Å; D38-R40 PolarHBondContact OD2-NH2 2.9Å
39	Y	93.1	Very high	82.8	Confident	207 Å²	207	129.9 Å²	129.9	81%	0.812	66%	0.655	S	S	*	*			trans	-88.8	1.5	177.2	-65.1	-81.1	0	0	0	113	V37	V37-Y39 HydrophobicContact CB-CE2 4.04Å; V37-Y39 HydrophobicContact CG1-CD1 4.44Å; V37-Y39 HydrophobicContact CG1-CE1 4.06Å; V37-Y39 HydrophobicContact CG1-CE2 4.17Å; V37-Y39 VanDerWaalsContact O-CD2 3.25Å; V37-Y39 WeakPolarHBondContact O-CD2 3.26Å; V37-Y39 WeakPolarHBondContact O-CE2 3.2Å; V37-Y39 PolarHBondContact O-N 2.79Å
40	R	90.2	Very high	82	Confident	152 Å²	152	129.6 Å²	129.6	57%	0.574	66%	0.658	S	S	*	*			trans	-72.7	134.3	176.8	-66.7	174.9	-78.4	-176.7	-1	109.4	D38 V45	D38-R40 VanDerWaalsContact C-N 3.32Å; D38-R40 WeakPolarHBondContact OD1-CB 3.43Å; D38-R40 VanDerWaalsContact OD1-CG 3.26Å; D38-R40 WeakPolarHBondContact OD1-CG 3.25Å; D38-R40 IonicContact OD1-CZ 3.08Å; D38-R40 PolarHBondContact OD1-N 3.29Å; D38-R40 IonicContact OD1-NE 2.8Å; D38-R40 PolarHBondContact OD1-NE 2.91Å; D38-R40 IonicContact OD1-NH2 2.93Å; D38-R40 IonicContact OD2-CZ 3.35Å; D38-R40 VanDerWaalsContact OD2-CZ 3.3Å; D38-R40 IonicContact OD2-NE 3.69Å; D38-R40 PolarHBondContact OD2-NE 3.41Å; D38-R40 VanDerWaalsContact OD2-NE 3.08Å; D38-R40 IonicContact OD2-NH2 3.18Å; D38-R40 PolarHBondContact OD2-NH2 2.9Å; R40-V45 HydrophobicContact CB-CG2 3.88Å
41	S	92	Very high	81.3	Confident	67 Å²	67	127.8 Å²	127.8	47%	0.469	66%	0.661	S	S	.	*			trans	-68.5	153.7	171.3	63.4	0	0	0	0	110.3	T43 K44 V45	S41-T43 PolarHBondContact O-N 3.17Å; S41-K44 CarbonylContact O-C 3.29Å; S41-K44 VanDerWaalsContact O-C 3.29Å; S41-K44 VanDerWaalsContact O-CA 3.28Å; S41-K44 WeakPolarHBondContact O-CA 3.08Å; S41-K44 PolarHBondContact O-N 2.8Å; S41-K44 PolarHBondContact OG-N 2.98Å; S41-V45 PolarHBondContact O-N 3.25Å
42	V	91.5	Very high	81.1	Confident	101 Å²	101	125.5 Å²	125.5	61%	0.612	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.7	-39	172.3	-179.5	0	0	0	0	110.8	K44 V45 D46	V42-K44 VanDerWaalsContact C-N 3.27Å; V42-K44 PolarHBondContact O-N 2.86Å; V42-V45 PolarHBondContact O-N 3.41Å; V42-D46 WeakPolarHBondContact CG1-OD2 3.28Å; V42-D46 PolarHBondContact O-N 3.21Å
43	T	90	Very high	81.4	Confident	94 Å²	94	133.8 Å²	133.8	58%	0.577	67%	0.672	S	S	*	*	H	α-helix	trans	-61.1	-35.4	174.5	-40.4	0	0	0	0	112.9	S41 V45 F47 H48	S41-T43 PolarHBondContact O-N 3.17Å; T43-V45 VanDerWaalsContact C-N 3.35Å; T43-F47 HydrophobicContact CG2-CD2 4.08Å; T43-F47 WeakPolarHBondContact O-CA 3.38Å; T43-F47 PolarHBondContact O-N 2.92Å; T43-H48 PolarHBondContact O-CE1 3.08Å; T43-H48 PolarHBondContact O-ND1 3.03Å
44	K	87.6	Confident	81.4	Confident	137 Å²	137	130.8 Å²	130.8	60%	0.596	67%	0.665	S	S	*	*	H	α-helix	trans	-87.8	7.1	174.6	-171.3	165.7	179	-176.4	0	113.8	S41 V42 H48	S41-K44 CarbonylContact O-C 3.29Å; S41-K44 VanDerWaalsContact O-C 3.29Å; S41-K44 VanDerWaalsContact O-CA 3.28Å; S41-K44 WeakPolarHBondContact O-CA 3.08Å; S41-K44 PolarHBondContact O-N 2.8Å; S41-K44 PolarHBondContact OG-N 2.98Å; V42-K44 VanDerWaalsContact C-N 3.27Å; V42-K44 PolarHBondContact O-N 2.86Å; K44-H48 WeakPolarHBondContact CA-CE1 3.24Å; K44-H48 PolarHBondContact O-CE1 3.44Å; K44-H48 PolarHBondContact O-NE2 3.21Å
45	V	88.8	Confident	81.8	Confident	74 Å²	74	130.5 Å²	130.5	45%	0.448	66%	0.663	S	S	.	*	H	α-helix	trans	-110.9	-32.2	163.9	-178.5	0	0	0	0	113.1	R40 S41 V42 T43 H48	R40-V45 HydrophobicContact CB-CG2 3.88Å; S41-V45 PolarHBondContact O-N 3.25Å; V42-V45 PolarHBondContact O-N 3.41Å; T43-V45 VanDerWaalsContact C-N 3.35Å; V45-H48 WeakPolarHBondContact CA-CE1 3.09Å; V45-H48 WeakPolarHBondContact CA-NE2 3.19Å; V45-H48 PolarHBondContact N-CE1 3Å; V45-H48 PolarHBondContact N-NE2 3.41Å; V45-H48 PolarHBondContact O-NE2 3.07Å
46	D	87.8	Confident	81.8	Confident	102 Å²	102	128.3 Å²	128.3	55%	0.545	66%	0.663	S	S	.	*	H	α-helix	trans	-106.4	-29.5	-173.5	-56.2	-24	0	0	0	113.2	V42 H48	V42-D46 WeakPolarHBondContact CG1-OD2 3.28Å; V42-D46 PolarHBondContact O-N 3.21Å; D46-H48 PolarHBondContact N-CE1 3.43Å; D46-H48 PolarHBondContact O-N 2.84Å
47	F	85.9	Confident	81.4	Confident	154 Å²	154	133 Å²	133	68%	0.675	67%	0.665	S	S	*	*	S	Bend	trans	-75.4	-0.8	-172.9	42.1	-165.9	0	0	0	118.5	T43	T43-F47 HydrophobicContact CG2-CD2 4.08Å; T43-F47 WeakPolarHBondContact O-CA 3.38Å; T43-F47 PolarHBondContact O-N 2.92Å
48	H	75.5	Confident	81.1	Confident	99 Å²	99	133.3 Å²	133.3	46%	0.458	67%	0.669	S	S	.	*			trans	-111.5	75.6	-173.4	8.9	-53.7	0	0	0	105.4	T43 K44 V45 D46 D50	T43-H48 PolarHBondContact O-CE1 3.08Å; T43-H48 PolarHBondContact O-ND1 3.03Å; K44-H48 WeakPolarHBondContact CA-CE1 3.24Å; K44-H48 PolarHBondContact O-CE1 3.44Å; K44-H48 PolarHBondContact O-NE2 3.21Å; V45-H48 WeakPolarHBondContact CA-CE1 3.09Å; V45-H48 WeakPolarHBondContact CA-NE2 3.19Å; V45-H48 PolarHBondContact N-CE1 3Å; V45-H48 PolarHBondContact N-NE2 3.41Å; V45-H48 PolarHBondContact O-NE2 3.07Å; D46-H48 PolarHBondContact N-CE1 3.43Å; D46-H48 PolarHBondContact O-N 2.84Å; H48-D50 PolarHBondContact O-N 2.84Å
49	K	67.6	Low	80.7	Confident	190 Å²	190	137.8 Å²	137.8	83%	0.826	69%	0.687	S	S	*	*			trans	-55	124.6	153.5	-75.2	-176.2	175.6	-177.2	0	106.2	V51	K49-V51 PolarHBondContact O-N 2.74Å
50	D	69.4	Low	79.7	Confident	151 Å²	151	133.4 Å²	133.4	81%	0.807	68%	0.684	S	S	*	*			trans	-42.9	114.3	167.9	-66.9	-50	0	0	0	107.1	H48 V52	H48-D50 PolarHBondContact O-N 2.84Å; D50-V52 VanDerWaalsContact C-N 3.27Å; D50-V52 PolarHBondContact O-N 2.93Å
51	V	68.5	Low	78.9	Confident	135 Å²	135	132.9 Å²	132.9	82%	0.818	69%	0.69	S	S	*	*			trans	-57	104	177.9	178.7	0	0	0	0	104.2	K49 R53	K49-V51 PolarHBondContact O-N 2.74Å; V51-R53 PolarHBondContact O-N 2.93Å
52	V	72.6	Confident	78.2	Confident	108 Å²	108	138.2 Å²	138.2	66%	0.655	71%	0.712	S	S	*	*			trans	-49.9	119.1	176.8	176.1	0	0	0	0	103.9	D50 L54	D50-V52 VanDerWaalsContact C-N 3.27Å; D50-V52 PolarHBondContact O-N 2.93Å; V52-L54 HydrophobicContact CG1-CD2 4.49Å; V52-L54 PolarHBondContact O-N 2.65Å
53	R	70.7	Confident	77.3	Confident	244 Å²	244	138.2 Å²	138.2	92%	0.921	71%	0.705	S	S	*	*			trans	-62	91	176.3	-73.2	-173.6	177	-170.3	0.1	105.6	V51 S55	V51-R53 PolarHBondContact O-N 2.93Å; R53-S55 PolarHBondContact O-N 3.1Å
54	L	71.8	Confident	76.5	Confident	146 Å²	146	138.6 Å²	138.6	76%	0.764	70%	0.7	S	S	*	*			trans	-58.9	133.5	177.4	-64.7	176.6	0	0	0	105.1	V52	V52-L54 HydrophobicContact CG1-CD2 4.49Å; V52-L54 PolarHBondContact O-N 2.65Å
55	S	77.6	Confident	75.7	Confident	100 Å²	100	140.2 Å²	140.2	70%	0.699	71%	0.712	S	S	*	*			trans	-46.5	145.3	170	50.6	0	0	0	0	109	R53 R57	R53-S55 PolarHBondContact O-N 3.1Å; S55-R57 PolarHBondContact O-N 3.32Å; S55-R57 VanDerWaalsContact O-N 3.1Å
56	P	79.2	Confident	74.8	Confident	124 Å²	124	142.9 Å²	142.9	81%	0.805	73%	0.728	S	S	*	*			trans	-44.7	125.7	177.1	-26.9	34	0	0	0	109.6
57	R	75.1	Confident	74.1	Confident	221 Å²	221	145.9 Å²	145.9	83%	0.834	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-55.7	132.7	177.1	-167.1	-175.4	-141.9	-149.4	3.5	106.8	S55 E59	S55-R57 PolarHBondContact O-N 3.32Å; S55-R57 VanDerWaalsContact O-N 3.1Å; R57-E59 PolarHBondContact O-N 2.87Å
58	P	79.9	Confident	73.8	Confident	107 Å²	107	143.1 Å²	143.1	70%	0.695	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-53.6	145.7	170.7	22.1	-32.1	0	0	0	109.1
59	E	80.3	Confident	73.9	Confident	181 Å²	181	142 Å²	142	85%	0.846	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-53.3	136.4	-179.2	-67.8	-165.4	175.5	0	0	109.9	R57 M61	R57-E59 PolarHBondContact O-N 2.87Å; E59-M61 PolarHBondContact O-N 2.99Å
60	P	72.3	Confident	74.6	Confident	114 Å²	114	137 Å²	137	74%	0.74	70%	0.703	S	S	*	*			trans	-60.8	112.1	178.1	24.7	-31.3	0	0	0	108.6	L62	P60-L62 PolarHBondContact O-N 3.49Å
61	M	73.1	Confident	75.4	Confident	142 Å²	142	135.3 Å²	135.3	70%	0.7	70%	0.698	S	S	*	*			trans	-62.2	129.9	167.2	-91.8	179.8	64	0	0	108.3	E59 H63	E59-M61 PolarHBondContact O-N 2.99Å; M61-H63 VanDerWaalsContact C-N 3.32Å; M61-H63 PolarHBondContact O-N 2.93Å
62	L	76.2	Confident	76.3	Confident	178 Å²	178	131.5 Å²	131.5	93%	0.932	68%	0.675	S	S	*	*			trans	-69.2	92.7	171.6	-109.4	147.4	0	0	0	108.1	P60	P60-L62 PolarHBondContact O-N 3.49Å
63	H	72.7	Confident	77.2	Confident	101 Å²	101	131.9 Å²	131.9	47%	0.468	67%	0.668	S	S	.	*			trans	-74.2	124.7	174.4	-69	-49.4	0	0	0	109.9	M61 M65 E68	M61-H63 VanDerWaalsContact C-N 3.32Å; M61-H63 PolarHBondContact O-N 2.93Å; H63-M65 VanDerWaalsContact C-N 3.29Å; H63-M65 PolarHBondContact O-N 3.36Å; H63-E68 VanDerWaalsContact CA-OE2 3.3Å; H63-E68 WeakPolarHBondContact CA-OE2 3.3Å; H63-E68 WeakPolarHBondContact CB-OE2 3.18Å; H63-E68 IonicContact CE1-OE1 3.74Å; H63-E68 IonicContact CG-OE2 3.31Å; H63-E68 IonicContact ND1-OE1 3.58Å; H63-E68 PolarHBondContact ND1-OE1 2.91Å; H63-E68 IonicContact ND1-OE2 3.58Å; H63-E68 PolarHBondContact ND1-OE2 3.25Å
64	E	74	Confident	77.9	Confident	102 Å²	102	127.2 Å²	127.2	48%	0.477	65%	0.651	S	S	.	*			trans	-80	83.4	173.8	-164.4	177.6	-171.6	0	0	108	V66 R67 E68	E64-V66 PolarHBondContact O-N 3.34Å; E64-R67 HydrophobicContact CG-CB 4.33Å; E64-R67 HydrophobicContact CG-CG 4.4Å; E64-R67 PolarHBondContact O-N 3.08Å; E64-R67 WeakPolarHBondContact OE1-CD 3.35Å; E64-R67 IonicContact OE1-CZ 3.34Å; E64-R67 IonicContact OE1-NE 2.9Å; E64-R67 IonicContact OE1-NH1 3.01Å; E64-R67 PolarHBondContact OE1-NH1 2.9Å; E64-R67 WeakPolarHBondContact OE2-CD 3.44Å; E64-R67 IonicContact OE2-NH1 3.79Å; E64-E68 WeakPolarHBondContact O-CB 3.4Å; E64-E68 PolarHBondContact O-N 2.88Å
65	M	69.7	Low	78.5	Confident	171 Å²	171	121.7 Å²	121.7	84%	0.842	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53	-21.8	-172.2	-60.8	-133.3	78.4	0	0	114.7	H63	H63-M65 VanDerWaalsContact C-N 3.29Å; H63-M65 PolarHBondContact O-N 3.36Å
66	V	71.4	Confident	79	Confident	130 Å²	130	122.6 Å²	122.6	79%	0.788	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	-32.3	-179.1	-178.5	0	0	0	0	112.2	E64	E64-V66 PolarHBondContact O-N 3.34Å
67	R	72.8	Confident	79.4	Confident	165 Å²	165	119.4 Å²	119.4	62%	0.623	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.8	-26.9	-172.3	-64.9	-170.3	179.7	157.6	-7.2	113.3	E64 Q69	E64-R67 HydrophobicContact CG-CB 4.33Å; E64-R67 HydrophobicContact CG-CG 4.4Å; E64-R67 PolarHBondContact O-N 3.08Å; E64-R67 WeakPolarHBondContact OE1-CD 3.35Å; E64-R67 IonicContact OE1-CZ 3.34Å; E64-R67 IonicContact OE1-NE 2.9Å; E64-R67 IonicContact OE1-NH1 3.01Å; E64-R67 PolarHBondContact OE1-NH1 2.9Å; E64-R67 WeakPolarHBondContact OE2-CD 3.44Å; E64-R67 IonicContact OE2-NH1 3.79Å; R67-Q69 PolarHBondContact O-N 3.42Å
68	E	78.4	Confident	79.7	Confident	97 Å²	97	113.5 Å²	113.5	45%	0.453	57%	0.568	S	S	.	*	P	Polyproline II helix	trans	-72.1	120.6	-178.1	-161.6	167.2	178.5	0	0	110.1	H63 E64	H63-E68 VanDerWaalsContact CA-OE2 3.3Å; H63-E68 WeakPolarHBondContact CA-OE2 3.3Å; H63-E68 WeakPolarHBondContact CB-OE2 3.18Å; H63-E68 IonicContact CE1-OE1 3.74Å; H63-E68 IonicContact CG-OE2 3.31Å; H63-E68 IonicContact ND1-OE1 3.58Å; H63-E68 PolarHBondContact ND1-OE1 2.91Å; H63-E68 IonicContact ND1-OE2 3.58Å; H63-E68 PolarHBondContact ND1-OE2 3.25Å; E64-E68 WeakPolarHBondContact O-CB 3.4Å; E64-E68 PolarHBondContact O-N 2.88Å
69	Q	78.8	Confident	79.8	Confident	75 Å²	75	113.5 Å²	113.5	35%	0.35	56%	0.562	S	S	.	*	P	Polyproline II helix	trans	-86.9	139.3	174.2	-68.4	-62.4	-69.2	0	0	109.3	R67 V71 T92	R67-Q69 PolarHBondContact O-N 3.42Å; Q69-V71 PolarHBondContact O-N 3.29Å; Q69-T92 WeakPolarHBondContact CG-O 3.36Å
70	P	82.8	Confident	80	Confident	84 Å²	84	112.4 Å²	112.4	55%	0.545	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-64.1	135.7	178.3	27.5	-34.4	0	0	0	110.3	T72 T75	P70-T72 HydrophobicContact CB-CG2 4.24Å; P70-T72 HydrophobicContact CG-CG2 4.4Å; P70-T72 PolarHBondContact O-N 3.2Å; P70-T75 PolarHBondContact O-OG1 3.19Å
71	V	85.2	Confident	80.2	Confident	116 Å²	116	109.2 Å²	109.2	70%	0.703	53%	0.531	S	S	*	.			trans	-74.2	110.9	171.5	-176	0	0	0	0	108.1	Q69 E76	Q69-V71 PolarHBondContact O-N 3.29Å; V71-E76 HydrophobicContact CG1-CG 3.93Å; V71-E76 VanDerWaalsContact CG1-OE1 3.24Å; V71-E76 WeakPolarHBondContact CG1-OE1 3.49Å
72	T	88.5	Confident	80.5	Confident	56 Å²	56	111.3 Å²	111.3	34%	0.344	54%	0.538	S	S	.	.			trans	-129.6	162.8	176.7	65.5	0	0	0	0	109.3	P70 W74 T75 E76	P70-T72 HydrophobicContact CB-CG2 4.24Å; P70-T72 HydrophobicContact CG-CG2 4.4Å; P70-T72 PolarHBondContact O-N 3.2Å; T72-W74 PolarHBondContact O-N 2.96Å; T72-W74 VanDerWaalsContact O-N 3.13Å; T72-T75 PolarHBondContact N-OG1 2.85Å; T72-T75 PolarHBondContact O-N 3.43Å; T72-T75 VanDerWaalsContact O-N 3.13Å; T72-T75 PolarHBondContact O-OG1 3.26Å; T72-T75 PolarHBondContact OG1-N 3.35Å; T72-T75 PolarHBondContact OG1-OG1 2.94Å; T72-E76 WeakPolarHBondContact O-CG 3.48Å; T72-E76 PolarHBondContact O-N 2.89Å; T72-E76 VanDerWaalsContact O-N 3.09Å
73	F	89.6	Confident	80.5	Confident	116 Å²	116	106.9 Å²	106.9	51%	0.509	54%	0.536	S	S	.	.	H	α-helix	trans	-47.9	-42.8	172.6	176.5	-104.5	0	0	0	112.7	E76 H77 M81	F73-E76 PolarHBondContact O-N 2.93Å; F73-H77 AromaticContact CD2-CE1 3.65Å; F73-H77 AromaticContact CD2-ND1 3.49Å; F73-H77 WeakPolarHBondContact CD2-ND1 3.38Å; F73-H77 AromaticContact CE2-CE1 3.63Å; F73-H77 AromaticContact CE2-CG 3.99Å; F73-H77 AromaticContact CE2-ND1 3.58Å; F73-H77 WeakPolarHBondContact O-CB 3.46Å; F73-H77 PolarHBondContact O-N 2.91Å; F73-H77 PolarHBondContact O-ND1 3.18Å; F73-M81 HydrophobicContact CD1-CE 4Å; F73-M81 HydrophobicContact CE1-CE 3.26Å; F73-M81 HydrophobicContact CZ-CE 3.81Å
74	W	86.6	Confident	80.5	Confident	146 Å²	146	105.4 Å²	105.4	55%	0.553	53%	0.531	S	S	*	.	H	α-helix	trans	-68.5	-43.7	-179	-58.7	104.8	0	0	0	112.9	T72 E76 H77 R78 M81 F95	T72-W74 PolarHBondContact O-N 2.96Å; T72-W74 VanDerWaalsContact O-N 3.13Å; W74-E76 VanDerWaalsContact C-N 3.26Å; W74-E76 PolarHBondContact O-N 3.31Å; W74-H77 PolarHBondContact O-N 2.96Å; W74-R78 PolarHBondContact O-N 3.02Å; W74-M81 HydrophobicContact CE3-CE 3.59Å; W74-M81 HydrophobicContact CE3-SD 3.34Å; W74-M81 HydrophobicContact CH2-CE 4.35Å; W74-M81 HydrophobicContact CZ3-CE 3.5Å; W74-M81 VanDerWaalsContact CZ3-CE 3.5Å; W74-M81 HydrophobicContact CZ3-SD 3.38Å; W74-M81 WeakPolarHBondContact CZ3-SD 3.39Å; W74-F95 HydrophobicContact CB-CE1 4.49Å; W74-F95 HydrophobicContact CB-CE2 3.66Å; W74-F95 HydrophobicContact CB-CZ 3.53Å; W74-F95 WeakPolarHBondContact O-CZ 3.46Å
75	T	85.1	Confident	80.4	Confident	29 Å²	29	104.7 Å²	104.7	18%	0.178	53%	0.534	C	S	.	.	H	α-helix	trans	-65.9	-32	179	51	0	0	0	0	112.1	P70 T72 P94 F95	P70-T75 PolarHBondContact O-OG1 3.19Å; T72-T75 PolarHBondContact N-OG1 2.85Å; T72-T75 PolarHBondContact O-N 3.43Å; T72-T75 VanDerWaalsContact O-N 3.13Å; T72-T75 PolarHBondContact O-OG1 3.26Å; T72-T75 PolarHBondContact OG1-N 3.35Å; T72-T75 PolarHBondContact OG1-OG1 2.94Å; T75-P94 HydrophobicContact CG2-CG 4.03Å; T75-F95 HydrophobicContact CG2-CE2 3.98Å
76	E	88.1	Confident	80.4	Confident	120 Å²	120	104.5 Å²	104.5	56%	0.561	53%	0.531	S	S	*	.	H	α-helix	trans	-75.7	-34.6	176.9	-69.5	-178.5	155.4	0	0	113.1	V71 T72 F73 W74	V71-E76 HydrophobicContact CG1-CG 3.93Å; V71-E76 VanDerWaalsContact CG1-OE1 3.24Å; V71-E76 WeakPolarHBondContact CG1-OE1 3.49Å; T72-E76 WeakPolarHBondContact O-CG 3.48Å; T72-E76 PolarHBondContact O-N 2.89Å; T72-E76 VanDerWaalsContact O-N 3.09Å; F73-E76 PolarHBondContact O-N 2.93Å; W74-E76 VanDerWaalsContact C-N 3.26Å; W74-E76 PolarHBondContact O-N 3.31Å
77	H	87.6	Confident	80.3	Confident	57 Å²	57	102.2 Å²	102.2	26%	0.264	51%	0.509	S	S	.	.	H	α-helix	trans	-102.5	6.1	-173.3	-65.2	80.6	0	0	0	113.8	F73 W74 D79 K80 M81	F73-H77 AromaticContact CD2-CE1 3.65Å; F73-H77 AromaticContact CD2-ND1 3.49Å; F73-H77 WeakPolarHBondContact CD2-ND1 3.38Å; F73-H77 AromaticContact CE2-CE1 3.63Å; F73-H77 AromaticContact CE2-CG 3.99Å; F73-H77 AromaticContact CE2-ND1 3.58Å; F73-H77 WeakPolarHBondContact O-CB 3.46Å; F73-H77 PolarHBondContact O-N 2.91Å; F73-H77 PolarHBondContact O-ND1 3.18Å; W74-H77 PolarHBondContact O-N 2.96Å; H77-D79 PolarHBondContact O-N 3.39Å; H77-D79 VanDerWaalsContact O-N 3.09Å; H77-K80 PolarHBondContact O-N 3.35Å; H77-M81 HydrophobicContact CB-CE 3.87Å; H77-M81 HydrophobicContact CB-CG 4.35Å; H77-M81 HydrophobicContact CB-SD 4.37Å; H77-M81 WeakPolarHBondContact O-CG 3.43Å; H77-M81 PolarHBondContact O-N 3.13Å
78	R	80.6	Confident	79.9	Confident	96 Å²	96	97.3 Å²	97.3	36%	0.362	50%	0.5	S	S	.	.	G	3₁₀ helix	trans	-51.3	-38	-175.2	71.3	-175.8	-175	-170.7	-3.6	114	W74 K80 F95	W74-R78 PolarHBondContact O-N 3.02Å; R78-K80 VanDerWaalsContact C-N 3.31Å; R78-F95 HydrophobicContact CB-CZ 4.36Å
79	D	81.2	Confident	79.3	Confident	107 Å²	107	99 Å²	99	57%	0.572	52%	0.516	S	S	*	.	G	3₁₀ helix	trans	-80	-15.3	-176.5	-54.1	-47.6	0	0	0	112.3	H77 Y87	H77-D79 PolarHBondContact O-N 3.39Å; H77-D79 VanDerWaalsContact O-N 3.09Å; D79-Y87 PolarHBondContact OD1-OH 3.47Å
80	K	84.7	Confident	78.7	Confident	158 Å²	158	102.5 Å²	102.5	69%	0.687	54%	0.538	S	S	*	.	G	3₁₀ helix	trans	-102	-7	-178.5	-61.8	178.7	-176.7	172.4	0	112.9	H77 R78	H77-K80 PolarHBondContact O-N 3.35Å; R78-K80 VanDerWaalsContact C-N 3.31Å
81	M	78.1	Confident	77.8	Confident	48 Å²	48	105.6 Å²	105.6	24%	0.236	54%	0.539	C	S	.	.			trans	-97.7	123.7	-174.5	-74.6	-174.7	169.4	0	0	112.1	F73 W74 H77	F73-M81 HydrophobicContact CD1-CE 4Å; F73-M81 HydrophobicContact CE1-CE 3.26Å; F73-M81 HydrophobicContact CZ-CE 3.81Å; W74-M81 HydrophobicContact CE3-CE 3.59Å; W74-M81 HydrophobicContact CE3-SD 3.34Å; W74-M81 HydrophobicContact CH2-CE 4.35Å; W74-M81 HydrophobicContact CZ3-CE 3.5Å; W74-M81 VanDerWaalsContact CZ3-CE 3.5Å; W74-M81 HydrophobicContact CZ3-SD 3.38Å; W74-M81 WeakPolarHBondContact CZ3-SD 3.39Å; H77-M81 HydrophobicContact CB-CE 3.87Å; H77-M81 HydrophobicContact CB-CG 4.35Å; H77-M81 HydrophobicContact CB-SD 4.37Å; H77-M81 WeakPolarHBondContact O-CG 3.43Å; H77-M81 PolarHBondContact O-N 3.13Å
82	H	78.8	Confident	76.9	Confident	185 Å²	185	104.6 Å²	104.6	86%	0.856	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.6	156.2	173.3	-4.8	82.2	0	0	0	111.4	N84	H82-N84 VanDerWaalsContact C-N 3.31Å; H82-N84 PolarHBondContact O-N 2.83Å
83	G	76.2	Confident	76.2	Confident	85 Å²	85	104.8 Å²	104.8	88%	0.876	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.7	0.5	176.6	0	0	0	0	0	115.1
84	N	72.9	Confident	75.3	Confident	71 Å²	71	100.1 Å²	100.1	38%	0.38	52%	0.515	S	S	.	.	P	Polyproline II helix	trans	-75.2	137	174.2	-72.5	-17.7	0	0	0	110.9	H82	H82-N84 VanDerWaalsContact C-N 3.31Å; H82-N84 PolarHBondContact O-N 2.83Å
85	T	71.3	Confident	74.9	Confident	86 Å²	86	98 Å²	98	53%	0.528	51%	0.51	S	S	.	.	P	Polyproline II helix	trans	-62.7	141.1	169.3	51.5	0	0	0	0	109.9	Y87 N98	T85-Y87 PolarHBondContact O-N 3.06Å; T85-N98 HydrophobicContact CG2-CB 4.32Å
86	H	69.4	Low	74.5	Confident	168 Å²	168	97.7 Å²	97.7	78%	0.778	51%	0.513	S	S	*	.	P	Polyproline II helix	trans	-52.3	118.5	180	-159.9	-67	0	0	0	110.3	N98	H86-N98 PolarHBondContact O-ND2 2.96Å
87	Y	69.4	Low	73.9	Confident	82 Å²	82	103.4 Å²	103.4	32%	0.322	53%	0.529	S	S	.	.	P	Polyproline II helix	trans	-89.4	148.2	172	55	-80	0	0	0	108.5	D79 T85	D79-Y87 PolarHBondContact OD1-OH 3.47Å; T85-Y87 PolarHBondContact O-N 3.06Å
88	S	64.5	Low	73.3	Confident	62 Å²	62	104.1 Å²	104.1	43%	0.434	54%	0.535	S	S	.	.	P	Polyproline II helix	trans	-87.8	131	170	180	0	0	0	0	107.8	N90 R91	S88-N90 PolarHBondContact O-N 3.09Å; S88-N90 PolarHBondContact OG-N 3.13Å; S88-R91 PolarHBondContact O-N 2.83Å
89	T	66.2	Low	73.3	Confident	131 Å²	131	102 Å²	102	80%	0.804	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	-22.7	172.2	-41.6	0	0	0	0	112	R91	T89-R91 VanDerWaalsContact C-N 3.34Å
90	N	64.8	Low	73	Confident	150 Å²	150	99.5 Å²	99.5	80%	0.802	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84	-3.9	179.5	-62	-12.3	0	0	0	113.7	S88	S88-N90 PolarHBondContact O-N 3.09Å; S88-N90 PolarHBondContact OG-N 3.13Å
91	R	64.7	Low	72.7	Confident	149 Å²	149	101.3 Å²	101.3	56%	0.562	54%	0.54	S	S	*	.			trans	-90.7	132.7	175.5	-99.3	-172	179.3	-174.3	-0.1	110.9	S88 T89 T93 R97	S88-R91 PolarHBondContact O-N 2.83Å; T89-R91 VanDerWaalsContact C-N 3.34Å; R91-T93 PolarHBondContact O-N 3.5Å; R91-R97 PolarHBondContact NH1-O 3.3Å
92	T	66.9	Low	72.9	Confident	95 Å²	95	104.1 Å²	104.1	58%	0.583	56%	0.56	S	S	*	*	S	Bend	trans	-62.5	-26.2	175.1	-45	0	0	0	0	112.8	Q69	Q69-T92 WeakPolarHBondContact CG-O 3.36Å
93	T	73.3	Confident	73.1	Confident	60 Å²	60	97.2 Å²	97.2	37%	0.368	53%	0.531	S	S	.	.			trans	-111.4	120.4	-176.7	57.1	0	0	0	0	111.4	R91 F95	R91-T93 PolarHBondContact O-N 3.5Å; T93-F95 VanDerWaalsContact C-N 3.29Å; T93-F95 PolarHBondContact O-N 3.24Å
94	P	70.9	Confident	73.5	Confident	18 Å²	18	96.7 Å²	96.7	12%	0.117	51%	0.512	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.5	-25.9	-176.9	23.2	-30.3	0	0	0	113.4	T75	T75-P94 HydrophobicContact CG2-CG 4.03Å
95	F	78	Confident	73.9	Confident	102 Å²	102	99.6 Å²	99.6	45%	0.447	53%	0.527	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.2	35.1	-175.3	-56.2	-65.7	0	0	0	113.7	W74 T75 R78 T93	W74-F95 HydrophobicContact CB-CE1 4.49Å; W74-F95 HydrophobicContact CB-CE2 3.66Å; W74-F95 HydrophobicContact CB-CZ 3.53Å; W74-F95 WeakPolarHBondContact O-CZ 3.46Å; T75-F95 HydrophobicContact CG2-CE2 3.98Å; R78-F95 HydrophobicContact CB-CZ 4.36Å; T93-F95 VanDerWaalsContact C-N 3.29Å; T93-F95 PolarHBondContact O-N 3.24Å
96	G	76.3	Confident	74.4	Confident	22 Å²	22	98.8 Å²	98.8	23%	0.227	54%	0.535	C	S	.	.			trans	-64.7	141.1	175.7	0	0	0	0	0	112.1	N98	G96-N98 PolarHBondContact O-N 2.63Å
97	R	75.4	Confident	75	Confident	240 Å²	240	96.8 Å²	96.8	91%	0.906	53%	0.526	S	S	*	.			trans	-54.9	128.9	174.8	-64.5	-176.1	-168.1	165.2	3.8	109.9	R91	R91-R97 PolarHBondContact NH1-O 3.3Å
98	N	76.7	Confident	75.4	Confident	71 Å²	71	94.8 Å²	94.8	38%	0.38	52%	0.518	S	S	.	.			trans	-118.5	113.8	172	-175.1	-15.1	0	0	0	107.9	T85 H86 G96 A100	T85-N98 HydrophobicContact CG2-CB 4.32Å; H86-N98 PolarHBondContact O-ND2 2.96Å; G96-N98 PolarHBondContact O-N 2.63Å; N98-A100 WeakPolarHBondContact OD1-CB 3.48Å; N98-A100 PolarHBondContact OD1-N 2.94Å
99	A	79.8	Confident	75.4	Confident	51 Å²	51	98.6 Å²	98.6	42%	0.421	53%	0.533	S	S	.	.			trans	-109.2	12.3	177.9	0	0	0	0	0	112.1	F101 T102 T103	A99-F101 PolarHBondContact O-N 3.35Å; A99-T102 PolarHBondContact O-N 3.35Å; A99-T102 PolarHBondContact O-OG1 3.1Å; A99-T103 PolarHBondContact O-N 3.28Å; A99-T103 PolarHBondContact O-OG1 3.49Å
100	A	75.3	Confident	75.4	Confident	55 Å²	55	100.6 Å²	100.6	46%	0.455	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.3	-21.4	-169.7	0	0	0	0	0	114.6	N98 Y108	N98-A100 WeakPolarHBondContact OD1-CB 3.48Å; N98-A100 PolarHBondContact OD1-N 2.94Å; A100-Y108 PolarHBondContact O-OH 3.32Å
101	F	77.1	Confident	75.6	Confident	196 Å²	196	96.5 Å²	96.5	86%	0.86	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.7	-28.5	175	-178.3	-99.6	0	0	0	113.6	A99	A99-F101 PolarHBondContact O-N 3.35Å
102	T	83.2	Confident	75.7	Confident	108 Å²	108	95.6 Å²	95.6	66%	0.663	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.6	-10.7	-175.5	54.3	0	0	0	0	113.2	A99 P104	A99-T102 PolarHBondContact O-N 3.35Å; A99-T102 PolarHBondContact O-OG1 3.1Å; T102-P104 WeakPolarHBondContact O-CD 3.26Å
103	T	82.4	Confident	75.7	Confident	40 Å²	40	94.7 Å²	94.7	25%	0.245	51%	0.509	C	S	.	.	S	Bend	trans	-61.7	123.4	172.6	-60.2	0	0	0	0	109.7	A99 Q107 Y108	A99-T103 PolarHBondContact O-N 3.28Å; A99-T103 PolarHBondContact O-OG1 3.49Å; T103-Q107 HydrophobicContact CG2-CB 3.69Å; T103-Y108 HydrophobicContact CG2-CD2 4.2Å; T103-Y108 HydrophobicContact CG2-CE2 3.84Å; T103-Y108 VanDerWaalsContact O-CE2 3.26Å; T103-Y108 WeakPolarHBondContact O-CE2 3.46Å; T103-Y108 PolarHBondContact O-OH 2.98Å
104	P	85.9	Confident	75.1	Confident	74 Å²	74	95.4 Å²	95.4	48%	0.481	51%	0.514	S	S	.	.			trans	-60.8	145.9	174.7	-23.7	33.6	0	0	0	112.2	T102 G106 Q107	T102-P104 WeakPolarHBondContact O-CD 3.26Å; P104-G106 PolarHBondContact O-N 3.25Å; P104-G106 VanDerWaalsContact O-N 3.08Å; P104-Q107 WeakPolarHBondContact O-CB 3.18Å; P104-Q107 PolarHBondContact O-N 3.09Å
105	I	80.6	Confident	74.7	Confident	132 Å²	132	101 Å²	101	68%	0.677	55%	0.552	S	S	*	*	G	3₁₀ helix	trans	-56.5	-32.3	-172.7	-161	160.6	0	0	0	114.3	Q107 Y108 M113	I105-Q107 PolarHBondContact O-N 2.92Å; I105-Y108 WeakPolarHBondContact O-CD2 3.24Å; I105-Y108 PolarHBondContact O-N 3.07Å; I105-M113 HydrophobicContact CD1-CE 4.2Å; I105-M113 HydrophobicContact CD1-SD 4.25Å; I105-M113 HydrophobicContact CG1-SD 3.98Å
106	G	81.4	Confident	74.1	Confident	68 Å²	68	101.1 Å²	101.1	70%	0.701	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-71.3	-9.1	177.3	0	0	0	0	0	115.1	P104	P104-G106 PolarHBondContact O-N 3.25Å; P104-G106 VanDerWaalsContact O-N 3.08Å
107	Q	82.6	Confident	73.2	Confident	126 Å²	126	108.3 Å²	108.3	59%	0.589	58%	0.584	S	S	*	*	G	3₁₀ helix	trans	-97.8	-3.7	-178.7	-64.3	-176.1	-1.4	0	0	113.6	T103 P104 I105 L109	T103-Q107 HydrophobicContact CG2-CB 3.69Å; P104-Q107 WeakPolarHBondContact O-CB 3.18Å; P104-Q107 PolarHBondContact O-N 3.09Å; I105-Q107 PolarHBondContact O-N 2.92Å; Q107-L109 PolarHBondContact O-N 3.27Å
108	Y	77.4	Confident	72.5	Confident	40 Å²	40	102.5 Å²	102.5	16%	0.157	57%	0.567	C	S	.	*			trans	-78.5	64.6	172.2	-63.8	-99.4	0	0	0	109.6	A100 T103 I105 N110 S111 P114	A100-Y108 PolarHBondContact O-OH 3.32Å; T103-Y108 HydrophobicContact CG2-CD2 4.2Å; T103-Y108 HydrophobicContact CG2-CE2 3.84Å; T103-Y108 VanDerWaalsContact O-CE2 3.26Å; T103-Y108 WeakPolarHBondContact O-CE2 3.46Å; T103-Y108 PolarHBondContact O-OH 2.98Å; I105-Y108 WeakPolarHBondContact O-CD2 3.24Å; I105-Y108 PolarHBondContact O-N 3.07Å; Y108-N110 PolarHBondContact O-N 2.97Å; Y108-N110 VanDerWaalsContact O-N 3.1Å; Y108-S111 WeakPolarHBondContact CA-OG 3.46Å; Y108-S111 WeakPolarHBondContact CD1-OG 3.4Å; Y108-P114 HydrophobicContact CE1-CG 3.91Å
109	L	65	Low	71.6	Confident	143 Å²	143	105.8 Å²	105.8	75%	0.749	59%	0.589	S	S	*	*	S	Bend	trans	-68.1	-12.6	-166.1	-97.4	155.9	0	0	0	115.2	Q107	Q107-L109 PolarHBondContact O-N 3.27Å
110	N	67	Low	70.5	Confident	173 Å²	173	111.3 Å²	111.3	93%	0.925	60%	0.604	S	S	*	*	S	Bend	trans	-170.2	20.6	171	-79.6	-46.7	0	0	0	111.4	Y108	Y108-N110 PolarHBondContact O-N 2.97Å; Y108-N110 VanDerWaalsContact O-N 3.1Å
111	S	68.4	Low	69.7	Low	64 Å²	64	114.2 Å²	114.2	45%	0.448	62%	0.621	S	S	.	*	S	Bend	trans	-102.7	147.2	-177.3	45.5	0	0	0	0	110	Y108 M113	Y108-S111 WeakPolarHBondContact CA-OG 3.46Å; Y108-S111 WeakPolarHBondContact CD1-OG 3.4Å; S111-M113 PolarHBondContact O-N 3.06Å
112	R	66	Low	68.3	Low	129 Å²	129	120 Å²	120	49%	0.487	64%	0.637	S	S	.	*	P	Polyproline II helix	trans	-54.2	127.9	177.8	-172.1	174.9	174.5	-166.6	-2.2	110.1	E116	R112-E116 HydrophobicContact CG-CB 3.9Å; R112-E116 PolarHBondContact NE-O 2.83Å; R112-E116 PolarHBondContact NH2-O 2.68Å
113	M	66.3	Low	67.6	Low	77 Å²	77	120.7 Å²	120.7	38%	0.379	64%	0.636	S	S	.	*	P	Polyproline II helix	trans	-68.6	144.5	-179.5	-69.8	-117	-74.5	0	0	110.1	I105 S111 C115 E116	I105-M113 HydrophobicContact CD1-CE 4.2Å; I105-M113 HydrophobicContact CD1-SD 4.25Å; I105-M113 HydrophobicContact CG1-SD 3.98Å; S111-M113 PolarHBondContact O-N 3.06Å; M113-C115 PolarHBondContact O-N 3.08Å; M113-C115 VanDerWaalsContact O-N 3.11Å; M113-E116 HydrophobicContact CB-CG 4.03Å; M113-E116 PolarHBondContact N-OE2 3.08Å; M113-E116 PolarHBondContact O-N 2.6Å; M113-E116 VanDerWaalsContact O-N 3.08Å
114	P	61.9	Low	66.8	Low	75 Å²	75	124.9 Å²	124.9	49%	0.487	66%	0.657	S	S	.	*	T	Hydrogen-bonded Turn	trans	-56.3	121	167.7	-16.7	29.4	0	0	0	107.9	Y108	Y108-P114 HydrophobicContact CE1-CG 3.91Å
115	C	62.2	Low	65.7	Low	136 Å²	136	127.7 Å²	127.7	92%	0.919	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.8	-4.1	-174.6	-54.5	0	0	0	0	118.7	M113 M117	M113-C115 PolarHBondContact O-N 3.08Å; M113-C115 VanDerWaalsContact O-N 3.11Å; C115-M117 PolarHBondContact O-N 3.11Å; C115-M117 VanDerWaalsContact O-N 3.08Å
116	E	66.2	Low	64.9	Low	104 Å²	104	127.5 Å²	127.5	49%	0.486	67%	0.666	S	S	.	*			trans	-68.2	110.5	169.9	-87.4	175	162.7	0	0	110	R112 M113	R112-E116 HydrophobicContact CG-CB 3.9Å; R112-E116 PolarHBondContact NE-O 2.83Å; R112-E116 PolarHBondContact NH2-O 2.68Å; M113-E116 HydrophobicContact CB-CG 4.03Å; M113-E116 PolarHBondContact N-OE2 3.08Å; M113-E116 PolarHBondContact O-N 2.6Å; M113-E116 VanDerWaalsContact O-N 3.08Å
117	M	57.5	Low	63.8	Low	172 Å²	172	131.2 Å²	131.2	85%	0.847	66%	0.664	S	S	*	*			trans	-64.9	142	175.7	-103.6	176.7	69.3	0	0	111	C115 V119	C115-M117 PolarHBondContact O-N 3.11Å; C115-M117 VanDerWaalsContact O-N 3.08Å; M117-V119 PolarHBondContact O-N 3.07Å
118	Q	59	Low	62.6	Low	119 Å²	119	131.5 Å²	131.5	56%	0.556	67%	0.669	S	S	*	*			trans	-75.2	103.6	179.7	-129.2	166.2	15.5	0	0	106.9	F120	Q118-F120 HydrophobicContact CB-CD2 4.33Å; Q118-F120 HydrophobicContact CB-CE2 4.03Å; Q118-F120 HydrophobicContact CG-CE2 4.49Å; Q118-F120 PolarHBondContact O-N 3.45Å
119	V	58.4	Low	61.5	Low	140 Å²	140	138.1 Å²	138.1	85%	0.848	71%	0.705	S	S	*	*			trans	-74	98.3	170.8	-165.5	0	0	0	0	106.2	M117 S121	M117-V119 PolarHBondContact O-N 3.07Å; V119-S121 PolarHBondContact O-N 3.23Å
120	F	55.8	Low	61.2	Low	166 Å²	166	137.7 Å²	137.7	73%	0.728	70%	0.702	S	S	*	*			trans	-70.6	111	169.6	-78.3	-85.7	0	0	0	107.9	Q118 R122	Q118-F120 HydrophobicContact CB-CD2 4.33Å; Q118-F120 HydrophobicContact CB-CE2 4.03Å; Q118-F120 HydrophobicContact CG-CE2 4.49Å; Q118-F120 PolarHBondContact O-N 3.45Å; F120-R122 PolarHBondContact O-N 3.06Å
121	S	59.2	Low	60.8	Low	116 Å²	116	134.8 Å²	134.8	81%	0.811	68%	0.683	S	S	*	*			trans	-68.6	124.9	163.6	59.6	0	0	0	0	108.1	V119	V119-S121 PolarHBondContact O-N 3.23Å
122	R	48.2	Very low	60.1	Low	319 Å²	319	141.2 Å²	141.2	100%	1.204	71%	0.705	S	S	*	*			trans	-71	0	171	-73.7	-173.1	178.2	-167	0.2	111.4	F120	F120-R122 PolarHBondContact O-N 3.06Å

Retrieved 122 of 122 residues in 94.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).