A0A3Q0KTE3_SCHMA Loading...

U6 snRNA-associated Sm-like protein LSm8

Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A3Q0KTE3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene LSM8, Length 96 aa.

						>A0A3Q0KTE3_SCHMA|A0A3Q0KTE3|LSM8
MASELEAYVGRMVNVITSDGRTIVGTLKGFDNVVNLVIKDSHERVFSPTEGVEQVPLGLFIIRGQNVAVVGELDEDLDRRIDFSQLRAEPLNPVVH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.7	Low	86.5	Confident	173 Å²	173	85.5 Å²	85.5	85%	0.852	48%	0.477	S	S	*	.				0	-93.2	0	-63.5	-76.2	-96.5	0	0	110.7	S3 E4	M1-S3 VanDerWaalsContact C-N 3.26Å; M1-S3 PolarHBondContact O-N 2.89Å; M1-E4 PolarHBondContact N-OE1 2.59Å; M1-E4 PolarHBondContact O-N 3.37Å; M1-E4 VanDerWaalsContact O-N 3.14Å
2	A	60.2	Low	87.5	Confident	53 Å²	53	81.8 Å²	81.8	44%	0.438	45%	0.454	S	S	.	.	H	α-helix	trans	-59.5	-34	-177.7	0	0	0	0	0	113.8	E4 F30	A2-E4 VanDerWaalsContact C-N 3.28Å; A2-E4 PolarHBondContact O-N 2.82Å; A2-F30 HydrophobicContact CB-CE2 4.14Å; A2-F30 VanDerWaalsContact O-CE2 3.3Å; A2-F30 WeakPolarHBondContact O-CE2 3.29Å; A2-F30 WeakPolarHBondContact O-CZ 3.32Å
3	S	71.4	Confident	88.4	Confident	87 Å²	87	75.5 Å²	75.5	61%	0.608	42%	0.419	S	S	*	.	H	α-helix	trans	-66.4	-23	179.4	55.2	0	0	0	0	114.8	M1	M1-S3 VanDerWaalsContact C-N 3.26Å; M1-S3 PolarHBondContact O-N 2.89Å
4	E	87.6	Confident	89.1	Confident	130 Å²	130	72.6 Å²	72.6	61%	0.607	40%	0.403	S	S	*	.	H	α-helix	trans	-84	-37.7	-176.6	-72.6	152.7	-116.5	0	0	111.4	M1 A2 E6 A7	M1-E4 PolarHBondContact N-OE1 2.59Å; M1-E4 PolarHBondContact O-N 3.37Å; M1-E4 VanDerWaalsContact O-N 3.14Å; A2-E4 VanDerWaalsContact C-N 3.28Å; A2-E4 PolarHBondContact O-N 2.82Å; E4-E6 VanDerWaalsContact C-N 3.28Å; E4-E6 PolarHBondContact O-N 3.34Å; E4-A7 WeakPolarHBondContact O-CB 3.05Å; E4-A7 PolarHBondContact O-N 3.47Å
5	L	94.6	Very high	89.7	Confident	19 Å²	19	67.8 Å²	67.8	10%	0.099	38%	0.376	C	S	.	.	H	α-helix	trans	-71	-23.4	177	-71.8	174.8	0	0	0	113	A7 Y8 V9 F30 V34 L36 V70	L5-A7 PolarHBondContact O-N 3.47Å; L5-Y8 HydrophobicContact CD2-CD2 3.98Å; L5-Y8 WeakPolarHBondContact O-CB 3.22Å; L5-Y8 PolarHBondContact O-N 3.33Å; L5-V9 PolarHBondContact O-N 3.12Å; L5-F30 HydrophobicContact CB-CD1 3.89Å; L5-F30 HydrophobicContact CB-CD2 4.08Å; L5-F30 HydrophobicContact CB-CE1 3.77Å; L5-F30 HydrophobicContact CB-CE2 3.95Å; L5-F30 HydrophobicContact CB-CG 4.06Å; L5-F30 HydrophobicContact CB-CZ 3.8Å; L5-F30 HydrophobicContact CD1-CB 4.47Å; L5-F30 HydrophobicContact CD1-CD2 4.08Å; L5-F30 HydrophobicContact CD1-CG 4.19Å; L5-V34 HydrophobicContact CD1-CG1 3.82Å; L5-V34 HydrophobicContact CD1-CG2 4.46Å; L5-L36 HydrophobicContact CD1-CD2 4.35Å; L5-V70 HydrophobicContact CD2-CB 3.91Å; L5-V70 HydrophobicContact CD2-CG1 3.85Å; L5-V70 HydrophobicContact CD2-CG2 4.17Å
6	E	95.5	Very high	90.2	Very high	138 Å²	138	66.6 Å²	66.6	65%	0.645	37%	0.368	S	S	*	.	G	3₁₀ helix	trans	-56.4	-36.5	174.5	-169.4	170.7	-170.3	0	0	111.5	E4 Y8 V9 F30	E4-E6 VanDerWaalsContact C-N 3.28Å; E4-E6 PolarHBondContact O-N 3.34Å; E6-Y8 PolarHBondContact O-N 3.19Å; E6-V9 PolarHBondContact O-N 3.39Å; E6-F30 HydrophobicContact CB-CE1 4.45Å; E6-F30 HydrophobicContact CB-CZ 4.17Å
7	A	95.6	Very high	90.7	Very high	50 Å²	50	63.2 Å²	63.2	41%	0.413	35%	0.349	S	S	.	.	G	3₁₀ helix	trans	-64.3	-22.4	176.6	0	0	0	0	0	113.5	E4 L5 R11	E4-A7 WeakPolarHBondContact O-CB 3.05Å; E4-A7 PolarHBondContact O-N 3.47Å; L5-A7 PolarHBondContact O-N 3.47Å; A7-R11 VanDerWaalsContact O-CZ 3.3Å; A7-R11 PolarHBondContact O-NE 3.45Å
8	Y	97.2	Very high	91	Very high	62 Å²	62	61.2 Å²	61.2	24%	0.243	34%	0.34	C	S	.	.	G	3₁₀ helix	trans	-94.3	-8.5	-177.9	-61.4	-10.7	0	0	0	113	L5 E6 G10 R11 V13 V70 E72	L5-Y8 HydrophobicContact CD2-CD2 3.98Å; L5-Y8 WeakPolarHBondContact O-CB 3.22Å; L5-Y8 PolarHBondContact O-N 3.33Å; E6-Y8 PolarHBondContact O-N 3.19Å; Y8-G10 PolarHBondContact O-N 3.04Å; Y8-R11 WeakPolarHBondContact O-CB 3.29Å; Y8-R11 PolarHBondContact O-N 3.13Å; Y8-V13 HydrophobicContact CD2-CG1 4.27Å; Y8-V13 HydrophobicContact CG-CG1 4.3Å; Y8-V70 HydrophobicContact CD2-CG1 3.96Å; Y8-V70 HydrophobicContact CE2-CG1 4.37Å; Y8-E72 HydrophobicContact CD1-CB 3.92Å; Y8-E72 HydrophobicContact CD1-CG 4.49Å; Y8-E72 HydrophobicContact CE1-CB 3.64Å; Y8-E72 HydrophobicContact CG-CB 4.49Å
9	V	97.4	Very high	91.3	Very high	66 Å²	66	62.8 Å²	62.8	40%	0.4	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.3	127.5	178.5	177.2	0	0	0	0	110	L5 E6 R11 L27 F30	L5-V9 PolarHBondContact O-N 3.12Å; E6-V9 PolarHBondContact O-N 3.39Å; V9-R11 VanDerWaalsContact C-N 3.27Å; V9-R11 PolarHBondContact O-N 3.27Å; V9-L27 HydrophobicContact CG2-CD2 4.41Å; V9-F30 HydrophobicContact CG2-CD1 4.03Å; V9-F30 HydrophobicContact CG2-CE1 3.69Å
10	G	97.8	Very high	91.6	Very high	50 Å²	50	60.3 Å²	60.3	52%	0.515	34%	0.337	S	S	.	.	T	Hydrogen-bonded Turn	trans	82.2	-3.8	-176.5	0	0	0	0	0	114.7	Y8 L27	Y8-G10 PolarHBondContact O-N 3.04Å; G10-L27 PolarHBondContact N-O 3.04Å
11	R	98	Very high	91.9	Very high	113 Å²	113	61.4 Å²	61.4	43%	0.426	34%	0.336	S	S	.	.	S	Bend	trans	-99.3	161	177.9	-52.5	-164.4	-172.2	177.3	5.1	111.8	A7 Y8 V9 T26 L27 E72	A7-R11 VanDerWaalsContact O-CZ 3.3Å; A7-R11 PolarHBondContact O-NE 3.45Å; Y8-R11 WeakPolarHBondContact O-CB 3.29Å; Y8-R11 PolarHBondContact O-N 3.13Å; V9-R11 VanDerWaalsContact C-N 3.27Å; V9-R11 PolarHBondContact O-N 3.27Å; R11-T26 WeakPolarHBondContact O-CA 3.46Å; R11-L27 PolarHBondContact O-N 3.23Å; R11-L27 VanDerWaalsContact O-N 3.1Å; R11-E72 WeakPolarHBondContact CD-OE1 3.25Å; R11-E72 IonicContact CZ-OE1 3.69Å; R11-E72 IonicContact NE-OE1 3.63Å; R11-E72 VanDerWaalsContact NH1-CD 3.26Å; R11-E72 IonicContact NH1-OE1 3.12Å; R11-E72 PolarHBondContact NH1-OE1 2.86Å; R11-E72 IonicContact NH1-OE2 2.78Å; R11-E72 PolarHBondContact NH1-OE2 2.87Å; R11-E72 VanDerWaalsContact NH1-OE2 3.12Å
12	M	98.3	Very high	93.9	Very high	41 Å²	41	53.5 Å²	53.5	20%	0.202	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.4	129.8	170.1	-165.7	171.5	-66.8	0	0	109.8	V24 G25 L73 E75	M12-V24 HydrophobicContact CG-CG1 4.13Å; M12-V24 HydrophobicContact SD-CG1 4.17Å; M12-G25 WeakPolarHBondContact CA-O 3.34Å; M12-L73 HydrophobicContact CB-CB 4.37Å; M12-L73 HydrophobicContact CG-CB 4.22Å; M12-L73 HydrophobicContact CG-CD1 4.07Å; M12-L73 PolarHBondContact O-N 2.83Å; M12-L73 HydrophobicContact SD-CD1 4.36Å; M12-E75 HydrophobicContact CB-CG 3.86Å; M12-E75 HydrophobicContact CE-CG 3.87Å; M12-E75 HydrophobicContact SD-CG 4Å
13	V	98.4	Very high	95.7	Very high	0 Å²	0	51 Å²	51	0%	0	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	150.4	178.9	-61.9	0	0	0	0	110.6	Y8 V15 V24 G25 L27 I38 V70 G71	Y8-V13 HydrophobicContact CD2-CG1 4.27Å; Y8-V13 HydrophobicContact CG-CG1 4.3Å; V13-V15 HydrophobicContact CG2-CG2 4.06Å; V13-V24 WeakPolarHBondContact O-CA 3.16Å; V13-G25 PolarHBondContact N-O 2.69Å; V13-G25 PolarHBondContact O-N 2.98Å; V13-G25 VanDerWaalsContact O-N 3.13Å; V13-L27 HydrophobicContact CG1-CB 4.07Å; V13-L27 HydrophobicContact CG2-CB 3.99Å; V13-I38 HydrophobicContact CG2-CD1 4.01Å; V13-V70 HydrophobicContact CB-CG1 4.1Å; V13-V70 HydrophobicContact CG1-CG1 4.2Å; V13-V70 HydrophobicContact CG2-CG1 4.48Å; V13-G71 CarbonylContact C-O 3.57Å; V13-G71 VanDerWaalsContact CA-O 3.24Å; V13-G71 WeakPolarHBondContact CA-O 3.45Å
14	N	98.2	Very high	97	Very high	35 Å²	35	46.9 Å²	46.9	19%	0.187	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	121.3	163.6	-171.6	-14.4	0	0	0	108.8	T22 V24 G71 L73	N14-T22 WeakPolarHBondContact OD1-CG2 3.42Å; N14-V24 HydrophobicContact CB-CG2 4.17Å; N14-G71 PolarHBondContact N-O 3.04Å; N14-G71 PolarHBondContact O-N 3.13Å; N14-L73 HydrophobicContact CB-CD1 3.87Å; N14-L73 HydrophobicContact CB-CD2 4.04Å; N14-L73 HydrophobicContact CB-CG 3.88Å
15	V	98.4	Very high	97.5	Very high	0 Å²	0	40.9 Å²	40.9	0%	0	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	119.9	176.5	-174.6	0	0	0	0	109	V13 I23 L36 I38 I62 V67 V69 V70	V13-V15 HydrophobicContact CG2-CG2 4.06Å; V15-I23 HydrophobicContact CB-CB 4.43Å; V15-I23 PolarHBondContact N-O 2.74Å; V15-I23 PolarHBondContact O-N 3.14Å; V15-L36 HydrophobicContact CG1-CD1 3.96Å; V15-L36 HydrophobicContact CG2-CD1 3.87Å; V15-I38 HydrophobicContact CG2-CD1 4.15Å; V15-I38 HydrophobicContact CG2-CG1 4.49Å; V15-I62 HydrophobicContact CB-CD1 4.02Å; V15-I62 HydrophobicContact CG1-CD1 3.72Å; V15-I62 HydrophobicContact CG2-CD1 4.24Å; V15-V67 HydrophobicContact CG1-CG1 4.2Å; V15-V69 CarbonylContact C-O 3.57Å; V15-V69 WeakPolarHBondContact CA-O 3.39Å; V15-V70 HydrophobicContact CG1-CG2 4.48Å; V15-V70 HydrophobicContact CG2-CG1 4.42Å; V15-V70 HydrophobicContact CG2-CG2 4.4Å
16	I	98.2	Very high	97.7	Very high	48 Å²	48	41.2 Å²	41.2	25%	0.246	22%	0.224	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	127.5	167.5	-57.6	173.8	0	0	0	107.7	R21 A68 V69 L91	I16-R21 WeakPolarHBondContact CA-O 3.35Å; I16-A68 WeakPolarHBondContact O-CA 3.49Å; I16-A68 WeakPolarHBondContact O-CB 3.42Å; I16-A68 PolarHBondContact O-N 3.15Å; I16-V69 HydrophobicContact CB-CB 4.15Å; I16-V69 HydrophobicContact CD1-CB 4.42Å; I16-V69 HydrophobicContact CG1-CB 4.5Å; I16-V69 PolarHBondContact N-O 2.9Å; I16-V69 PolarHBondContact O-N 3.1Å; I16-V69 VanDerWaalsContact O-N 3.1Å; I16-L91 HydrophobicContact CD1-CD1 4Å; I16-L91 HydrophobicContact CG1-CD1 4.3Å; I16-L91 HydrophobicContact CG2-CD1 3.94Å
17	T	97.8	Very high	97.8	Very high	9 Å²	9	34.6 Å²	34.6	6%	0.055	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94	160.3	178.2	49.1	0	0	0	0	111.3	D19 G20 R21 I23 I62 N66	T17-D19 WeakPolarHBondContact CB-OD1 3.41Å; T17-D19 PolarHBondContact O-N 3.23Å; T17-D19 PolarHBondContact OG1-OD1 3.06Å; T17-G20 PolarHBondContact O-N 3.4Å; T17-R21 PolarHBondContact N-O 3Å; T17-R21 WeakPolarHBondContact OG1-CA 3.26Å; T17-R21 VanDerWaalsContact OG1-CB 3.23Å; T17-R21 WeakPolarHBondContact OG1-CB 3.46Å; T17-R21 PolarHBondContact OG1-N 3.32Å; T17-R21 VanDerWaalsContact OG1-N 3.12Å; T17-R21 PolarHBondContact OG1-O 3.3Å; T17-I23 HydrophobicContact CG2-CD1 3.96Å; T17-I62 HydrophobicContact CG2-CG2 4.13Å; T17-N66 CarbonylContact C-O 3.6Å; T17-N66 WeakPolarHBondContact CA-O 3.4Å; T17-N66 WeakPolarHBondContact CB-O 3.4Å
18	S	97.1	Very high	98	Very high	27 Å²	27	37.1 Å²	37.1	19%	0.189	20%	0.195	C	C	.	.	T	Hydrogen-bonded Turn	trans	-64.7	-20.4	-176.3	55.6	0	0	0	0	114	G20 N66 P93 V94	S18-G20 VanDerWaalsContact C-N 3.34Å; S18-N66 PolarHBondContact N-O 3.19Å; S18-N66 WeakPolarHBondContact OG-CA 3.31Å; S18-P93 CarbonylContact O-C 3.52Å; S18-P93 VanDerWaalsContact O-CA 3.26Å; S18-P93 WeakPolarHBondContact O-CA 3.24Å; S18-P93 WeakPolarHBondContact O-CB 3.16Å; S18-V94 PolarHBondContact O-N 3.16Å
19	D	96.7	Very high	98	Very high	93 Å²	93	35.1 Å²	35.1	50%	0.497	19%	0.193	S	C	.	.	T	Hydrogen-bonded Turn	trans	-89.9	6.4	173.3	64.3	-12.7	0	0	0	113.4	T17 R21	T17-D19 WeakPolarHBondContact CB-OD1 3.41Å; T17-D19 PolarHBondContact O-N 3.23Å; T17-D19 PolarHBondContact OG1-OD1 3.06Å; D19-R21 VanDerWaalsContact OD2-CD 3.3Å; D19-R21 WeakPolarHBondContact OD2-CD 3.47Å
20	G	97	Very high	98	Very high	12 Å²	12	34.7 Å²	34.7	12%	0.124	19%	0.186	C	C	.	.	S	Bend	trans	91.2	6.8	173.7	0	0	0	0	0	115.1	T17 S18	T17-G20 PolarHBondContact O-N 3.4Å; S18-G20 VanDerWaalsContact C-N 3.34Å
21	R	97.8	Very high	97.9	Very high	84 Å²	84	35.1 Å²	35.1	32%	0.317	18%	0.177	S	C	.	.			trans	-82.5	145.7	179.6	-53.4	167.1	62.6	-165.6	-0.7	111.6	I16 T17 D19 E43	I16-R21 WeakPolarHBondContact CA-O 3.35Å; T17-R21 PolarHBondContact N-O 3Å; T17-R21 WeakPolarHBondContact OG1-CA 3.26Å; T17-R21 VanDerWaalsContact OG1-CB 3.23Å; T17-R21 WeakPolarHBondContact OG1-CB 3.46Å; T17-R21 PolarHBondContact OG1-N 3.32Å; T17-R21 VanDerWaalsContact OG1-N 3.12Å; T17-R21 PolarHBondContact OG1-O 3.3Å; D19-R21 VanDerWaalsContact OD2-CD 3.3Å; D19-R21 WeakPolarHBondContact OD2-CD 3.47Å; R21-E43 WeakPolarHBondContact CB-OE1 3.42Å; R21-E43 WeakPolarHBondContact CG-OE1 3.48Å; R21-E43 IonicContact CZ-OE1 3.65Å; R21-E43 IonicContact CZ-OE2 2.81Å; R21-E43 IonicContact NE-OE1 3.43Å; R21-E43 PolarHBondContact NE-OE1 2.83Å; R21-E43 IonicContact NE-OE2 3.44Å; R21-E43 PolarHBondContact NE-OE2 2.91Å; R21-E43 IonicContact NH2-OE1 3.38Å; R21-E43 IonicContact NH2-OE2 2.67Å; R21-E43 PolarHBondContact NH2-OE2 2.86Å
22	T	98.2	Very high	97.7	Very high	6 Å²	6	36.6 Å²	36.6	4%	0.037	19%	0.193	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	113.3	-179.7	-58.9	0	0	0	0	109.7	N14 E43 R44 F46	N14-T22 WeakPolarHBondContact OD1-CG2 3.42Å; T22-E43 CarbonylContact O-C 3.54Å; T22-E43 VanDerWaalsContact O-CA 3.32Å; T22-E43 WeakPolarHBondContact O-CA 3.15Å; T22-R44 HydrophobicContact CG2-CB 4.06Å; T22-R44 PolarHBondContact O-N 3.48Å; T22-F46 HydrophobicContact CG2-CE2 4.07Å
23	I	98.6	Very high	97.5	Very high	1 Å²	1	38.6 Å²	38.6	1%	0.005	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	123.6	-178.2	-61.4	163.4	0	0	0	109	V15 T17 L57 F60 I62	V15-I23 HydrophobicContact CB-CB 4.43Å; V15-I23 PolarHBondContact N-O 2.74Å; V15-I23 PolarHBondContact O-N 3.14Å; T17-I23 HydrophobicContact CG2-CD1 3.96Å; I23-L57 HydrophobicContact CG1-CD1 4.27Å; I23-L57 HydrophobicContact CG2-CD1 4.2Å; I23-F60 HydrophobicContact CD1-CD1 3.96Å; I23-F60 HydrophobicContact CD1-CE1 3.58Å; I23-I62 HydrophobicContact CB-CD1 4.39Å; I23-I62 HydrophobicContact CD1-CD1 3.67Å; I23-I62 HydrophobicContact CD1-CG1 4.21Å; I23-I62 HydrophobicContact CG2-CD1 4.35Å
24	V	98.6	Very high	97.4	Very high	1 Å²	1	40.5 Å²	40.5	1%	0.006	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	136.6	178.1	174.8	0	0	0	0	109.9	M12 V13 N14 S41 H42 R44 L73	M12-V24 HydrophobicContact CG-CG1 4.13Å; M12-V24 HydrophobicContact SD-CG1 4.17Å; V13-V24 WeakPolarHBondContact O-CA 3.16Å; N14-V24 HydrophobicContact CB-CG2 4.17Å; V24-S41 CarbonylContact O-C 3.42Å; V24-S41 WeakPolarHBondContact O-CA 3.39Å; V24-H42 PolarHBondContact N-O 3.46Å; V24-H42 PolarHBondContact O-N 2.67Å; V24-R44 HydrophobicContact CG2-CG 4.39Å; V24-L73 HydrophobicContact CB-CD1 4.44Å; V24-L73 HydrophobicContact CG1-CD1 3.61Å; V24-L73 HydrophobicContact CG2-CD1 4.01Å
25	G	98.5	Very high	97.4	Very high	4 Å²	4	41.1 Å²	41.1	4%	0.041	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	175.8	-169.9	174.3	0	0	0	0	0	112.1	M12 V13	M12-G25 WeakPolarHBondContact CA-O 3.34Å; V13-G25 PolarHBondContact N-O 2.69Å; V13-G25 PolarHBondContact O-N 2.98Å; V13-G25 VanDerWaalsContact O-N 3.13Å
26	T	98.5	Very high	97.4	Very high	25 Å²	25	41.1 Å²	41.1	15%	0.153	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	123.1	179	-56.8	0	0	0	0	111.1	R11 K28 I38 K39	R11-T26 WeakPolarHBondContact O-CA 3.46Å; T26-K28 HydrophobicContact CG2-CD 4.19Å; T26-K28 PolarHBondContact O-N 2.91Å; T26-I38 WeakPolarHBondContact O-CA 3.4Å; T26-K39 PolarHBondContact N-O 2.89Å; T26-K39 PolarHBondContact O-N 3.12Å
27	L	98.5	Very high	97.4	Very high	0 Å²	0	41.1 Å²	41.1	0%	0	22%	0.224	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-68.5	117.6	173.3	179.8	63.3	0	0	0	109.9	V9 G10 R11 V13 G29 F30 L36 I38	V9-L27 HydrophobicContact CG2-CD2 4.41Å; G10-L27 PolarHBondContact N-O 3.04Å; R11-L27 PolarHBondContact O-N 3.23Å; R11-L27 VanDerWaalsContact O-N 3.1Å; V13-L27 HydrophobicContact CG1-CB 4.07Å; V13-L27 HydrophobicContact CG2-CB 3.99Å; L27-G29 WeakPolarHBondContact CD1-O 3.49Å; L27-F30 HydrophobicContact CD2-CD1 4.36Å; L27-L36 HydrophobicContact CD1-CB 4.3Å; L27-L36 HydrophobicContact CD1-CD2 4.1Å; L27-I38 HydrophobicContact CB-CD1 4.39Å; L27-I38 HydrophobicContact CD1-CD1 3.73Å
28	K	98.2	Very high	97.4	Very high	102 Å²	102	40.7 Å²	40.7	44%	0.443	22%	0.222	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-98.8	-26.6	177.8	-69.5	-52.3	-172.5	-170	0	114.2	T26 V37 K39	T26-K28 HydrophobicContact CG2-CD 4.19Å; T26-K28 PolarHBondContact O-N 2.91Å; K28-V37 HydrophobicContact CB-CB 4.45Å; K28-V37 HydrophobicContact CB-CG1 4.21Å; K28-V37 PolarHBondContact N-O 2.69Å; K28-K39 HydrophobicContact CD-CB 4.26Å; K28-K39 HydrophobicContact CD-CD 4.37Å; K28-K39 HydrophobicContact CG-CB 3.52Å; K28-K39 HydrophobicContact CG-CD 4.29Å; K28-K39 HydrophobicContact CG-CG 4.48Å
29	G	97.4	Very high	97.5	Very high	21 Å²	21	43.3 Å²	43.3	22%	0.216	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-177	162.5	178.8	0	0	0	0	0	111	L27 V37	L27-G29 WeakPolarHBondContact CD1-O 3.49Å; G29-V37 PolarHBondContact O-N 2.81Å
30	F	97.8	Very high	97.5	Very high	57 Å²	57	43.7 Å²	43.7	25%	0.25	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-147.3	167.7	175.4	63.7	-82.6	0	0	0	109.8	A2 L5 E6 V9 L27 N35 L36	A2-F30 HydrophobicContact CB-CE2 4.14Å; A2-F30 VanDerWaalsContact O-CE2 3.3Å; A2-F30 WeakPolarHBondContact O-CE2 3.29Å; A2-F30 WeakPolarHBondContact O-CZ 3.32Å; L5-F30 HydrophobicContact CB-CD1 3.89Å; L5-F30 HydrophobicContact CB-CD2 4.08Å; L5-F30 HydrophobicContact CB-CE1 3.77Å; L5-F30 HydrophobicContact CB-CE2 3.95Å; L5-F30 HydrophobicContact CB-CG 4.06Å; L5-F30 HydrophobicContact CB-CZ 3.8Å; L5-F30 HydrophobicContact CD1-CB 4.47Å; L5-F30 HydrophobicContact CD1-CD2 4.08Å; L5-F30 HydrophobicContact CD1-CG 4.19Å; E6-F30 HydrophobicContact CB-CE1 4.45Å; E6-F30 HydrophobicContact CB-CZ 4.17Å; V9-F30 HydrophobicContact CG2-CD1 4.03Å; V9-F30 HydrophobicContact CG2-CE1 3.69Å; L27-F30 HydrophobicContact CD2-CD1 4.36Å; F30-N35 WeakPolarHBondContact CA-O 3.02Å; F30-L36 HydrophobicContact CB-CD2 3.83Å
31	D	96.2	Very high	97.6	Very high	59 Å²	59	43.3 Å²	43.3	32%	0.316	23%	0.227	S	C	.	.			trans	-120.5	-178.3	171.2	68.4	14.7	0	0	0	112.3	V33 V34 N35	D31-V33 PolarHBondContact O-N 3.33Å; D31-V33 VanDerWaalsContact O-N 3.16Å; D31-V33 WeakPolarHBondContact OD1-CG2 3.1Å; D31-V33 PolarHBondContact OD1-N 3.34Å; D31-V34 PolarHBondContact O-N 2.93Å; D31-V34 PolarHBondContact OD1-N 2.81Å; D31-V34 VanDerWaalsContact OD1-N 3.1Å; D31-N35 PolarHBondContact N-O 2.82Å; D31-N35 WeakPolarHBondContact OD1-CB 3.36Å; D31-N35 PolarHBondContact OD1-N 3.44Å; D31-N35 PolarHBondContact OD1-ND2 2.86Å; D31-N35 WeakPolarHBondContact OD2-CB 3.24Å; D31-N35 PolarHBondContact OD2-ND2 3.45Å
32	N	93.6	Very high	97.6	Very high	144 Å²	144	41 Å²	41	77%	0.77	22%	0.22	S	C	*	.	T	Hydrogen-bonded Turn	trans	-66.7	-12.5	-177	66.3	-31.9	0	0	0	114.4
33	V	94.4	Very high	97.7	Very high	83 Å²	83	42 Å²	42	50%	0.503	22%	0.224	S	C	.	.	T	Hydrogen-bonded Turn	trans	-107.9	13.6	174.8	-61	0	0	0	0	112.1	D31 N35 G64	D31-V33 PolarHBondContact O-N 3.33Å; D31-V33 VanDerWaalsContact O-N 3.16Å; D31-V33 WeakPolarHBondContact OD1-CG2 3.1Å; D31-V33 PolarHBondContact OD1-N 3.34Å; V33-N35 VanDerWaalsContact C-N 3.29Å; V33-N35 WeakPolarHBondContact CG2-ND2 3.3Å; V33-N35 PolarHBondContact O-N 2.91Å; V33-G64 WeakPolarHBondContact O-CA 3.45Å
34	V	95.8	Very high	97.6	Very high	40 Å²	40	42.5 Å²	42.5	24%	0.242	23%	0.226	C	C	.	.			trans	66.2	28.1	175.6	-163.4	0	0	0	0	112.4	L5 D31 L36 G64 V67	L5-V34 HydrophobicContact CD1-CG1 3.82Å; L5-V34 HydrophobicContact CD1-CG2 4.46Å; D31-V34 PolarHBondContact O-N 2.93Å; D31-V34 PolarHBondContact OD1-N 2.81Å; D31-V34 VanDerWaalsContact OD1-N 3.1Å; V34-L36 HydrophobicContact CG1-CD2 3.88Å; V34-L36 HydrophobicContact CG1-CG 4.41Å; V34-L36 WeakPolarHBondContact O-CG 3.38Å; V34-L36 PolarHBondContact O-N 2.95Å; V34-G64 VanDerWaalsContact C-CA 3.43Å; V34-G64 WeakPolarHBondContact O-CA 3.5Å; V34-V67 HydrophobicContact CG1-CB 4.4Å; V34-V67 HydrophobicContact CG1-CG1 4.18Å
35	N	97.4	Very high	97.6	Very high	47 Å²	47	45.1 Å²	45.1	25%	0.251	24%	0.242	S	C	.	.			trans	-65.6	128.9	162.3	-63	-47.2	0	0	0	108.1	F30 D31 V33 I62 R63 G64	F30-N35 WeakPolarHBondContact CA-O 3.02Å; D31-N35 PolarHBondContact N-O 2.82Å; D31-N35 WeakPolarHBondContact OD1-CB 3.36Å; D31-N35 PolarHBondContact OD1-N 3.44Å; D31-N35 PolarHBondContact OD1-ND2 2.86Å; D31-N35 WeakPolarHBondContact OD2-CB 3.24Å; D31-N35 PolarHBondContact OD2-ND2 3.45Å; V33-N35 VanDerWaalsContact C-N 3.29Å; V33-N35 WeakPolarHBondContact CG2-ND2 3.3Å; V33-N35 PolarHBondContact O-N 2.91Å; N35-I62 CarbonylContact C-O 3.51Å; N35-I62 WeakPolarHBondContact CA-O 3.34Å; N35-R63 VanDerWaalsContact OD1-CA 3.31Å; N35-R63 WeakPolarHBondContact OD1-CA 3.37Å; N35-G64 PolarHBondContact OD1-N 2.96Å
36	L	98.2	Very high	97.6	Very high	0 Å²	0	47.1 Å²	47.1	0%	0	25%	0.25	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	138.1	-173.8	-52.3	179	0	0	0	110.9	L5 V15 L27 F30 V34 I38 I61 I62 V67 V70	L5-L36 HydrophobicContact CD1-CD2 4.35Å; V15-L36 HydrophobicContact CG1-CD1 3.96Å; V15-L36 HydrophobicContact CG2-CD1 3.87Å; L27-L36 HydrophobicContact CD1-CB 4.3Å; L27-L36 HydrophobicContact CD1-CD2 4.1Å; F30-L36 HydrophobicContact CB-CD2 3.83Å; V34-L36 HydrophobicContact CG1-CD2 3.88Å; V34-L36 HydrophobicContact CG1-CG 4.41Å; V34-L36 WeakPolarHBondContact O-CG 3.38Å; V34-L36 PolarHBondContact O-N 2.95Å; L36-I38 HydrophobicContact CB-CD1 3.91Å; L36-I38 HydrophobicContact CB-CG1 4.28Å; L36-I38 HydrophobicContact CD1-CD1 4.42Å; L36-I61 CarbonylContact O-C 3.54Å; L36-I61 VanDerWaalsContact O-CA 3.29Å; L36-I61 WeakPolarHBondContact O-CA 3.48Å; L36-I62 HydrophobicContact CB-CB 4.33Å; L36-I62 PolarHBondContact N-O 3.27Å; L36-I62 PolarHBondContact O-N 3.1Å; L36-V67 HydrophobicContact CD1-CG1 4.17Å; L36-V67 HydrophobicContact CD1-CG2 3.83Å; L36-V67 HydrophobicContact CG-CG2 4.13Å; L36-V70 HydrophobicContact CD1-CG2 3.67Å
37	V	98.4	Very high	97.5	Very high	49 Å²	49	47 Å²	47	30%	0.297	25%	0.25	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	111	166.6	-176.9	0	0	0	0	108.2	K28 G29 L59 I61	K28-V37 HydrophobicContact CB-CB 4.45Å; K28-V37 HydrophobicContact CB-CG1 4.21Å; K28-V37 PolarHBondContact N-O 2.69Å; G29-V37 PolarHBondContact O-N 2.81Å; V37-L59 HydrophobicContact CG1-CD1 3.68Å; V37-I61 HydrophobicContact CG2-CG1 4.47Å
38	I	98.7	Very high	97.4	Very high	0 Å²	0	50 Å²	50	0%	0	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	120.4	-179.5	-47	-58.5	0	0	0	109	V13 V15 T26 L27 L36 F60 I62	V13-I38 HydrophobicContact CG2-CD1 4.01Å; V15-I38 HydrophobicContact CG2-CD1 4.15Å; V15-I38 HydrophobicContact CG2-CG1 4.49Å; T26-I38 WeakPolarHBondContact O-CA 3.4Å; L27-I38 HydrophobicContact CB-CD1 4.39Å; L27-I38 HydrophobicContact CD1-CD1 3.73Å; L36-I38 HydrophobicContact CB-CD1 3.91Å; L36-I38 HydrophobicContact CB-CG1 4.28Å; L36-I38 HydrophobicContact CD1-CD1 4.42Å; I38-F60 PolarHBondContact N-O 2.83Å; I38-F60 PolarHBondContact O-N 2.9Å; I38-I62 HydrophobicContact CG1-CD1 4.03Å
39	K	98.6	Very high	97.4	Very high	82 Å²	82	50.3 Å²	50.3	36%	0.357	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	151.9	177.3	-171.7	-172.9	178	-84.4	0	110.5	T26 K28 S41 L59	T26-K39 PolarHBondContact N-O 2.89Å; T26-K39 PolarHBondContact O-N 3.12Å; K28-K39 HydrophobicContact CD-CB 4.26Å; K28-K39 HydrophobicContact CD-CD 4.37Å; K28-K39 HydrophobicContact CG-CB 3.52Å; K28-K39 HydrophobicContact CG-CD 4.29Å; K28-K39 HydrophobicContact CG-CG 4.48Å; K39-S41 PolarHBondContact O-N 2.78Å; K39-L59 HydrophobicContact CB-CD1 4.19Å; K39-L59 HydrophobicContact CG-CD1 4.5Å
40	D	98.2	Very high	97.4	Very high	101 Å²	101	55.6 Å²	55.6	54%	0.54	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	53.5	39.9	177.6	-51.2	-38	0	0	0	111.2	G58	D40-G58 PolarHBondContact N-O 3.13Å; D40-G58 VanDerWaalsContact N-O 3.13Å
41	S	98.4	Very high	97.4	Very high	3 Å²	3	54 Å²	54	2%	0.021	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	150	-171.3	59.1	0	0	0	0	113	V24 K39 L57 G58 F60	V24-S41 CarbonylContact O-C 3.42Å; V24-S41 WeakPolarHBondContact O-CA 3.39Å; K39-S41 PolarHBondContact O-N 2.78Å; S41-L57 PolarHBondContact O-N 3.1Å; S41-L57 WeakPolarHBondContact OG-CB 3.42Å; S41-G58 PolarHBondContact N-O 3.38Å; S41-G58 PolarHBondContact O-N 2.76Å; S41-G58 PolarHBondContact OG-O 2.87Å; S41-F60 VanDerWaalsContact OG-CB 3.25Å; S41-F60 WeakPolarHBondContact OG-CB 3.11Å
42	H	98.5	Very high	97.5	Very high	35 Å²	35	51.7 Å²	51.7	16%	0.162	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	150.8	168	63	-81.5	0	0	0	109.8	V24 R44 V55	V24-H42 PolarHBondContact N-O 3.46Å; V24-H42 PolarHBondContact O-N 2.67Å; H42-R44 PolarHBondContact NE2-NE 2.82Å; H42-V55 CarbonylContact C-O 3.54Å; H42-V55 WeakPolarHBondContact CA-O 3.4Å; H42-V55 WeakPolarHBondContact CB-O 3.35Å
43	E	98.5	Very high	97.6	Very high	28 Å²	28	50.7 Å²	50.7	13%	0.131	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	139.4	169.1	179	171.6	-164.4	0	0	110.1	R21 T22 V45 Q54 V55 L57	R21-E43 WeakPolarHBondContact CB-OE1 3.42Å; R21-E43 WeakPolarHBondContact CG-OE1 3.48Å; R21-E43 IonicContact CZ-OE1 3.65Å; R21-E43 IonicContact CZ-OE2 2.81Å; R21-E43 IonicContact NE-OE1 3.43Å; R21-E43 PolarHBondContact NE-OE1 2.83Å; R21-E43 IonicContact NE-OE2 3.44Å; R21-E43 PolarHBondContact NE-OE2 2.91Å; R21-E43 IonicContact NH2-OE1 3.38Å; R21-E43 IonicContact NH2-OE2 2.67Å; R21-E43 PolarHBondContact NH2-OE2 2.86Å; T22-E43 CarbonylContact O-C 3.54Å; T22-E43 VanDerWaalsContact O-CA 3.32Å; T22-E43 WeakPolarHBondContact O-CA 3.15Å; E43-V45 HydrophobicContact CG-CG2 3.95Å; E43-Q54 CarbonylContact O-C 3.47Å; E43-Q54 VanDerWaalsContact O-CA 3.29Å; E43-Q54 WeakPolarHBondContact O-CA 3.23Å; E43-V55 HydrophobicContact CB-CB 4.37Å; E43-V55 PolarHBondContact N-O 2.86Å; E43-V55 PolarHBondContact O-N 2.82Å; E43-L57 HydrophobicContact CB-CD1 4.17Å
44	R	98	Very high	97.8	Very high	11 Å²	11	51.3 Å²	51.3	4%	0.042	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	110.4	168.9	-69.5	179.5	179.7	176.8	-3.5	108.8	T22 V24 H42 F46 V52 E53 D78	T22-R44 HydrophobicContact CG2-CB 4.06Å; T22-R44 PolarHBondContact O-N 3.48Å; V24-R44 HydrophobicContact CG2-CG 4.39Å; H42-R44 PolarHBondContact NE2-NE 2.82Å; R44-F46 HydrophobicContact CB-CE2 3.84Å; R44-F46 HydrophobicContact CB-CZ 4.19Å; R44-V52 HydrophobicContact CB-CG1 3.84Å; R44-V52 HydrophobicContact CG-CG1 4.26Å; R44-E53 WeakPolarHBondContact CA-O 3.42Å; R44-D78 IonicContact CZ-OD1 3.25Å; R44-D78 VanDerWaalsContact CZ-OD1 3.25Å; R44-D78 IonicContact CZ-OD2 3.77Å; R44-D78 IonicContact NH1-OD1 2.74Å; R44-D78 PolarHBondContact NH1-OD1 3.12Å; R44-D78 IonicContact NH2-OD1 2.69Å; R44-D78 PolarHBondContact NH2-OD1 2.79Å; R44-D78 IonicContact NH2-OD2 3.57Å; R44-D78 PolarHBondContact NH2-OD2 3.2Å
45	V	98	Very high	97.9	Very high	57 Å²	57	51.6 Å²	51.6	35%	0.345	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	112.8	178.6	-174.3	0	0	0	0	108.8	E43 V52 E53 V55	E43-V45 HydrophobicContact CG-CG2 3.95Å; V45-V52 WeakPolarHBondContact O-CA 3.35Å; V45-E53 HydrophobicContact CB-CB 4.26Å; V45-E53 PolarHBondContact N-O 3.25Å; V45-E53 PolarHBondContact O-N 2.86Å; V45-E53 VanDerWaalsContact O-N 3.14Å; V45-V55 HydrophobicContact CG2-CG2 4.17Å
46	F	97.6	Very high	97.9	Very high	46 Å²	46	54.6 Å²	54.6	20%	0.202	30%	0.298	C	S	.	.			trans	-88.8	139.6	180	-65	-91.1	0	0	0	110.8	T22 R44 V52 L86 A88	T22-F46 HydrophobicContact CG2-CE2 4.07Å; R44-F46 HydrophobicContact CB-CE2 3.84Å; R44-F46 HydrophobicContact CB-CZ 4.19Å; F46-V52 HydrophobicContact CD1-CG2 3.43Å; F46-V52 VanDerWaalsContact CD1-CG2 3.43Å; F46-V52 HydrophobicContact CE1-CG1 4.4Å; F46-V52 HydrophobicContact CE1-CG2 3.61Å; F46-V52 HydrophobicContact CG-CG2 4.23Å; F46-L86 HydrophobicContact CD1-CD2 3.63Å; F46-L86 HydrophobicContact CE1-CD2 3.72Å; F46-A88 CarbonylContact C-O 3.59Å; F46-A88 HydrophobicContact CB-CB 4.29Å; F46-A88 HydrophobicContact CD1-CB 3.99Å; F46-A88 HydrophobicContact CG-CB 4.49Å
47	S	97.1	Very high	97.9	Very high	23 Å²	23	57 Å²	57	16%	0.161	31%	0.311	C	S	.	.			trans	-136.1	144.1	179.1	171.6	0	0	0	0	110.6	T49 E50 R87 A88	S47-T49 VanDerWaalsContact C-N 3.25Å; S47-T49 PolarHBondContact O-N 3.22Å; S47-T49 PolarHBondContact OG-N 2.77Å; S47-T49 PolarHBondContact OG-OG1 2.94Å; S47-E50 PolarHBondContact OG-N 2.83Å; S47-E50 VanDerWaalsContact OG-N 3.13Å; S47-R87 WeakPolarHBondContact O-CA 3.26Å; S47-A88 CarbonylContact C-O 2.94Å; S47-A88 WeakPolarHBondContact CA-O 3.2Å; S47-A88 PolarHBondContact N-O 2.7Å; S47-A88 PolarHBondContact O-N 2.98Å; S47-A88 VanDerWaalsContact O-O 3.11Å
48	P	97.3	Very high	97.9	Very high	61 Å²	61	56.2 Å²	56.2	40%	0.396	31%	0.313	S	S	.	.	S	Bend	trans	-72.1	-20.2	175.3	28.5	-34.2	0	0	0	112.6	E89	P48-E89 WeakPolarHBondContact CB-OE1 3.3Å
49	T	97.1	Very high	97.9	Very high	109 Å²	109	62 Å²	62	67%	0.669	34%	0.343	S	S	*	.	S	Bend	trans	-114	-28.3	-174.1	53.4	0	0	0	0	113.6	S47 R87	S47-T49 VanDerWaalsContact C-N 3.25Å; S47-T49 PolarHBondContact O-N 3.22Å; S47-T49 PolarHBondContact OG-N 2.77Å; S47-T49 PolarHBondContact OG-OG1 2.94Å; T49-R87 VanDerWaalsContact C-CD 3.48Å; T49-R87 VanDerWaalsContact C-NE 3.26Å; T49-R87 PolarHBondContact O-NE 2.94Å
50	E	97.3	Very high	97.8	Very high	132 Å²	132	60.9 Å²	60.9	62%	0.617	34%	0.339	S	S	*	.	S	Bend	trans	-115.8	156.9	-174.3	-62.6	-178.4	158.8	0	0	112.1	S47 R87	S47-E50 PolarHBondContact OG-N 2.83Å; S47-E50 VanDerWaalsContact OG-N 3.13Å; E50-R87 VanDerWaalsContact C-CD 3.45Å; E50-R87 WeakPolarHBondContact O-CD 3.14Å; E50-R87 PolarHBondContact O-NE 3.05Å
51	G	97.4	Very high	97.8	Very high	23 Å²	23	61.9 Å²	61.9	24%	0.237	34%	0.342	C	S	.	.	P	Polyproline II helix	trans	-60.9	156.3	174.2	0	0	0	0	0	111.5	E53 S84	G51-E53 PolarHBondContact O-N 3.06Å; G51-E53 VanDerWaalsContact O-N 3.15Å; G51-S84 VanDerWaalsContact CA-O 3.22Å; G51-S84 WeakPolarHBondContact CA-O 3.42Å
52	V	98.1	Very high	97.8	Very high	12 Å²	12	62 Å²	62	7%	0.073	34%	0.343	C	S	.	.	P	Polyproline II helix	trans	-62.8	120.2	178.2	176	0	0	0	0	109.1	R44 V45 F46 F83 L86	R44-V52 HydrophobicContact CB-CG1 3.84Å; R44-V52 HydrophobicContact CG-CG1 4.26Å; V45-V52 WeakPolarHBondContact O-CA 3.35Å; F46-V52 HydrophobicContact CD1-CG2 3.43Å; F46-V52 VanDerWaalsContact CD1-CG2 3.43Å; F46-V52 HydrophobicContact CE1-CG1 4.4Å; F46-V52 HydrophobicContact CE1-CG2 3.61Å; F46-V52 HydrophobicContact CG-CG2 4.23Å; V52-F83 HydrophobicContact CB-CB 4.07Å; V52-F83 HydrophobicContact CB-CD1 4.22Å; V52-F83 HydrophobicContact CG1-CD1 4.24Å; V52-F83 HydrophobicContact CG2-CD1 4.33Å; V52-F83 PolarHBondContact N-O 2.9Å; V52-L86 HydrophobicContact CG2-CB 4.05Å; V52-L86 HydrophobicContact CG2-CD2 3.68Å; V52-L86 HydrophobicContact CG2-CG 4.37Å
53	E	97.5	Very high	97.8	Very high	122 Å²	122	67.6 Å²	67.6	57%	0.57	36%	0.363	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.8	137.5	174.1	-171.5	-177.7	177.8	0	0	109.6	R44 V45 G51 V55	R44-E53 WeakPolarHBondContact CA-O 3.42Å; V45-E53 HydrophobicContact CB-CB 4.26Å; V45-E53 PolarHBondContact N-O 3.25Å; V45-E53 PolarHBondContact O-N 2.86Å; V45-E53 VanDerWaalsContact O-N 3.14Å; G51-E53 PolarHBondContact O-N 3.06Å; G51-E53 VanDerWaalsContact O-N 3.15Å; E53-V55 HydrophobicContact CG-CG2 4.06Å
54	Q	97.4	Very high	97.7	Very high	96 Å²	96	66.7 Å²	66.7	45%	0.449	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	104.3	174.3	-66.1	-174.5	31.1	0	0	109.9	E43 P56	E43-Q54 CarbonylContact O-C 3.47Å; E43-Q54 VanDerWaalsContact O-CA 3.29Å; E43-Q54 WeakPolarHBondContact O-CA 3.23Å; Q54-P56 WeakPolarHBondContact O-CD 3.17Å
55	V	98	Very high	97.6	Very high	47 Å²	47	71.9 Å²	71.9	29%	0.285	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	113.6	-177.7	-176.7	0	0	0	0	109.3	H42 E43 V45 E53 L57	H42-V55 CarbonylContact C-O 3.54Å; H42-V55 WeakPolarHBondContact CA-O 3.4Å; H42-V55 WeakPolarHBondContact CB-O 3.35Å; E43-V55 HydrophobicContact CB-CB 4.37Å; E43-V55 PolarHBondContact N-O 2.86Å; E43-V55 PolarHBondContact O-N 2.82Å; V45-V55 HydrophobicContact CG2-CG2 4.17Å; E53-V55 HydrophobicContact CG-CG2 4.06Å; V55-L57 PolarHBondContact O-N 2.91Å
56	P	98.3	Very high	97.5	Very high	109 Å²	109	72.5 Å²	72.5	71%	0.708	39%	0.387	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.1	132.2	-178	27.5	-33.9	0	0	0	111.6	Q54	Q54-P56 WeakPolarHBondContact O-CD 3.17Å
57	L	98.2	Very high	97.5	Very high	50 Å²	50	71.7 Å²	71.7	26%	0.262	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	-24.4	179.1	-60.5	177.5	0	0	0	112.5	I23 S41 E43 V55 F60	I23-L57 HydrophobicContact CG1-CD1 4.27Å; I23-L57 HydrophobicContact CG2-CD1 4.2Å; S41-L57 PolarHBondContact O-N 3.1Å; S41-L57 WeakPolarHBondContact OG-CB 3.42Å; E43-L57 HydrophobicContact CB-CD1 4.17Å; V55-L57 PolarHBondContact O-N 2.91Å; L57-F60 HydrophobicContact CB-CB 4.31Å; L57-F60 HydrophobicContact CB-CD2 4.22Å; L57-F60 HydrophobicContact CB-CG 4.35Å; L57-F60 HydrophobicContact CD1-CD1 4.2Å; L57-F60 HydrophobicContact CD1-CD2 4.26Å; L57-F60 HydrophobicContact CD1-CE1 4.39Å; L57-F60 HydrophobicContact CD1-CE2 4.45Å; L57-F60 HydrophobicContact CD1-CG 4.14Å
58	G	97.9	Very high	97.5	Very high	34 Å²	34	72.8 Å²	72.8	35%	0.351	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	77.6	-124.5	179	0	0	0	0	0	112.4	D40 S41	D40-G58 PolarHBondContact N-O 3.13Å; D40-G58 VanDerWaalsContact N-O 3.13Å; S41-G58 PolarHBondContact N-O 3.38Å; S41-G58 PolarHBondContact O-N 2.76Å; S41-G58 PolarHBondContact OG-O 2.87Å
59	L	98.2	Very high	97.4	Very high	120 Å²	120	73.5 Å²	73.5	63%	0.628	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88	114.3	171.7	-177.3	68.4	0	0	0	109	V37 K39	V37-L59 HydrophobicContact CG1-CD1 3.68Å; K39-L59 HydrophobicContact CB-CD1 4.19Å; K39-L59 HydrophobicContact CG-CD1 4.5Å
60	F	97.5	Very high	97.5	Very high	60 Å²	60	69.6 Å²	69.6	26%	0.263	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	131.9	-172.5	-162.2	-111.7	0	0	0	111	I23 I38 S41 L57 I62	I23-F60 HydrophobicContact CD1-CD1 3.96Å; I23-F60 HydrophobicContact CD1-CE1 3.58Å; I38-F60 PolarHBondContact N-O 2.83Å; I38-F60 PolarHBondContact O-N 2.9Å; S41-F60 VanDerWaalsContact OG-CB 3.25Å; S41-F60 WeakPolarHBondContact OG-CB 3.11Å; L57-F60 HydrophobicContact CB-CB 4.31Å; L57-F60 HydrophobicContact CB-CD2 4.22Å; L57-F60 HydrophobicContact CB-CG 4.35Å; L57-F60 HydrophobicContact CD1-CD1 4.2Å; L57-F60 HydrophobicContact CD1-CD2 4.26Å; L57-F60 HydrophobicContact CD1-CE1 4.39Å; L57-F60 HydrophobicContact CD1-CE2 4.45Å; L57-F60 HydrophobicContact CD1-CG 4.14Å; F60-I62 HydrophobicContact CD1-CD1 4.24Å; F60-I62 HydrophobicContact CD1-CG1 3.61Å; F60-I62 HydrophobicContact CE1-CG1 3.79Å
61	I	98	Very high	97.5	Very high	121 Å²	121	64.5 Å²	64.5	62%	0.621	36%	0.358	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.1	121.2	176.7	-58.2	176.6	0	0	0	108.3	L36 V37	L36-I61 CarbonylContact O-C 3.54Å; L36-I61 VanDerWaalsContact O-CA 3.29Å; L36-I61 WeakPolarHBondContact O-CA 3.48Å; V37-I61 HydrophobicContact CG2-CG1 4.47Å
62	I	98	Very high	97.4	Very high	7 Å²	7	67.5 Å²	67.5	4%	0.036	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	122.8	177.6	-50.7	173.3	0	0	0	107.9	V15 T17 I23 N35 L36 I38 F60 V67	V15-I62 HydrophobicContact CB-CD1 4.02Å; V15-I62 HydrophobicContact CG1-CD1 3.72Å; V15-I62 HydrophobicContact CG2-CD1 4.24Å; T17-I62 HydrophobicContact CG2-CG2 4.13Å; I23-I62 HydrophobicContact CB-CD1 4.39Å; I23-I62 HydrophobicContact CD1-CD1 3.67Å; I23-I62 HydrophobicContact CD1-CG1 4.21Å; I23-I62 HydrophobicContact CG2-CD1 4.35Å; N35-I62 CarbonylContact C-O 3.51Å; N35-I62 WeakPolarHBondContact CA-O 3.34Å; L36-I62 HydrophobicContact CB-CB 4.33Å; L36-I62 PolarHBondContact N-O 3.27Å; L36-I62 PolarHBondContact O-N 3.1Å; I38-I62 HydrophobicContact CG1-CD1 4.03Å; F60-I62 HydrophobicContact CD1-CD1 4.24Å; F60-I62 HydrophobicContact CD1-CG1 3.61Å; F60-I62 HydrophobicContact CE1-CG1 3.79Å; I62-V67 HydrophobicContact CB-CG2 4.34Å; I62-V67 HydrophobicContact CG2-CG2 3.62Å
63	R	97.8	Very high	97.4	Very high	151 Å²	151	68.6 Å²	68.6	57%	0.57	37%	0.371	S	S	*	.			trans	-70.6	131.5	175.1	-172.7	176.2	169.2	177.2	-8.3	109.4	N35 Q65 N66	N35-R63 VanDerWaalsContact OD1-CA 3.31Å; N35-R63 WeakPolarHBondContact OD1-CA 3.37Å; R63-Q65 VanDerWaalsContact C-N 3.25Å; R63-Q65 HydrophobicContact CG-CG 4.06Å; R63-Q65 VanDerWaalsContact CZ-CD 3.42Å; R63-Q65 VanDerWaalsContact CZ-NE2 3.26Å; R63-Q65 PolarHBondContact O-N 3.47Å; R63-Q65 VanDerWaalsContact O-N 3.13Å; R63-N66 WeakPolarHBondContact O-CB 3.42Å; R63-N66 PolarHBondContact O-N 3.04Å
64	G	96.7	Very high	97.4	Very high	10 Å²	10	67.7 Å²	67.7	10%	0.103	37%	0.37	C	S	.	.	G	3₁₀ helix	trans	-60.9	-28.6	-169.6	0	0	0	0	0	115.4	V33 V34 N35 N66 V67	V33-G64 WeakPolarHBondContact O-CA 3.45Å; V34-G64 VanDerWaalsContact C-CA 3.43Å; V34-G64 WeakPolarHBondContact O-CA 3.5Å; N35-G64 PolarHBondContact OD1-N 2.96Å; G64-N66 PolarHBondContact O-N 2.85Å; G64-N66 VanDerWaalsContact O-N 3.16Å; G64-V67 WeakPolarHBondContact O-CB 3.47Å; G64-V67 PolarHBondContact O-N 2.74Å
65	Q	95.9	Very high	97.3	Very high	120 Å²	120	66.6 Å²	66.6	56%	0.561	37%	0.365	S	S	*	.	G	3₁₀ helix	trans	-63.2	-19.9	173.1	79.6	-173.4	9.5	0	0	113.6	R63	R63-Q65 VanDerWaalsContact C-N 3.25Å; R63-Q65 HydrophobicContact CG-CG 4.06Å; R63-Q65 VanDerWaalsContact CZ-CD 3.42Å; R63-Q65 VanDerWaalsContact CZ-NE2 3.26Å; R63-Q65 PolarHBondContact O-N 3.47Å; R63-Q65 VanDerWaalsContact O-N 3.13Å
66	N	96.4	Very high	97.2	Very high	70 Å²	70	68.7 Å²	68.7	37%	0.374	38%	0.375	S	S	.	.	G	3₁₀ helix	trans	-98.8	1	178	-63	-9.5	0	0	0	111.8	T17 S18 R63 G64	T17-N66 CarbonylContact C-O 3.6Å; T17-N66 WeakPolarHBondContact CA-O 3.4Å; T17-N66 WeakPolarHBondContact CB-O 3.4Å; S18-N66 PolarHBondContact N-O 3.19Å; S18-N66 WeakPolarHBondContact OG-CA 3.31Å; R63-N66 WeakPolarHBondContact O-CB 3.42Å; R63-N66 PolarHBondContact O-N 3.04Å; G64-N66 PolarHBondContact O-N 2.85Å; G64-N66 VanDerWaalsContact O-N 3.16Å
67	V	97.2	Very high	97.2	Very high	28 Å²	28	68.5 Å²	68.5	17%	0.17	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	122.4	178.6	178.2	0	0	0	0	108.7	V15 V34 L36 I62 G64 V70	V15-V67 HydrophobicContact CG1-CG1 4.2Å; V34-V67 HydrophobicContact CG1-CB 4.4Å; V34-V67 HydrophobicContact CG1-CG1 4.18Å; L36-V67 HydrophobicContact CD1-CG1 4.17Å; L36-V67 HydrophobicContact CD1-CG2 3.83Å; L36-V67 HydrophobicContact CG-CG2 4.13Å; I62-V67 HydrophobicContact CB-CG2 4.34Å; I62-V67 HydrophobicContact CG2-CG2 3.62Å; G64-V67 WeakPolarHBondContact O-CB 3.47Å; G64-V67 PolarHBondContact O-N 2.74Å; V67-V70 HydrophobicContact CG1-CG2 3.69Å
68	A	96.7	Very high	97.1	Very high	46 Å²	46	67.1 Å²	67.1	38%	0.38	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	-47.1	174.2	0	0	0	0	0	111.5	I16 V94	I16-A68 WeakPolarHBondContact O-CA 3.49Å; I16-A68 WeakPolarHBondContact O-CB 3.42Å; I16-A68 PolarHBondContact O-N 3.15Å; A68-V94 HydrophobicContact CB-CG2 4.08Å
69	V	96.9	Very high	96.9	Very high	77 Å²	77	73.6 Å²	73.6	47%	0.467	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	142	-178.2	-178.2	0	0	0	0	109.9	V15 I16	V15-V69 CarbonylContact C-O 3.57Å; V15-V69 WeakPolarHBondContact CA-O 3.39Å; I16-V69 HydrophobicContact CB-CB 4.15Å; I16-V69 HydrophobicContact CD1-CB 4.42Å; I16-V69 HydrophobicContact CG1-CB 4.5Å; I16-V69 PolarHBondContact N-O 2.9Å; I16-V69 PolarHBondContact O-N 3.1Å; I16-V69 VanDerWaalsContact O-N 3.1Å
70	V	97.5	Very high	96.9	Very high	27 Å²	27	77.4 Å²	77.4	16%	0.164	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	120.3	164.3	-174.5	0	0	0	0	107.4	L5 Y8 V13 V15 L36 V67	L5-V70 HydrophobicContact CD2-CB 3.91Å; L5-V70 HydrophobicContact CD2-CG1 3.85Å; L5-V70 HydrophobicContact CD2-CG2 4.17Å; Y8-V70 HydrophobicContact CD2-CG1 3.96Å; Y8-V70 HydrophobicContact CE2-CG1 4.37Å; V13-V70 HydrophobicContact CB-CG1 4.1Å; V13-V70 HydrophobicContact CG1-CG1 4.2Å; V13-V70 HydrophobicContact CG2-CG1 4.48Å; V15-V70 HydrophobicContact CG1-CG2 4.48Å; V15-V70 HydrophobicContact CG2-CG1 4.42Å; V15-V70 HydrophobicContact CG2-CG2 4.4Å; L36-V70 HydrophobicContact CD1-CG2 3.67Å; V67-V70 HydrophobicContact CG1-CG2 3.69Å
71	G	97.2	Very high	96.8	Very high	24 Å²	24	78 Å²	78	25%	0.247	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	135.8	176.2	0	0	0	0	0	111.2	V13 N14	V13-G71 CarbonylContact C-O 3.57Å; V13-G71 VanDerWaalsContact CA-O 3.24Å; V13-G71 WeakPolarHBondContact CA-O 3.45Å; N14-G71 PolarHBondContact N-O 3.04Å; N14-G71 PolarHBondContact O-N 3.13Å
72	E	97.2	Very high	96.7	Very high	86 Å²	86	76.8 Å²	76.8	40%	0.402	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.4	138	167.6	-177.8	178	-175.2	0	0	110.4	Y8 R11	Y8-E72 HydrophobicContact CD1-CB 3.92Å; Y8-E72 HydrophobicContact CD1-CG 4.49Å; Y8-E72 HydrophobicContact CE1-CB 3.64Å; Y8-E72 HydrophobicContact CG-CB 4.49Å; R11-E72 WeakPolarHBondContact CD-OE1 3.25Å; R11-E72 IonicContact CZ-OE1 3.69Å; R11-E72 IonicContact NE-OE1 3.63Å; R11-E72 VanDerWaalsContact NH1-CD 3.26Å; R11-E72 IonicContact NH1-OE1 3.12Å; R11-E72 PolarHBondContact NH1-OE1 2.86Å; R11-E72 IonicContact NH1-OE2 2.78Å; R11-E72 PolarHBondContact NH1-OE2 2.87Å; R11-E72 VanDerWaalsContact NH1-OE2 3.12Å
73	L	97.1	Very high	96.6	Very high	35 Å²	35	77.5 Å²	77.5	18%	0.183	38%	0.383	C	S	.	.			trans	-104.4	134.7	173.9	-73.9	174.2	0	0	0	110.8	M12 N14 V24 E75	M12-L73 HydrophobicContact CB-CB 4.37Å; M12-L73 HydrophobicContact CG-CB 4.22Å; M12-L73 HydrophobicContact CG-CD1 4.07Å; M12-L73 PolarHBondContact O-N 2.83Å; M12-L73 HydrophobicContact SD-CD1 4.36Å; N14-L73 HydrophobicContact CB-CD1 3.87Å; N14-L73 HydrophobicContact CB-CD2 4.04Å; N14-L73 HydrophobicContact CB-CG 3.88Å; V24-L73 HydrophobicContact CB-CD1 4.44Å; V24-L73 HydrophobicContact CG1-CD1 3.61Å; V24-L73 HydrophobicContact CG2-CD1 4.01Å; L73-E75 PolarHBondContact O-N 2.81Å
74	D	97.2	Very high	96.5	Very high	103 Å²	103	73.1 Å²	73.1	55%	0.551	38%	0.375	S	S	*	.			trans	-74.9	108.8	161.7	-178.4	-36.6	0	0	0	108.4	D76 L77 D78	D74-D76 VanDerWaalsContact C-N 3.28Å; D74-D76 PolarHBondContact O-N 3.25Å; D74-D76 PolarHBondContact OD1-N 3.26Å; D74-L77 HydrophobicContact CB-CB 3.96Å; D74-L77 PolarHBondContact O-N 3.43Å; D74-L77 PolarHBondContact OD1-N 2.95Å; D74-D78 WeakPolarHBondContact O-CB 3.48Å; D74-D78 PolarHBondContact O-N 3.21Å
75	E	96	Very high	96.5	Very high	74 Å²	74	79 Å²	79	35%	0.346	40%	0.4	S	S	.	.	H	α-helix	trans	-61.7	-33.9	-176.8	-64.5	-171.3	-138	0	0	113.2	M12 L73 R79	M12-E75 HydrophobicContact CB-CG 3.86Å; M12-E75 HydrophobicContact CE-CG 3.87Å; M12-E75 HydrophobicContact SD-CG 4Å; L73-E75 PolarHBondContact O-N 2.81Å; E75-R79 WeakPolarHBondContact O-CB 3.44Å; E75-R79 WeakPolarHBondContact O-CD 3.41Å; E75-R79 WeakPolarHBondContact O-CG 3.45Å; E75-R79 PolarHBondContact O-N 3.14Å; E75-R79 IonicContact OE2-CZ 2.69Å; E75-R79 IonicContact OE2-NH2 2.89Å; E75-R79 PolarHBondContact OE2-NH2 3.35Å
76	D	96.5	Very high	96.5	Very high	91 Å²	91	75.9 Å²	75.9	49%	0.487	39%	0.387	S	S	.	.	H	α-helix	trans	-75.4	-35.1	-178.3	-75.3	-27.7	0	0	0	111.1	D74 R79 R80	D74-D76 VanDerWaalsContact C-N 3.28Å; D74-D76 PolarHBondContact O-N 3.25Å; D74-D76 PolarHBondContact OD1-N 3.26Å; D76-R79 IonicContact OD1-NH1 3.84Å; D76-R79 PolarHBondContact OD1-NH1 3.42Å; D76-R80 WeakPolarHBondContact O-CD 3.4Å; D76-R80 VanDerWaalsContact O-CG 3.26Å; D76-R80 WeakPolarHBondContact O-CG 3.05Å; D76-R80 PolarHBondContact O-NE 2.86Å
77	L	96.4	Very high	96.6	Very high	104 Å²	104	77.8 Å²	77.8	55%	0.545	39%	0.389	S	S	.	.	H	α-helix	trans	-68.1	-46.4	171.3	-177.9	60.7	0	0	0	110.9	D74 R79 R80	D74-L77 HydrophobicContact CB-CB 3.96Å; D74-L77 PolarHBondContact O-N 3.43Å; D74-L77 PolarHBondContact OD1-N 2.95Å; L77-R79 VanDerWaalsContact C-N 3.34Å; L77-R79 PolarHBondContact O-N 3.25Å; L77-R80 WeakPolarHBondContact O-CB 3.29Å; L77-R80 PolarHBondContact O-N 3.32Å
78	D	96	Very high	96.6	Very high	22 Å²	22	78.1 Å²	78.1	12%	0.118	39%	0.394	C	S	.	.	H	α-helix	trans	-60.9	-41.2	-177.4	-170	79.4	0	0	0	112	R44 D74 R80 I81	R44-D78 IonicContact CZ-OD1 3.25Å; R44-D78 VanDerWaalsContact CZ-OD1 3.25Å; R44-D78 IonicContact CZ-OD2 3.77Å; R44-D78 IonicContact NH1-OD1 2.74Å; R44-D78 PolarHBondContact NH1-OD1 3.12Å; R44-D78 IonicContact NH2-OD1 2.69Å; R44-D78 PolarHBondContact NH2-OD1 2.79Å; R44-D78 IonicContact NH2-OD2 3.57Å; R44-D78 PolarHBondContact NH2-OD2 3.2Å; D74-D78 WeakPolarHBondContact O-CB 3.48Å; D74-D78 PolarHBondContact O-N 3.21Å; D78-R80 PolarHBondContact O-N 3.16Å; D78-I81 PolarHBondContact O-N 3.13Å
79	R	95.1	Very high	96.6	Very high	170 Å²	170	82.4 Å²	82.4	64%	0.642	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.2	-21.4	175.4	-73.3	171	-163.9	159.2	4.9	114.4	E75 D76 L77 I81	E75-R79 WeakPolarHBondContact O-CB 3.44Å; E75-R79 WeakPolarHBondContact O-CD 3.41Å; E75-R79 WeakPolarHBondContact O-CG 3.45Å; E75-R79 PolarHBondContact O-N 3.14Å; E75-R79 IonicContact OE2-CZ 2.69Å; E75-R79 IonicContact OE2-NH2 2.89Å; E75-R79 PolarHBondContact OE2-NH2 3.35Å; D76-R79 IonicContact OD1-NH1 3.84Å; D76-R79 PolarHBondContact OD1-NH1 3.42Å; L77-R79 VanDerWaalsContact C-N 3.34Å; L77-R79 PolarHBondContact O-N 3.25Å; R79-I81 VanDerWaalsContact C-N 3.34Å
80	R	96.7	Very high	96.5	Very high	200 Å²	200	82.4 Å²	82.4	76%	0.755	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.6	-10.7	179.3	-68.3	169.5	-164.8	-172.7	5.4	112.7	D76 L77 D78	D76-R80 WeakPolarHBondContact O-CD 3.4Å; D76-R80 VanDerWaalsContact O-CG 3.26Å; D76-R80 WeakPolarHBondContact O-CG 3.05Å; D76-R80 PolarHBondContact O-NE 2.86Å; L77-R80 WeakPolarHBondContact O-CB 3.29Å; L77-R80 PolarHBondContact O-N 3.32Å; D78-R80 PolarHBondContact O-N 3.16Å
81	I	95.9	Very high	96.4	Very high	72 Å²	72	85 Å²	85	37%	0.369	42%	0.421	S	S	.	.			trans	-83.8	121.2	-179.1	-58.7	171.6	0	0	0	109.1	D78 R79 F83 L86	D78-I81 PolarHBondContact O-N 3.13Å; R79-I81 VanDerWaalsContact C-N 3.34Å; I81-F83 HydrophobicContact CB-CD2 4.39Å; I81-F83 HydrophobicContact CB-CE1 4.5Å; I81-F83 HydrophobicContact CB-CE2 3.92Å; I81-F83 HydrophobicContact CB-CZ 3.96Å; I81-F83 HydrophobicContact CD1-CZ 4.21Å; I81-F83 HydrophobicContact CG2-CD1 4.12Å; I81-F83 HydrophobicContact CG2-CD2 4.29Å; I81-F83 HydrophobicContact CG2-CE1 3.9Å; I81-F83 HydrophobicContact CG2-CE2 4.09Å; I81-F83 HydrophobicContact CG2-CG 4.3Å; I81-F83 HydrophobicContact CG2-CZ 3.87Å; I81-F83 WeakPolarHBondContact O-CD2 3.31Å; I81-F83 PolarHBondContact O-N 2.9Å; I81-F83 VanDerWaalsContact O-N 3.1Å; I81-L86 HydrophobicContact CG2-CD1 4.4Å
82	D	96.3	Very high	96.4	Very high	96 Å²	96	90.8 Å²	90.8	51%	0.513	45%	0.446	S	S	.	.			trans	-80.8	88.2	169.6	-172.2	-8.3	0	0	0	110.3	S84 Q85 L86	D82-S84 PolarHBondContact O-N 2.8Å; D82-S84 VanDerWaalsContact OD1-CB 3.31Å; D82-S84 WeakPolarHBondContact OD1-CB 3.33Å; D82-S84 PolarHBondContact OD1-N 2.86Å; D82-S84 PolarHBondContact OD1-OG 2.95Å; D82-Q85 HydrophobicContact CB-CG 4.44Å; D82-Q85 PolarHBondContact O-N 3.36Å; D82-Q85 VanDerWaalsContact O-N 3.12Å; D82-Q85 VanDerWaalsContact OD2-CG 3.29Å; D82-Q85 WeakPolarHBondContact OD2-CG 3.47Å; D82-L86 PolarHBondContact O-N 2.88Å
83	F	96	Very high	96.4	Very high	21 Å²	21	90.2 Å²	90.2	9%	0.092	45%	0.45	C	S	.	.	G	3₁₀ helix	trans	-58.6	-24.8	177.8	-74.6	-70.3	0	0	0	113.4	V52 I81 Q85 L86	V52-F83 HydrophobicContact CB-CB 4.07Å; V52-F83 HydrophobicContact CB-CD1 4.22Å; V52-F83 HydrophobicContact CG1-CD1 4.24Å; V52-F83 HydrophobicContact CG2-CD1 4.33Å; V52-F83 PolarHBondContact N-O 2.9Å; I81-F83 HydrophobicContact CB-CD2 4.39Å; I81-F83 HydrophobicContact CB-CE1 4.5Å; I81-F83 HydrophobicContact CB-CE2 3.92Å; I81-F83 HydrophobicContact CB-CZ 3.96Å; I81-F83 HydrophobicContact CD1-CZ 4.21Å; I81-F83 HydrophobicContact CG2-CD1 4.12Å; I81-F83 HydrophobicContact CG2-CD2 4.29Å; I81-F83 HydrophobicContact CG2-CE1 3.9Å; I81-F83 HydrophobicContact CG2-CE2 4.09Å; I81-F83 HydrophobicContact CG2-CG 4.3Å; I81-F83 HydrophobicContact CG2-CZ 3.87Å; I81-F83 WeakPolarHBondContact O-CD2 3.31Å; I81-F83 PolarHBondContact O-N 2.9Å; I81-F83 VanDerWaalsContact O-N 3.1Å; F83-Q85 PolarHBondContact O-N 3.42Å; F83-L86 PolarHBondContact O-N 3.1Å
84	S	95.9	Very high	96.3	Very high	59 Å²	59	91.9 Å²	91.9	41%	0.413	46%	0.461	S	S	.	.	G	3₁₀ helix	trans	-69.2	-23.5	178.4	80.3	0	0	0	0	112.9	G51 D82 R87	G51-S84 VanDerWaalsContact CA-O 3.22Å; G51-S84 WeakPolarHBondContact CA-O 3.42Å; D82-S84 PolarHBondContact O-N 2.8Å; D82-S84 VanDerWaalsContact OD1-CB 3.31Å; D82-S84 WeakPolarHBondContact OD1-CB 3.33Å; D82-S84 PolarHBondContact OD1-N 2.86Å; D82-S84 PolarHBondContact OD1-OG 2.95Å; S84-R87 PolarHBondContact O-NH1 3.32Å
85	Q	96	Very high	96.2	Very high	135 Å²	135	93.4 Å²	93.4	63%	0.631	47%	0.474	S	S	*	.	G	3₁₀ helix	trans	-99.6	-7.6	179.3	-59.3	-57.3	-54.6	0	0	113.1	D82 F83 R87	D82-Q85 HydrophobicContact CB-CG 4.44Å; D82-Q85 PolarHBondContact O-N 3.36Å; D82-Q85 VanDerWaalsContact O-N 3.12Å; D82-Q85 VanDerWaalsContact OD2-CG 3.29Å; D82-Q85 WeakPolarHBondContact OD2-CG 3.47Å; F83-Q85 PolarHBondContact O-N 3.42Å; Q85-R87 VanDerWaalsContact C-NH1 3.28Å; Q85-R87 PolarHBondContact O-NH1 3.48Å
86	L	96.8	Very high	95.7	Very high	54 Å²	54	100.8 Å²	100.8	28%	0.283	51%	0.508	S	S	.	.			trans	-77.9	134.2	178.4	-165.7	153.7	0	0	0	110	F46 V52 I81 D82 F83 A88	F46-L86 HydrophobicContact CD1-CD2 3.63Å; F46-L86 HydrophobicContact CE1-CD2 3.72Å; V52-L86 HydrophobicContact CG2-CB 4.05Å; V52-L86 HydrophobicContact CG2-CD2 3.68Å; V52-L86 HydrophobicContact CG2-CG 4.37Å; I81-L86 HydrophobicContact CG2-CD1 4.4Å; D82-L86 PolarHBondContact O-N 2.88Å; F83-L86 PolarHBondContact O-N 3.1Å; L86-A88 HydrophobicContact CD2-CB 3.95Å
87	R	97.4	Very high	95.7	Very high	110 Å²	110	101.3 Å²	101.3	42%	0.415	51%	0.509	S	S	.	.			trans	-125.4	129.7	172.2	-58.9	-60.2	179.4	-86.1	3	108.8	S47 T49 E50 S84 Q85	S47-R87 WeakPolarHBondContact O-CA 3.26Å; T49-R87 VanDerWaalsContact C-CD 3.48Å; T49-R87 VanDerWaalsContact C-NE 3.26Å; T49-R87 PolarHBondContact O-NE 2.94Å; E50-R87 VanDerWaalsContact C-CD 3.45Å; E50-R87 WeakPolarHBondContact O-CD 3.14Å; E50-R87 PolarHBondContact O-NE 3.05Å; S84-R87 PolarHBondContact O-NH1 3.32Å; Q85-R87 VanDerWaalsContact C-NH1 3.28Å; Q85-R87 PolarHBondContact O-NH1 3.48Å
88	A	96.9	Very high	95.6	Very high	34 Å²	34	101.1 Å²	101.1	28%	0.281	51%	0.507	S	S	.	.			trans	-155.6	149.5	178.6	0	0	0	0	0	110.7	F46 S47 L86	F46-A88 CarbonylContact C-O 3.59Å; F46-A88 HydrophobicContact CB-CB 4.29Å; F46-A88 HydrophobicContact CD1-CB 3.99Å; F46-A88 HydrophobicContact CG-CB 4.49Å; S47-A88 CarbonylContact C-O 2.94Å; S47-A88 WeakPolarHBondContact CA-O 3.2Å; S47-A88 PolarHBondContact N-O 2.7Å; S47-A88 PolarHBondContact O-N 2.98Å; S47-A88 VanDerWaalsContact O-O 3.11Å; L86-A88 HydrophobicContact CD2-CB 3.95Å
89	E	97.1	Very high	95.6	Very high	137 Å²	137	105.5 Å²	105.5	64%	0.64	53%	0.529	S	S	*	.	P	Polyproline II helix	trans	-63.2	143.2	168.3	-66.1	-62.6	158.4	0	0	110.3	P48	P48-E89 WeakPolarHBondContact CB-OE1 3.3Å
90	P	95.1	Very high	95.6	Very high	77 Å²	77	101.7 Å²	101.7	50%	0.5	52%	0.522	S	S	.	.	P	Polyproline II helix	trans	-54.9	147.7	169	-23	32.8	0	0	0	111.5
91	L	96.7	Very high	95.6	Very high	82 Å²	82	95.6 Å²	95.6	43%	0.429	51%	0.508	S	S	.	.	P	Polyproline II helix	trans	-68.4	140.1	174.5	-65.3	173.9	0	0	0	110.2	I16	I16-L91 HydrophobicContact CD1-CD1 4Å; I16-L91 HydrophobicContact CG1-CD1 4.3Å; I16-L91 HydrophobicContact CG2-CD1 3.94Å
92	N	96.8	Very high	95.6	Very high	144 Å²	144	97.1 Å²	97.1	77%	0.77	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-70.3	150.3	172.5	-68.3	-48.8	0	0	0	110.8
93	P	96.7	Very high	95.5	Very high	75 Å²	75	97.2 Å²	97.2	49%	0.487	52%	0.517	S	S	.	.	P	Polyproline II helix	trans	-66.8	157.8	171.2	30.6	-36.2	0	0	0	111.2	S18 V95	S18-P93 CarbonylContact O-C 3.52Å; S18-P93 VanDerWaalsContact O-CA 3.26Å; S18-P93 WeakPolarHBondContact O-CA 3.24Å; S18-P93 WeakPolarHBondContact O-CB 3.16Å; P93-V95 PolarHBondContact O-N 3.05Å
94	V	95.7	Very high	95.5	Very high	70 Å²	70	103.1 Å²	103.1	42%	0.424	55%	0.55	S	S	.	.	P	Polyproline II helix	trans	-70.3	126.9	170.2	178.8	0	0	0	0	109.1	S18 A68	S18-V94 PolarHBondContact O-N 3.16Å; A68-V94 HydrophobicContact CB-CG2 4.08Å
95	V	93.5	Very high	95.4	Very high	134 Å²	134	106.8 Å²	106.8	81%	0.812	56%	0.561	S	S	*	*	P	Polyproline II helix	trans	-97.4	124.3	174.9	-175.4	0	0	0	0	108.6	P93	P93-V95 PolarHBondContact O-N 3.05Å
96	H	86.8	Confident	95.4	Very high	229 Å²	229	104.2 Å²	104.2	100%	1.06	56%	0.555	S	S	*	*			trans	-96.4	0	179.5	-66.3	-67.2	0	0	0	112.5

Retrieved 96 of 96 residues in 130.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).