A0A3Q0KT83_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KT83, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 82 aa.

						>A0A3Q0KT83_SCHMA|A0A3Q0KT83
MGLILADLFTVKFANRSLNKIFGRLDLYSHHIENKYKVFNENFGEEKLNNDFESVLMKKSVTMNRLPLTDTSPSKRCGTSPN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.2	Low	58.5	Low	212 Å²	212	111.7 Å²	111.7	100%	1.044	62%	0.623	S	S	*	*				0	-33	0	-67.5	-172	-175.3	0	0	113.9
2	G	54.7	Low	58.7	Low	60 Å²	60	113.9 Å²	113.9	62%	0.619	62%	0.621	S	S	*	*	H	α-helix	trans	-65.2	-38.9	-177.8	0	0	0	0	0	116.5	I4 L5	G2-I4 PolarHBondContact O-N 3.11Å; G2-L5 PolarHBondContact O-N 3.42Å
3	L	56.1	Low	58.8	Low	145 Å²	145	115.5 Å²	115.5	76%	0.759	62%	0.619	S	S	*	*	H	α-helix	trans	-63.4	-40.2	-177.9	-117.6	94.4	0	0	0	113.4	L5 A6 D7	L3-L5 VanDerWaalsContact C-N 3.28Å; L3-L5 PolarHBondContact O-N 3.18Å; L3-A6 WeakPolarHBondContact O-CB 3.44Å; L3-A6 PolarHBondContact O-N 3.48Å; L3-A6 VanDerWaalsContact O-N 3.13Å; L3-D7 PolarHBondContact O-N 2.96Å
4	I	56.8	Low	58.8	Low	124 Å²	124	110.4 Å²	110.4	64%	0.636	60%	0.6	S	S	*	*	H	α-helix	trans	-65	-32.9	-176.2	-60	172.9	0	0	0	111.5	G2 D7 L8	G2-I4 PolarHBondContact O-N 3.11Å; I4-D7 PolarHBondContact O-N 3.49Å; I4-L8 PolarHBondContact O-N 3.43Å; I4-L8 VanDerWaalsContact O-N 3.11Å
5	L	58.6	Low	58.8	Low	120 Å²	120	108.7 Å²	108.7	63%	0.628	59%	0.59	S	S	*	*	H	α-helix	trans	-70.7	-33.7	176.9	-71.9	170	0	0	0	112.2	G2 L3 L8 F9	G2-L5 PolarHBondContact O-N 3.42Å; L3-L5 VanDerWaalsContact C-N 3.28Å; L3-L5 PolarHBondContact O-N 3.18Å; L5-L8 PolarHBondContact O-N 3.47Å; L5-F9 WeakPolarHBondContact O-CB 3.46Å; L5-F9 PolarHBondContact O-N 3.14Å
6	A	59.5	Low	58.7	Low	54 Å²	54	114.1 Å²	114.1	45%	0.446	60%	0.6	S	S	.	*	H	α-helix	trans	-66	-39.8	175	0	0	0	0	0	111.4	L3 F9 T10	L3-A6 WeakPolarHBondContact O-CB 3.44Å; L3-A6 PolarHBondContact O-N 3.48Å; L3-A6 VanDerWaalsContact O-N 3.13Å; A6-F9 PolarHBondContact O-N 2.8Å; A6-T10 PolarHBondContact O-N 3.2Å; A6-T10 PolarHBondContact O-OG1 2.93Å
7	D	61.4	Low	59.2	Low	103 Å²	103	110.6 Å²	110.6	55%	0.551	59%	0.586	S	S	*	*	H	α-helix	trans	-64.4	-45.2	174.6	-76	-18.3	0	0	0	111.7	L3 I4 F9 T10 V11	L3-D7 PolarHBondContact O-N 2.96Å; I4-D7 PolarHBondContact O-N 3.49Å; D7-F9 VanDerWaalsContact C-N 3.27Å; D7-F9 PolarHBondContact O-N 2.86Å; D7-T10 WeakPolarHBondContact O-CB 3.35Å; D7-T10 PolarHBondContact O-N 2.69Å; D7-T10 VanDerWaalsContact O-N 3.1Å; D7-V11 WeakPolarHBondContact O-CG2 3.41Å; D7-V11 PolarHBondContact O-N 2.7Å
8	L	65.3	Low	59.5	Low	91 Å²	91	108.7 Å²	108.7	48%	0.476	58%	0.576	S	S	.	*	H	α-helix	trans	-61	-37.9	177	-174.4	64.8	0	0	0	112	I4 L5 K12	I4-L8 PolarHBondContact O-N 3.43Å; I4-L8 VanDerWaalsContact O-N 3.11Å; L5-L8 PolarHBondContact O-N 3.47Å; L8-K12 WeakPolarHBondContact O-CG 3.45Å; L8-K12 PolarHBondContact O-N 3.33Å
9	F	59.1	Low	59.9	Low	152 Å²	152	109.1 Å²	109.1	67%	0.667	58%	0.578	S	S	*	*	H	α-helix	trans	-64.7	-43	174.5	-168.1	-92.9	0	0	0	111.4	L5 A6 D7 K12 F13	L5-F9 WeakPolarHBondContact O-CB 3.46Å; L5-F9 PolarHBondContact O-N 3.14Å; A6-F9 PolarHBondContact O-N 2.8Å; D7-F9 VanDerWaalsContact C-N 3.27Å; D7-F9 PolarHBondContact O-N 2.86Å; F9-K12 PolarHBondContact O-N 2.88Å; F9-F13 WeakPolarHBondContact O-CB 3.41Å; F9-F13 PolarHBondContact O-N 3.23Å
10	T	61	Low	60.3	Low	88 Å²	88	110.5 Å²	110.5	54%	0.54	58%	0.579	S	S	.	*	H	α-helix	trans	-63.2	-43.1	178.3	-53.3	0	0	0	0	111.7	A6 D7 F13 A14	A6-T10 PolarHBondContact O-N 3.2Å; A6-T10 PolarHBondContact O-OG1 2.93Å; D7-T10 WeakPolarHBondContact O-CB 3.35Å; D7-T10 PolarHBondContact O-N 2.69Å; D7-T10 VanDerWaalsContact O-N 3.1Å; T10-F13 PolarHBondContact O-N 3.34Å; T10-A14 WeakPolarHBondContact O-CB 3.48Å; T10-A14 PolarHBondContact O-N 3.38Å
11	V	59.5	Low	60.5	Low	80 Å²	80	109.4 Å²	109.4	49%	0.485	57%	0.573	S	S	.	*	H	α-helix	trans	-64.6	-45	175.9	175.1	0	0	0	0	111.5	D7 F13 A14 N15	D7-V11 WeakPolarHBondContact O-CG2 3.41Å; D7-V11 PolarHBondContact O-N 2.7Å; V11-F13 VanDerWaalsContact C-N 3.31Å; V11-F13 PolarHBondContact O-N 3.34Å; V11-A14 PolarHBondContact O-N 2.76Å; V11-N15 PolarHBondContact O-N 2.97Å
12	K	61.5	Low	61.2	Low	138 Å²	138	105.4 Å²	105.4	60%	0.6	55%	0.55	S	S	*	*	H	α-helix	trans	-63.1	-38.1	176	-78.3	-174.4	177.7	-177.8	0	112.1	L8 F9 N15 R16	L8-K12 WeakPolarHBondContact O-CG 3.45Å; L8-K12 PolarHBondContact O-N 3.33Å; F9-K12 PolarHBondContact O-N 2.88Å; K12-N15 PolarHBondContact O-N 3.41Å; K12-R16 PolarHBondContact O-N 3.16Å
13	F	60	Low	61.6	Low	135 Å²	135	104.4 Å²	104.4	59%	0.592	54%	0.54	S	S	*	.	H	α-helix	trans	-66	-42.5	176.8	-169.5	-95.7	0	0	0	111.7	F9 T10 V11 R16 S17	F9-F13 WeakPolarHBondContact O-CB 3.41Å; F9-F13 PolarHBondContact O-N 3.23Å; T10-F13 PolarHBondContact O-N 3.34Å; V11-F13 VanDerWaalsContact C-N 3.31Å; V11-F13 PolarHBondContact O-N 3.34Å; F13-R16 PolarHBondContact O-N 3.34Å; F13-S17 PolarHBondContact O-N 3.05Å
14	A	58.1	Low	61.8	Low	43 Å²	43	104.7 Å²	104.7	36%	0.355	53%	0.531	S	S	.	.	H	α-helix	trans	-61.9	-40.9	173.1	0	0	0	0	0	112.3	T10 V11 R16 S17 L18	T10-A14 WeakPolarHBondContact O-CB 3.48Å; T10-A14 PolarHBondContact O-N 3.38Å; V11-A14 PolarHBondContact O-N 2.76Å; A14-R16 VanDerWaalsContact C-N 3.35Å; A14-R16 PolarHBondContact O-N 3.45Å; A14-S17 PolarHBondContact O-N 3.3Å; A14-S17 PolarHBondContact O-OG 2.79Å; A14-L18 WeakPolarHBondContact O-CG 3.25Å; A14-L18 PolarHBondContact O-N 2.79Å
15	N	59.3	Low	62.3	Low	85 Å²	85	103.5 Å²	103.5	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-67	-35.7	175.7	-76.7	-14.1	0	0	0	112.7	V11 K12 S17 L18 N19	V11-N15 PolarHBondContact O-N 2.97Å; K12-N15 PolarHBondContact O-N 3.41Å; N15-S17 VanDerWaalsContact C-N 3.32Å; N15-S17 PolarHBondContact O-N 3.28Å; N15-L18 PolarHBondContact O-N 2.96Å; N15-N19 PolarHBondContact O-N 2.77Å
16	R	57.7	Low	62.6	Low	196 Å²	196	103.5 Å²	103.5	74%	0.74	53%	0.526	S	S	*	.	H	α-helix	trans	-64.7	-37.7	174.6	-168.7	177.3	-177.7	-179.5	1.1	111.6	K12 F13 A14 K20	K12-R16 PolarHBondContact O-N 3.16Å; F13-R16 PolarHBondContact O-N 3.34Å; A14-R16 VanDerWaalsContact C-N 3.35Å; A14-R16 PolarHBondContact O-N 3.45Å; R16-K20 PolarHBondContact O-N 2.99Å
17	S	67.1	Low	62.5	Low	54 Å²	54	107 Å²	107	38%	0.378	54%	0.537	S	S	.	.	H	α-helix	trans	-70.2	-38.6	175.7	68.9	0	0	0	0	111.6	F13 A14 N15 K20 I21	F13-S17 PolarHBondContact O-N 3.05Å; A14-S17 PolarHBondContact O-N 3.3Å; A14-S17 PolarHBondContact O-OG 2.79Å; N15-S17 VanDerWaalsContact C-N 3.32Å; N15-S17 PolarHBondContact O-N 3.28Å; S17-K20 WeakPolarHBondContact O-CB 3.17Å; S17-K20 PolarHBondContact O-N 3.09Å; S17-I21 WeakPolarHBondContact O-CG1 3.23Å; S17-I21 PolarHBondContact O-N 2.86Å
18	L	65	Low	62.4	Low	76 Å²	76	109.8 Å²	109.8	40%	0.398	54%	0.54	S	S	.	.	H	α-helix	trans	-62	-45.6	174.2	-71.5	173.1	0	0	0	112.5	A14 N15 K20 I21 F22	A14-L18 WeakPolarHBondContact O-CG 3.25Å; A14-L18 PolarHBondContact O-N 2.79Å; N15-L18 PolarHBondContact O-N 2.96Å; L18-K20 PolarHBondContact O-N 3.41Å; L18-I21 HydrophobicContact CD2-CD1 4.32Å; L18-I21 CarbonylContact O-C 3.56Å; L18-I21 WeakPolarHBondContact O-CA 3.47Å; L18-I21 WeakPolarHBondContact O-CB 3.47Å; L18-I21 PolarHBondContact O-N 3.48Å; L18-F22 HydrophobicContact CB-CE2 4.31Å; L18-F22 WeakPolarHBondContact O-CD2 3.5Å; L18-F22 PolarHBondContact O-N 3.03Å
19	N	67	Low	62.1	Low	116 Å²	116	108.5 Å²	108.5	62%	0.62	54%	0.539	S	S	*	.	H	α-helix	trans	-59.8	-36	175.9	-76	-9.7	0	0	0	112.3	N15 I21 F22 G23	N15-N19 PolarHBondContact O-N 2.77Å; N19-I21 VanDerWaalsContact C-N 3.32Å; N19-F22 PolarHBondContact O-N 3.41Å; N19-G23 PolarHBondContact O-N 3.24Å
20	K	66.5	Low	62.1	Low	138 Å²	138	106.3 Å²	106.3	60%	0.6	53%	0.531	S	S	*	.	H	α-helix	trans	-67.6	-32.9	173.7	-169.1	176.4	-177.8	178.1	0	112.1	R16 S17 L18 R24	R16-K20 PolarHBondContact O-N 2.99Å; S17-K20 WeakPolarHBondContact O-CB 3.17Å; S17-K20 PolarHBondContact O-N 3.09Å; L18-K20 PolarHBondContact O-N 3.41Å; K20-R24 WeakPolarHBondContact O-CG 3.42Å; K20-R24 PolarHBondContact O-N 3.12Å
21	I	64.5	Low	62	Low	88 Å²	88	106.2 Å²	106.2	45%	0.451	52%	0.524	S	S	.	.	H	α-helix	trans	-69.1	-45.4	173.7	-66.8	162	0	0	0	110.1	S17 L18 N19 G23 R24 L25	S17-I21 WeakPolarHBondContact O-CG1 3.23Å; S17-I21 PolarHBondContact O-N 2.86Å; L18-I21 HydrophobicContact CD2-CD1 4.32Å; L18-I21 CarbonylContact O-C 3.56Å; L18-I21 WeakPolarHBondContact O-CA 3.47Å; L18-I21 WeakPolarHBondContact O-CB 3.47Å; L18-I21 PolarHBondContact O-N 3.48Å; N19-I21 VanDerWaalsContact C-N 3.32Å; I21-G23 PolarHBondContact O-N 3.48Å; I21-R24 WeakPolarHBondContact O-CB 3.32Å; I21-R24 PolarHBondContact O-N 3.5Å; I21-R24 VanDerWaalsContact O-N 3.11Å; I21-L25 HydrophobicContact CG2-CD1 3.9Å; I21-L25 PolarHBondContact O-N 3.37Å
22	F	66.2	Low	61.9	Low	128 Å²	128	106.3 Å²	106.3	56%	0.561	52%	0.521	S	S	*	.	H	α-helix	trans	-61.3	-44.1	176.6	-73	-62.1	0	0	0	112.6	L18 N19 R24 L25 D26	L18-F22 HydrophobicContact CB-CE2 4.31Å; L18-F22 WeakPolarHBondContact O-CD2 3.5Å; L18-F22 PolarHBondContact O-N 3.03Å; N19-F22 PolarHBondContact O-N 3.41Å; F22-R24 PolarHBondContact O-N 3.36Å; F22-L25 HydrophobicContact CD1-CD1 4.24Å; F22-L25 WeakPolarHBondContact O-CB 3.47Å; F22-L25 PolarHBondContact O-N 3.02Å; F22-L25 VanDerWaalsContact O-N 3.13Å; F22-D26 PolarHBondContact O-N 3.25Å
23	G	62.8	Low	61.8	Low	39 Å²	39	103.9 Å²	103.9	40%	0.402	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-30.9	174.3	0	0	0	0	0	113.4	N19 I21 L27	N19-G23 PolarHBondContact O-N 3.24Å; I21-G23 PolarHBondContact O-N 3.48Å; G23-L27 PolarHBondContact O-N 3.17Å
24	R	62	Low	61.8	Low	150 Å²	150	103 Å²	103	57%	0.566	51%	0.513	S	S	*	.	H	α-helix	trans	-73.6	-39.2	172.8	-76	176	169	-171.6	-5.2	112.5	K20 I21 F22 D26 L27 Y28	K20-R24 WeakPolarHBondContact O-CG 3.42Å; K20-R24 PolarHBondContact O-N 3.12Å; I21-R24 WeakPolarHBondContact O-CB 3.32Å; I21-R24 PolarHBondContact O-N 3.5Å; I21-R24 VanDerWaalsContact O-N 3.11Å; F22-R24 PolarHBondContact O-N 3.36Å; R24-D26 VanDerWaalsContact C-N 3.3Å; R24-D26 PolarHBondContact O-N 3.25Å; R24-L27 WeakPolarHBondContact O-CB 3.32Å; R24-L27 PolarHBondContact O-N 3.29Å; R24-Y28 WeakPolarHBondContact O-CD2 3.41Å; R24-Y28 PolarHBondContact O-N 3.29Å
25	L	66.9	Low	61.8	Low	99 Å²	99	106.8 Å²	106.8	52%	0.518	52%	0.522	S	S	.	.	H	α-helix	trans	-59.7	-41.7	175.5	-86.9	149	0	0	0	111.5	I21 F22 Y28 S29	I21-L25 HydrophobicContact CG2-CD1 3.9Å; I21-L25 PolarHBondContact O-N 3.37Å; F22-L25 HydrophobicContact CD1-CD1 4.24Å; F22-L25 WeakPolarHBondContact O-CB 3.47Å; F22-L25 PolarHBondContact O-N 3.02Å; F22-L25 VanDerWaalsContact O-N 3.13Å; L25-Y28 WeakPolarHBondContact O-CB 3.43Å; L25-Y28 PolarHBondContact O-N 3.06Å; L25-Y28 VanDerWaalsContact O-N 3.16Å; L25-S29 PolarHBondContact O-N 3.03Å
26	D	63.9	Low	61.7	Low	121 Å²	121	106.3 Å²	106.3	65%	0.647	51%	0.514	S	S	*	.	H	α-helix	trans	-62.6	-44	177.5	-161.3	34.8	0	0	0	111.9	F22 R24 Y28 S29 H30	F22-D26 PolarHBondContact O-N 3.25Å; R24-D26 VanDerWaalsContact C-N 3.3Å; R24-D26 PolarHBondContact O-N 3.25Å; D26-Y28 VanDerWaalsContact C-N 3.32Å; D26-Y28 PolarHBondContact O-N 2.99Å; D26-S29 WeakPolarHBondContact O-CB 3.17Å; D26-S29 PolarHBondContact O-N 3.03Å; D26-S29 VanDerWaalsContact O-N 3.17Å; D26-H30 PolarHBondContact O-N 3.48Å
27	L	58.9	Low	61.8	Low	128 Å²	128	100.6 Å²	100.6	67%	0.67	49%	0.494	S	S	*	.	H	α-helix	trans	-59.2	-39.1	172.2	-76.4	161.8	0	0	0	112.9	G23 R24 H31	G23-L27 PolarHBondContact O-N 3.17Å; R24-L27 WeakPolarHBondContact O-CB 3.32Å; R24-L27 PolarHBondContact O-N 3.29Å; L27-H31 WeakPolarHBondContact O-CB 3.49Å; L27-H31 PolarHBondContact O-N 3.36Å; L27-H31 VanDerWaalsContact O-N 3.07Å
28	Y	57.5	Low	61.7	Low	160 Å²	160	101.7 Å²	101.7	63%	0.627	50%	0.499	S	S	*	.	H	α-helix	trans	-67.7	-39.6	175.5	-82.7	-67.5	0	0	0	112.1	R24 L25 D26 H31 I32	R24-Y28 WeakPolarHBondContact O-CD2 3.41Å; R24-Y28 PolarHBondContact O-N 3.29Å; L25-Y28 WeakPolarHBondContact O-CB 3.43Å; L25-Y28 PolarHBondContact O-N 3.06Å; L25-Y28 VanDerWaalsContact O-N 3.16Å; D26-Y28 VanDerWaalsContact C-N 3.32Å; D26-Y28 PolarHBondContact O-N 2.99Å; Y28-H31 WeakPolarHBondContact O-CB 3.33Å; Y28-H31 PolarHBondContact O-N 3.41Å; Y28-I32 WeakPolarHBondContact O-CG1 3.4Å; Y28-I32 PolarHBondContact O-N 2.92Å
29	S	59	Low	61.6	Low	64 Å²	64	103.5 Å²	103.5	45%	0.448	50%	0.504	S	S	.	.	H	α-helix	trans	-58	-51.2	176.1	-165.8	0	0	0	0	110.5	L25 D26 H31 I32 E33	L25-S29 PolarHBondContact O-N 3.03Å; D26-S29 WeakPolarHBondContact O-CB 3.17Å; D26-S29 PolarHBondContact O-N 3.03Å; D26-S29 VanDerWaalsContact O-N 3.17Å; S29-H31 VanDerWaalsContact C-N 3.28Å; S29-H31 PolarHBondContact O-N 3.34Å; S29-I32 WeakPolarHBondContact O-CB 3.44Å; S29-I32 PolarHBondContact O-N 3.39Å; S29-E33 WeakPolarHBondContact O-CG 3.13Å; S29-E33 PolarHBondContact O-N 3.27Å; S29-E33 VanDerWaalsContact O-N 3.12Å
30	H	59.8	Low	61.5	Low	107 Å²	107	100 Å²	100	50%	0.495	49%	0.485	S	S	.	.	H	α-helix	trans	-62.7	-34.5	178.4	-168.7	29	0	0	0	112.8	D26 I32 E33 N34	D26-H30 PolarHBondContact O-N 3.48Å; H30-I32 VanDerWaalsContact C-N 3.33Å; H30-I32 PolarHBondContact O-N 3.05Å; H30-E33 PolarHBondContact O-N 2.96Å; H30-N34 PolarHBondContact CE1-ND2 3.11Å; H30-N34 PolarHBondContact O-N 3.41Å
31	H	58.9	Low	61.7	Low	86 Å²	86	101.6 Å²	101.6	40%	0.398	49%	0.494	S	S	.	.	H	α-helix	trans	-64.7	-36.4	173.9	-164.8	69	0	0	0	113	L27 Y28 S29 K35	L27-H31 WeakPolarHBondContact O-CB 3.49Å; L27-H31 PolarHBondContact O-N 3.36Å; L27-H31 VanDerWaalsContact O-N 3.07Å; Y28-H31 WeakPolarHBondContact O-CB 3.33Å; Y28-H31 PolarHBondContact O-N 3.41Å; S29-H31 VanDerWaalsContact C-N 3.28Å; S29-H31 PolarHBondContact O-N 3.34Å; H31-K35 WeakPolarHBondContact CE1-CE 3.44Å; H31-K35 PolarHBondContact CE1-NZ 3.16Å; H31-K35 WeakPolarHBondContact NE2-CD 3.48Å; H31-K35 WeakPolarHBondContact NE2-CE 3.49Å; H31-K35 PolarHBondContact NE2-NZ 3.07Å; H31-K35 PolarHBondContact O-N 2.93Å
32	I	57.5	Low	62.1	Low	82 Å²	82	104.3 Å²	104.3	42%	0.421	51%	0.51	S	S	.	.	H	α-helix	trans	-68.5	-44.1	179.6	-70.1	165.5	0	0	0	110.3	Y28 S29 H30 N34 K35 Y36 L48	Y28-I32 WeakPolarHBondContact O-CG1 3.4Å; Y28-I32 PolarHBondContact O-N 2.92Å; S29-I32 WeakPolarHBondContact O-CB 3.44Å; S29-I32 PolarHBondContact O-N 3.39Å; H30-I32 VanDerWaalsContact C-N 3.33Å; H30-I32 PolarHBondContact O-N 3.05Å; I32-N34 VanDerWaalsContact C-N 3.31Å; I32-N34 PolarHBondContact O-N 3.2Å; I32-K35 PolarHBondContact O-N 3.06Å; I32-Y36 HydrophobicContact CB-CD2 4.47Å; I32-Y36 HydrophobicContact CG1-CD2 4.49Å; I32-Y36 HydrophobicContact CG2-CD2 4.3Å; I32-Y36 PolarHBondContact O-N 3.46Å; I32-L48 HydrophobicContact CG2-CD2 4.05Å
33	E	59.1	Low	62.4	Low	86 Å²	86	104.9 Å²	104.9	40%	0.402	51%	0.512	S	S	.	.	H	α-helix	trans	-56.7	-45.1	179.2	-62.1	-161.8	125.7	0	0	112.1	S29 H30 K37	S29-E33 WeakPolarHBondContact O-CG 3.13Å; S29-E33 PolarHBondContact O-N 3.27Å; S29-E33 VanDerWaalsContact O-N 3.12Å; H30-E33 PolarHBondContact O-N 2.96Å; E33-K37 HydrophobicContact CB-CD 4.28Å; E33-K37 WeakPolarHBondContact O-CB 3.5Å; E33-K37 WeakPolarHBondContact O-CG 3.47Å; E33-K37 IonicContact OE1-NZ 2.77Å; E33-K37 PolarHBondContact OE1-NZ 2.78Å
34	N	60.3	Low	62.8	Low	117 Å²	117	105.3 Å²	105.3	63%	0.626	52%	0.517	S	S	*	.	H	α-helix	trans	-78.8	-26.1	-174.9	-70.6	-16.7	0	0	0	114.6	H30 I32	H30-N34 PolarHBondContact CE1-ND2 3.11Å; H30-N34 PolarHBondContact O-N 3.41Å; I32-N34 VanDerWaalsContact C-N 3.31Å; I32-N34 PolarHBondContact O-N 3.2Å
35	K	58.4	Low	63.2	Low	123 Å²	123	103.5 Å²	103.5	54%	0.535	52%	0.515	S	S	.	.	H	α-helix	trans	-101.1	-29.1	-175	-85.3	-163.7	-176.2	165.5	0	115	H31 I32	H31-K35 WeakPolarHBondContact CE1-CE 3.44Å; H31-K35 PolarHBondContact CE1-NZ 3.16Å; H31-K35 WeakPolarHBondContact NE2-CD 3.48Å; H31-K35 WeakPolarHBondContact NE2-CE 3.49Å; H31-K35 PolarHBondContact NE2-NZ 3.07Å; H31-K35 PolarHBondContact O-N 2.93Å; I32-K35 PolarHBondContact O-N 3.06Å
36	Y	56.4	Low	62.9	Low	74 Å²	74	105 Å²	105	29%	0.29	52%	0.519	S	S	.	.	H	α-helix	trans	-116.3	-8.8	-171.3	-57.4	-80.9	0	0	0	113	I32 V38 L48 N49 V55	I32-Y36 HydrophobicContact CB-CD2 4.47Å; I32-Y36 HydrophobicContact CG1-CD2 4.49Å; I32-Y36 HydrophobicContact CG2-CD2 4.3Å; I32-Y36 PolarHBondContact O-N 3.46Å; Y36-V38 PolarHBondContact O-N 2.86Å; Y36-L48 CarbonylContact O-C 3.56Å; Y36-L48 WeakPolarHBondContact O-CA 3.35Å; Y36-N49 WeakPolarHBondContact O-CB 3.4Å; Y36-N49 PolarHBondContact O-N 3.24Å; Y36-V55 HydrophobicContact CE1-CG2 4.39Å
37	K	60.2	Low	62.9	Low	76 Å²	76	103.5 Å²	103.5	33%	0.33	51%	0.507	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	120.9	168.9	-66.3	-176.8	-175.8	173.8	0	109.1	E33 L48	E33-K37 HydrophobicContact CB-CD 4.28Å; E33-K37 WeakPolarHBondContact O-CB 3.5Å; E33-K37 WeakPolarHBondContact O-CG 3.47Å; E33-K37 IonicContact OE1-NZ 2.77Å; E33-K37 PolarHBondContact OE1-NZ 2.78Å; K37-L48 HydrophobicContact CG-CD2 3.95Å
38	V	64.1	Low	63.1	Low	77 Å²	77	101.5 Å²	101.5	47%	0.467	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	129	171.5	176.4	0	0	0	0	107.3	Y36 N40 K47 N49	Y36-V38 PolarHBondContact O-N 2.86Å; V38-N40 PolarHBondContact O-N 2.97Å; V38-K47 PolarHBondContact N-O 3.47Å; V38-K47 PolarHBondContact O-N 3.24Å; V38-K47 VanDerWaalsContact O-O 3.08Å; V38-N49 HydrophobicContact CB-CB 4.35Å; V38-N49 HydrophobicContact CG2-CB 3.7Å
39	F	64.1	Low	63.2	Low	115 Å²	115	96.7 Å²	96.7	50%	0.504	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	124.7	175.3	-169.6	-99.9	0	0	0	109.6	E41 E46	F39-E41 HydrophobicContact CD1-CG 3.99Å; F39-E41 HydrophobicContact CE1-CG 4.35Å; F39-E41 PolarHBondContact O-N 2.95Å; F39-E46 HydrophobicContact CD2-CG 3.84Å
40	N	65	Low	63	Low	43 Å²	43	100 Å²	100	23%	0.23	49%	0.494	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	98.3	175.8	-170.9	-29.6	0	0	0	109.3	V38 N42 F43 G44 E45 K47	V38-N40 PolarHBondContact O-N 2.97Å; N40-N42 PolarHBondContact O-N 3.27Å; N40-N42 VanDerWaalsContact O-N 3.14Å; N40-N42 WeakPolarHBondContact OD1-CB 3.34Å; N40-N42 PolarHBondContact OD1-N 2.95Å; N40-F43 PolarHBondContact O-N 3.49Å; N40-F43 VanDerWaalsContact O-N 3.11Å; N40-G44 PolarHBondContact O-N 3.13Å; N40-E45 WeakPolarHBondContact CB-O 3.18Å; N40-E45 PolarHBondContact N-O 3.24Å; N40-K47 HydrophobicContact CB-CD 4.34Å
41	E	69.8	Low	62.9	Low	170 Å²	170	99.2 Å²	99.2	79%	0.794	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.6	-28.2	-177.6	-65.2	-178.2	174	0	0	113.5	F39 F43	F39-E41 HydrophobicContact CD1-CG 3.99Å; F39-E41 HydrophobicContact CE1-CG 4.35Å; F39-E41 PolarHBondContact O-N 2.95Å; E41-F43 VanDerWaalsContact C-N 3.31Å; E41-F43 PolarHBondContact O-N 3.28Å
42	N	74.4	Confident	62.6	Low	145 Å²	145	103 Å²	103	78%	0.775	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.4	-23.8	-178.9	-62.8	-34.5	0	0	0	113.4	N40	N40-N42 PolarHBondContact O-N 3.27Å; N40-N42 VanDerWaalsContact O-N 3.14Å; N40-N42 WeakPolarHBondContact OD1-CB 3.34Å; N40-N42 PolarHBondContact OD1-N 2.95Å
43	F	71.5	Confident	62.3	Low	140 Å²	140	105.2 Å²	105.2	61%	0.614	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-117.3	-11.2	-178.6	-65.7	-83.4	0	0	0	113.3	N40 E41 E45	N40-F43 PolarHBondContact O-N 3.49Å; N40-F43 VanDerWaalsContact O-N 3.11Å; E41-F43 VanDerWaalsContact C-N 3.31Å; E41-F43 PolarHBondContact O-N 3.28Å; F43-E45 VanDerWaalsContact C-N 3.28Å; F43-E45 PolarHBondContact O-N 3.02Å
44	G	70.4	Confident	62	Low	48 Å²	48	103.1 Å²	103.1	50%	0.495	51%	0.513	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.1	22.2	-175.3	0	0	0	0	0	114	N40	N40-G44 PolarHBondContact O-N 3.13Å
45	E	71.6	Confident	61.5	Low	112 Å²	112	100.7 Å²	100.7	52%	0.523	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	142.9	-174.8	-67.5	178.7	170.6	0	0	111.8	N40 F43 K47	N40-E45 WeakPolarHBondContact CB-O 3.18Å; N40-E45 PolarHBondContact N-O 3.24Å; F43-E45 VanDerWaalsContact C-N 3.28Å; F43-E45 PolarHBondContact O-N 3.02Å; E45-K47 PolarHBondContact O-N 3.28Å
46	E	60.8	Low	61.1	Low	132 Å²	132	99.5 Å²	99.5	62%	0.617	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.2	118	168.4	-71.5	-175.2	178.4	0	0	110.4	F39	F39-E46 HydrophobicContact CD2-CG 3.84Å
47	K	63.6	Low	60.7	Low	88 Å²	88	100.9 Å²	100.9	38%	0.383	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	141	174.6	-69.5	-176.9	179.5	174	0	109.8	V38 N40 E45 N49	V38-K47 PolarHBondContact N-O 3.47Å; V38-K47 PolarHBondContact O-N 3.24Å; V38-K47 VanDerWaalsContact O-O 3.08Å; N40-K47 HydrophobicContact CB-CD 4.34Å; E45-K47 PolarHBondContact O-N 3.28Å; K47-N49 PolarHBondContact O-N 2.91Å
48	L	62.3	Low	60.3	Low	86 Å²	86	105 Å²	105	45%	0.45	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.4	119.2	164.3	-74.2	167.9	0	0	0	107.6	I32 Y36 K37 N50	I32-L48 HydrophobicContact CG2-CD2 4.05Å; Y36-L48 CarbonylContact O-C 3.56Å; Y36-L48 WeakPolarHBondContact O-CA 3.35Å; K37-L48 HydrophobicContact CG-CD2 3.95Å; L48-N50 PolarHBondContact O-N 3.1Å
49	N	60.3	Low	59.5	Low	60 Å²	60	109.4 Å²	109.4	32%	0.321	54%	0.542	S	S	.	.			trans	-66.1	80.4	165.9	-171.5	10.3	0	0	0	108.5	Y36 V38 K47 D51	Y36-N49 WeakPolarHBondContact O-CB 3.4Å; Y36-N49 PolarHBondContact O-N 3.24Å; V38-N49 HydrophobicContact CB-CB 4.35Å; V38-N49 HydrophobicContact CG2-CB 3.7Å; K47-N49 PolarHBondContact O-N 2.91Å; N49-D51 PolarHBondContact O-N 2.96Å; N49-D51 WeakPolarHBondContact OD1-CB 3.44Å; N49-D51 PolarHBondContact OD1-N 3.45Å
50	N	55.2	Low	58.8	Low	132 Å²	132	107.7 Å²	107.7	71%	0.706	55%	0.545	S	S	*	.			trans	-83.7	35.7	172.6	-73.8	-20.1	0	0	0	110.6	L48 F52	L48-N50 PolarHBondContact O-N 3.1Å; N50-F52 PolarHBondContact O-N 2.94Å
51	D	58	Low	57.9	Low	92 Å²	92	110.1 Å²	110.1	49%	0.492	56%	0.561	S	S	.	*			trans	-62	95.5	165.4	-104.1	-8.5	0	0	0	107.4	N49 E53 S54 V55	N49-D51 PolarHBondContact O-N 2.96Å; N49-D51 WeakPolarHBondContact OD1-CB 3.44Å; N49-D51 PolarHBondContact OD1-N 3.45Å; D51-E53 PolarHBondContact O-N 3.11Å; D51-E53 VanDerWaalsContact O-N 3.16Å; D51-S54 WeakPolarHBondContact O-CB 3.35Å; D51-S54 PolarHBondContact O-N 3.33Å; D51-S54 PolarHBondContact O-OG 2.88Å; D51-V55 PolarHBondContact O-N 3.39Å
52	F	51.2	Low	56.7	Low	164 Å²	164	105.4 Å²	105.4	72%	0.719	54%	0.544	S	S	*	.	H	α-helix	trans	-55.2	-31.5	174.6	-158.6	-98.3	0	0	0	110	N50 V55 L56	N50-F52 PolarHBondContact O-N 2.94Å; F52-V55 PolarHBondContact O-N 2.98Å; F52-L56 HydrophobicContact CD1-CD1 3.67Å; F52-L56 HydrophobicContact CD1-CG 4.32Å; F52-L56 HydrophobicContact CE1-CD1 3.75Å; F52-L56 HydrophobicContact CE1-CG 4.34Å; F52-L56 WeakPolarHBondContact O-CG 3.49Å; F52-L56 PolarHBondContact O-N 3.32Å
53	E	52.5	Low	55.2	Low	129 Å²	129	106 Å²	106	60%	0.603	54%	0.544	S	S	*	.	H	α-helix	trans	-66.8	-37.4	172.7	-164.6	160.8	-168.3	0	0	112.9	D51 V55 L56 M57	D51-E53 PolarHBondContact O-N 3.11Å; D51-E53 VanDerWaalsContact O-N 3.16Å; E53-V55 VanDerWaalsContact C-N 3.31Å; E53-V55 PolarHBondContact O-N 3.36Å; E53-L56 PolarHBondContact O-N 3.27Å; E53-M57 HydrophobicContact CG-CG 4.01Å; E53-M57 VanDerWaalsContact O-CB 3.23Å; E53-M57 WeakPolarHBondContact O-CB 3.37Å; E53-M57 WeakPolarHBondContact O-CG 3.4Å; E53-M57 PolarHBondContact O-N 3.42Å
54	S	52.2	Low	54.2	Low	42 Å²	42	106.9 Å²	106.9	29%	0.294	56%	0.555	S	S	.	*	H	α-helix	trans	-65.1	-33.9	175.9	77.6	0	0	0	0	112.8	D51 K58	D51-S54 WeakPolarHBondContact O-CB 3.35Å; D51-S54 PolarHBondContact O-N 3.33Å; D51-S54 PolarHBondContact O-OG 2.88Å; S54-K58 PolarHBondContact O-N 3.33Å
55	V	50.1	Low	52.9	Low	67 Å²	67	114.2 Å²	114.2	41%	0.406	57%	0.568	S	S	.	*	H	α-helix	trans	-74.6	-41.6	176.6	177.5	0	0	0	0	111	Y36 D51 F52 E53 K59	Y36-V55 HydrophobicContact CE1-CG2 4.39Å; D51-V55 PolarHBondContact O-N 3.39Å; F52-V55 PolarHBondContact O-N 2.98Å; E53-V55 VanDerWaalsContact C-N 3.31Å; E53-V55 PolarHBondContact O-N 3.36Å; V55-K59 PolarHBondContact O-N 3.03Å
56	L	49.2	Very low	51.9	Low	98 Å²	98	115.6 Å²	115.6	51%	0.513	58%	0.578	S	S	.	*	H	α-helix	trans	-69.2	-46.5	177.1	-77.3	172.4	0	0	0	111.9	F52 E53 K58 K59 S60	F52-L56 HydrophobicContact CD1-CD1 3.67Å; F52-L56 HydrophobicContact CD1-CG 4.32Å; F52-L56 HydrophobicContact CE1-CD1 3.75Å; F52-L56 HydrophobicContact CE1-CG 4.34Å; F52-L56 WeakPolarHBondContact O-CG 3.49Å; F52-L56 PolarHBondContact O-N 3.32Å; E53-L56 PolarHBondContact O-N 3.27Å; L56-K58 VanDerWaalsContact C-N 3.3Å; L56-K58 PolarHBondContact O-N 3.48Å; L56-K59 CarbonylContact O-C 3.52Å; L56-K59 PolarHBondContact O-N 3.34Å; L56-S60 PolarHBondContact O-N 3.42Å; L56-S60 PolarHBondContact O-OG 3.45Å
57	M	48.1	Very low	51.2	Low	103 Å²	103	114.4 Å²	114.4	51%	0.507	58%	0.582	S	S	.	*	H	α-helix	trans	-62.9	-34.3	-179.7	-71.2	-63.5	-144	0	0	112.4	E53 K59 S60 V61	E53-M57 HydrophobicContact CG-CG 4.01Å; E53-M57 VanDerWaalsContact O-CB 3.23Å; E53-M57 WeakPolarHBondContact O-CB 3.37Å; E53-M57 WeakPolarHBondContact O-CG 3.4Å; E53-M57 PolarHBondContact O-N 3.42Å; M57-K59 VanDerWaalsContact C-N 3.28Å; M57-K59 PolarHBondContact O-N 2.92Å; M57-S60 WeakPolarHBondContact CA-OG 3.34Å; M57-V61 WeakPolarHBondContact O-CB 3.49Å; M57-V61 VanDerWaalsContact O-CG2 3.25Å; M57-V61 WeakPolarHBondContact O-CG2 3.44Å; M57-V61 PolarHBondContact O-N 3.05Å
58	K	51.1	Low	50.8	Low	163 Å²	163	118.3 Å²	118.3	71%	0.709	61%	0.606	S	S	*	*	H	α-helix	trans	-67.2	-27.1	172.3	-107.7	179.2	-179.8	165.5	0	113.6	S54 L56	S54-K58 PolarHBondContact O-N 3.33Å; L56-K58 VanDerWaalsContact C-N 3.3Å; L56-K58 PolarHBondContact O-N 3.48Å
59	K	48.9	Very low	49.6	Very low	168 Å²	168	119.4 Å²	119.4	73%	0.73	62%	0.616	S	S	*	*	H	α-helix	trans	-95.8	-29.4	-179.4	-83.7	-170.9	174.5	-175.4	0	114	V55 L56 M57	V55-K59 PolarHBondContact O-N 3.03Å; L56-K59 CarbonylContact O-C 3.52Å; L56-K59 PolarHBondContact O-N 3.34Å; M57-K59 VanDerWaalsContact C-N 3.28Å; M57-K59 PolarHBondContact O-N 2.92Å
60	S	47.7	Very low	48.9	Very low	80 Å²	80	123.3 Å²	123.3	56%	0.559	64%	0.637	S	S	*	*	H	α-helix	trans	-77.1	-25.2	175.8	51.8	0	0	0	0	112	L56 M57 T62	L56-S60 PolarHBondContact O-N 3.42Å; L56-S60 PolarHBondContact O-OG 3.45Å; M57-S60 WeakPolarHBondContact CA-OG 3.34Å; S60-T62 PolarHBondContact O-N 2.94Å; S60-T62 VanDerWaalsContact O-N 3.09Å
61	V	46.3	Very low	48.1	Very low	94 Å²	94	123.5 Å²	123.5	57%	0.57	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	99.6	171.6	-178.4	0	0	0	0	109.3	M57	M57-V61 WeakPolarHBondContact O-CB 3.49Å; M57-V61 VanDerWaalsContact O-CG2 3.25Å; M57-V61 WeakPolarHBondContact O-CG2 3.44Å; M57-V61 PolarHBondContact O-N 3.05Å
62	T	44.8	Very low	47.2	Very low	71 Å²	71	124 Å²	124	44%	0.436	65%	0.654	S	S	.	*	T	Hydrogen-bonded Turn	trans	97.6	41.4	164	65.5	0	0	0	0	119.8	S60 N64 R65	S60-T62 PolarHBondContact O-N 2.94Å; S60-T62 VanDerWaalsContact O-N 3.09Å; T62-N64 PolarHBondContact O-N 3.43Å; T62-R65 HydrophobicContact CG2-CB 4.05Å; T62-R65 HydrophobicContact CG2-CG 3.58Å; T62-R65 PolarHBondContact O-N 3.13Å
63	M	44.2	Very low	47.1	Very low	158 Å²	158	121.3 Å²	121.3	78%	0.778	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-53.7	-23.5	140.3	-77.8	-90.6	-71.6	0	0	111.7
64	N	49.8	Very low	46.6	Very low	158 Å²	158	121.1 Å²	121.1	85%	0.845	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-86	5.7	178	-62.9	-15.2	0	0	0	115	T62	T62-N64 PolarHBondContact O-N 3.43Å
65	R	43.2	Very low	46.2	Very low	201 Å²	201	128.1 Å²	128.1	76%	0.758	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-124.6	25	173.1	-64.2	-173	178.1	173.4	-4.7	114	T62 P67	T62-R65 HydrophobicContact CG2-CB 4.05Å; T62-R65 HydrophobicContact CG2-CG 3.58Å; T62-R65 PolarHBondContact O-N 3.13Å; R65-P67 WeakPolarHBondContact O-CD 3.48Å
66	L	49.4	Very low	45.7	Very low	142 Å²	142	136.9 Å²	136.9	74%	0.743	72%	0.717	S	S	*	*	S	Bend	trans	-64.9	116.4	152.3	-82.6	167.4	0	0	0	106.4	L68	L66-L68 PolarHBondContact O-N 3Å
67	P	46.8	Very low	45.2	Very low	107 Å²	107	138.5 Å²	138.5	70%	0.695	74%	0.735	S	S	*	*			trans	-60.9	112.2	-179.2	22.6	-30	0	0	0	108.9	R65 T69	R65-P67 WeakPolarHBondContact O-CD 3.48Å; P67-T69 PolarHBondContact O-N 3.32Å
68	L	54.6	Low	44.9	Very low	170 Å²	170	136.4 Å²	136.4	89%	0.89	74%	0.74	S	S	*	*			trans	-69.3	85.5	155.5	-80.5	156.3	0	0	0	106.7	L66	L66-L68 PolarHBondContact O-N 3Å
69	T	38.7	Very low	44.3	Very low	108 Å²	108	135.1 Å²	135.1	66%	0.663	75%	0.746	S	S	*	*			trans	-155	98.9	161.5	42	0	0	0	0	106.3	P67	P67-T69 PolarHBondContact O-N 3.32Å
70	D	44.4	Very low	44.3	Very low	142 Å²	142	132.9 Å²	132.9	76%	0.759	75%	0.751	S	S	*	*				66.7	139.3	82.9	-78.8	-32.8	0	0	0	112.6
71	T	39.2	Very low	44.5	Very low	136 Å²	136	133.9 Å²	133.9	83%	0.834	76%	0.756	S	S	*	*			trans	85.7	121.1	174.9	74.8	0	0	0	0	114.3
72	S	39.6	Very low	44.4	Very low	103 Å²	103	140.7 Å²	140.7	72%	0.72	79%	0.789	S	S	*	*			cis	-167.4	158	7.8	-85.3	0	0	0	0	109.2	S74	S72-S74 PolarHBondContact O-N 2.82Å
73	P	48.5	Very low	44.4	Very low	107 Å²	107	144.2 Å²	144.2	70%	0.695	81%	0.807	S	S	*	*			trans	-80.6	120.7	-167.3	31.5	-32.1	0	0	0	111.5	K75	P73-K75 PolarHBondContact O-N 3.35Å
74	S	41.4	Very low	44.4	Very low	126 Å²	126	143.5 Å²	143.5	88%	0.881	81%	0.808	S	S	*	*			trans	-74.7	86	161.7	-171.2	0	0	0	0	108.9	S72 R76	S72-S74 PolarHBondContact O-N 2.82Å; S74-R76 PolarHBondContact O-N 3.22Å
75	K	45.2	Very low	44.1	Very low	188 Å²	188	142.7 Å²	142.7	82%	0.817	81%	0.806	S	S	*	*			trans	-65.6	106.9	163	-75	-177.2	177.1	179.2	0	108.6	P73	P73-K75 PolarHBondContact O-N 3.35Å
76	R	39.3	Very low	44.2	Very low	251 Å²	251	139.2 Å²	139.2	95%	0.947	81%	0.809	S	S	*	*			trans	-150.5	67.2	139	-106.8	-178.8	-165.6	-163.1	3.8	108.1	S74	S74-R76 PolarHBondContact O-N 3.22Å
77	C	39	Very low	43.9	Very low	132 Å²	132	139.1 Å²	139.1	89%	0.892	81%	0.813	S	S	*	*			trans	-101.4	133	162.7	-171.8	0	0	0	0	107.4
78	G	40.4	Very low	43.7	Very low	59 Å²	59	141.2 Å²	141.2	61%	0.608	82%	0.821	S	S	*	*			trans	82.4	139.6	170.2	0	0	0	0	0	113.3
79	T	39.8	Very low	42.9	Very low	136 Å²	136	139.1 Å²	139.1	83%	0.834	82%	0.816	S	S	*	*			cis	-169.5	135.9	23.1	29.8	0	0	0	0	107.5
80	S	47.8	Very low	43.2	Very low	121 Å²	121	141.5 Å²	141.5	85%	0.846	83%	0.828	S	S	*	*			trans	-140.5	92.4	146.4	-174.3	0	0	0	0	107
81	P	52.4	Low	43.1	Very low	102 Å²	102	141.5 Å²	141.5	66%	0.662	83%	0.834	S	S	*	*			trans	-77.6	129.6	163.7	32	-27.7	0	0	0	107.9
82	N	44.9	Very low	43.5	Very low	237 Å²	237	142 Å²	142	100%	1.267	83%	0.834	S	S	*	*			trans	23.1	0	156.8	-64.6	-11.5	0	0	0	118.6

Retrieved 82 of 82 residues in 102.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).