A0A3Q0KTV3_SCHMA Loading...

Egg secreted protein ESP15-like AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KTV3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 77 aa.

						>A0A3Q0KTV3_SCHMA|A0A3Q0KTV3
MIIPVKNCLAIFCLIQLVVFSKCDGWTITCNETYCCENTDNGKLCCDGEYCSASISNHQDLTKHQQNLLMSKKFKII
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.8	Very low	57	Low	228 Å²	228	118.5 Å²	118.5	100%	1.123	64%	0.638	S	S	*	*				0	101.5	0	-165.5	170.7	-177.6	0	107.4	I3	M1-I3 PolarHBondContact O-N 3.32Å
2	I	49	Very low	57.9	Low	172 Å²	172	119.1 Å²	119.1	88%	0.882	63%	0.631	S	S	*	*			trans	-84.3	103.8	-177.5	-61	167.4	0	0	106.7
3	I	56.9	Low	58.6	Low	102 Å²	102	115.5 Å²	115.5	52%	0.523	62%	0.62	S	S	.	*			trans	-79.8	123	174	-60.1	167	0	0	106.6	M1 V5 N7	M1-I3 PolarHBondContact O-N 3.32Å; I3-V5 PolarHBondContact O-N 3.48Å; I3-N7 HydrophobicContact CG2-CB 4.18Å
4	P	54.4	Low	58.9	Low	79 Å²	79	115.4 Å²	115.4	51%	0.513	62%	0.618	S	S	.	*			trans	-62.3	130.7	-178.9	24.5	-32.4	0	0	109.8	K6 N7	P4-K6 PolarHBondContact O-N 3.38Å; P4-N7 PolarHBondContact O-N 3.37Å
5	V	56.9	Low	59.4	Low	112 Å²	112	113.9 Å²	113.9	68%	0.679	61%	0.609	S	S	*	*	H	α-helix	trans	-48.5	-28.9	-177.9	178.1	0	0	0	112.8	I3 N7 C8 L9	I3-V5 PolarHBondContact O-N 3.48Å; V5-N7 VanDerWaalsContact C-N 3.32Å; V5-N7 PolarHBondContact O-N 2.99Å; V5-C8 PolarHBondContact O-N 2.95Å; V5-L9 PolarHBondContact O-N 2.85Å
6	K	59	Low	59.5	Low	186 Å²	186	111.3 Å²	111.3	81%	0.809	59%	0.592	S	S	*	*	H	α-helix	trans	-61.8	-33.3	176.6	-163	168.7	-178.7	167.4	113.7	P4	P4-K6 PolarHBondContact O-N 3.38Å
7	N	60.3	Low	59.5	Low	96 Å²	96	111.1 Å²	111.1	51%	0.513	59%	0.59	S	S	.	*	H	α-helix	trans	-73.8	-34.3	175.8	-107.6	19.4	0	0	112.2	I3 P4 V5 L9 A10 I11	I3-N7 HydrophobicContact CG2-CB 4.18Å; P4-N7 PolarHBondContact O-N 3.37Å; V5-N7 VanDerWaalsContact C-N 3.32Å; V5-N7 PolarHBondContact O-N 2.99Å; N7-L9 PolarHBondContact O-N 3.38Å; N7-A10 PolarHBondContact O-N 3.48Å; N7-I11 WeakPolarHBondContact O-CD1 3.2Å; N7-I11 VanDerWaalsContact O-CG1 3.29Å; N7-I11 WeakPolarHBondContact O-CG1 3.49Å; N7-I11 PolarHBondContact O-N 3.42Å; N7-I11 VanDerWaalsContact O-N 3.16Å
8	C	59.1	Low	59.5	Low	72 Å²	72	109.6 Å²	109.6	49%	0.486	59%	0.586	S	S	.	*	H	α-helix	trans	-65.7	-37.5	177.9	-83.1	0	0	0	112.7	V5 I11 F12	V5-C8 PolarHBondContact O-N 2.95Å; C8-I11 PolarHBondContact O-N 3.27Å; C8-F12 PolarHBondContact O-N 2.88Å
9	L	61.2	Low	59.4	Low	115 Å²	115	108.1 Å²	108.1	60%	0.602	58%	0.581	S	S	*	*	H	α-helix	trans	-62.2	-43.7	176.2	-109.9	88.7	0	0	111.8	V5 N7 I11 F12 C13	V5-L9 PolarHBondContact O-N 2.85Å; N7-L9 PolarHBondContact O-N 3.38Å; L9-I11 VanDerWaalsContact C-N 3.33Å; L9-I11 PolarHBondContact O-N 3.3Å; L9-F12 PolarHBondContact O-N 3.36Å; L9-C13 PolarHBondContact O-N 2.91Å; L9-C13 PolarHBondContact O-SG 2.89Å; L9-C13 VanDerWaalsContact O-SG 3.39Å
10	A	61	Low	59	Low	52 Å²	52	108.4 Å²	108.4	43%	0.43	58%	0.577	S	S	.	*	H	α-helix	trans	-62	-42.7	178.6	0	0	0	0	111.5	N7 C13 L14	N7-A10 PolarHBondContact O-N 3.48Å; A10-C13 PolarHBondContact O-N 3.32Å; A10-L14 WeakPolarHBondContact O-CG 3.13Å; A10-L14 PolarHBondContact O-N 3.39Å
11	I	65.3	Low	58.6	Low	89 Å²	89	106.6 Å²	106.6	46%	0.456	57%	0.573	S	S	.	*	H	α-helix	trans	-64.1	-44.2	177.5	-64.2	162.3	0	0	110.8	N7 C8 L9 C13 L14 I15	N7-I11 WeakPolarHBondContact O-CD1 3.2Å; N7-I11 VanDerWaalsContact O-CG1 3.29Å; N7-I11 WeakPolarHBondContact O-CG1 3.49Å; N7-I11 PolarHBondContact O-N 3.42Å; N7-I11 VanDerWaalsContact O-N 3.16Å; C8-I11 PolarHBondContact O-N 3.27Å; L9-I11 VanDerWaalsContact C-N 3.33Å; L9-I11 PolarHBondContact O-N 3.3Å; I11-C13 PolarHBondContact O-N 3.38Å; I11-L14 PolarHBondContact O-N 3.33Å; I11-I15 HydrophobicContact CG2-CD1 3.83Å; I11-I15 HydrophobicContact CG2-CG1 4.49Å; I11-I15 VanDerWaalsContact O-CG1 3.27Å; I11-I15 WeakPolarHBondContact O-CG1 3.27Å; I11-I15 PolarHBondContact O-N 2.94Å
12	F	67.9	Low	58.7	Low	126 Å²	126	103.9 Å²	103.9	55%	0.553	56%	0.555	S	S	*	*	H	α-helix	trans	-62.6	-42.7	177.1	-172.3	-98.6	0	0	111.9	C8 L9 L14 I15 Q16	C8-F12 PolarHBondContact O-N 2.88Å; L9-F12 PolarHBondContact O-N 3.36Å; F12-L14 VanDerWaalsContact C-N 3.33Å; F12-L14 PolarHBondContact O-N 2.85Å; F12-I15 PolarHBondContact O-N 3.49Å; F12-Q16 HydrophobicContact CD1-CG 3.91Å; F12-Q16 HydrophobicContact CE1-CG 3.65Å; F12-Q16 HydrophobicContact CZ-CG 4.08Å; F12-Q16 VanDerWaalsContact O-CG 3.28Å; F12-Q16 WeakPolarHBondContact O-CG 3.35Å; F12-Q16 PolarHBondContact O-N 3.45Å
13	C	66.5	Low	58.4	Low	73 Å²	73	100.4 Å²	100.4	49%	0.493	55%	0.545	S	S	.	.	H	α-helix	trans	-60.7	-40.6	175	-74	0	0	0	112.4	L9 A10 I11 Q16 L17	L9-C13 PolarHBondContact O-N 2.91Å; L9-C13 PolarHBondContact O-SG 2.89Å; L9-C13 VanDerWaalsContact O-SG 3.39Å; A10-C13 PolarHBondContact O-N 3.32Å; I11-C13 PolarHBondContact O-N 3.38Å; C13-Q16 PolarHBondContact O-N 3.21Å; C13-L17 WeakPolarHBondContact O-CB 3.33Å; C13-L17 PolarHBondContact O-N 3.29Å
14	L	63.1	Low	57.7	Low	113 Å²	113	101.2 Å²	101.2	59%	0.592	55%	0.55	S	S	*	.	H	α-helix	trans	-64.7	-42.3	176	-71.8	172.2	0	0	111.9	A10 I11 F12 L17 V18	A10-L14 WeakPolarHBondContact O-CG 3.13Å; A10-L14 PolarHBondContact O-N 3.39Å; I11-L14 PolarHBondContact O-N 3.33Å; F12-L14 VanDerWaalsContact C-N 3.33Å; F12-L14 PolarHBondContact O-N 2.85Å; L14-L17 PolarHBondContact O-N 3.16Å; L14-V18 WeakPolarHBondContact O-CG2 3.49Å; L14-V18 PolarHBondContact O-N 3.27Å
15	I	66.5	Low	56.9	Low	94 Å²	94	99.7 Å²	99.7	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-63.3	-44.7	176.7	-64.4	162.7	0	0	110.2	I11 F12 V18 V19	I11-I15 HydrophobicContact CG2-CD1 3.83Å; I11-I15 HydrophobicContact CG2-CG1 4.49Å; I11-I15 VanDerWaalsContact O-CG1 3.27Å; I11-I15 WeakPolarHBondContact O-CG1 3.27Å; I11-I15 PolarHBondContact O-N 2.94Å; F12-I15 PolarHBondContact O-N 3.49Å; I15-V18 PolarHBondContact O-N 2.92Å; I15-V19 VanDerWaalsContact O-CG2 3.31Å; I15-V19 WeakPolarHBondContact O-CG2 3.49Å; I15-V19 PolarHBondContact O-N 3.39Å
16	Q	60.4	Low	55.9	Low	72 Å²	72	106.4 Å²	106.4	34%	0.336	56%	0.562	S	S	.	*	H	α-helix	trans	-60.2	-45.8	175.5	-69.4	-67.3	-21.1	0	111	F12 C13 V18 V19 F20	F12-Q16 HydrophobicContact CD1-CG 3.91Å; F12-Q16 HydrophobicContact CE1-CG 3.65Å; F12-Q16 HydrophobicContact CZ-CG 4.08Å; F12-Q16 VanDerWaalsContact O-CG 3.28Å; F12-Q16 WeakPolarHBondContact O-CG 3.35Å; F12-Q16 PolarHBondContact O-N 3.45Å; C13-Q16 PolarHBondContact O-N 3.21Å; Q16-V18 VanDerWaalsContact C-N 3.34Å; Q16-V18 PolarHBondContact O-N 3.13Å; Q16-V19 PolarHBondContact O-N 2.85Å; Q16-V19 VanDerWaalsContact O-N 3.14Å; Q16-F20 WeakPolarHBondContact O-CB 3.33Å; Q16-F20 VanDerWaalsContact O-CD2 3.32Å; Q16-F20 WeakPolarHBondContact O-CD2 3.33Å; Q16-F20 PolarHBondContact O-N 3.35Å
17	L	59.8	Low	54.7	Low	107 Å²	107	102.8 Å²	102.8	56%	0.56	56%	0.556	S	S	*	*	H	α-helix	trans	-59.1	-41.4	175.7	-105.7	158.4	0	0	112.7	C13 L14 V19 F20 S21	C13-L17 WeakPolarHBondContact O-CB 3.33Å; C13-L17 PolarHBondContact O-N 3.29Å; L14-L17 PolarHBondContact O-N 3.16Å; L17-V19 VanDerWaalsContact C-N 3.3Å; L17-V19 PolarHBondContact O-N 2.9Å; L17-F20 PolarHBondContact O-N 3.34Å; L17-S21 WeakPolarHBondContact O-CB 3.47Å; L17-S21 PolarHBondContact O-N 2.9Å; L17-S21 PolarHBondContact O-OG 2.88Å
18	V	59.8	Low	53.6	Low	84 Å²	84	104.7 Å²	104.7	51%	0.509	57%	0.565	S	S	.	*	H	α-helix	trans	-66.2	-34.6	177.1	170.6	0	0	0	111.8	L14 I15 Q16 K22	L14-V18 WeakPolarHBondContact O-CG2 3.49Å; L14-V18 PolarHBondContact O-N 3.27Å; I15-V18 PolarHBondContact O-N 2.92Å; Q16-V18 VanDerWaalsContact C-N 3.34Å; Q16-V18 PolarHBondContact O-N 3.13Å; V18-K22 WeakPolarHBondContact O-CG 3.42Å; V18-K22 PolarHBondContact O-N 3.04Å
19	V	57.8	Low	52.4	Low	81 Å²	81	106.8 Å²	106.8	49%	0.491	58%	0.575	S	S	.	*	H	α-helix	trans	-74.2	-43.1	176.8	173.6	0	0	0	111	I15 Q16 L17 K22	I15-V19 VanDerWaalsContact O-CG2 3.31Å; I15-V19 WeakPolarHBondContact O-CG2 3.49Å; I15-V19 PolarHBondContact O-N 3.39Å; Q16-V19 PolarHBondContact O-N 2.85Å; Q16-V19 VanDerWaalsContact O-N 3.14Å; L17-V19 VanDerWaalsContact C-N 3.3Å; L17-V19 PolarHBondContact O-N 2.9Å; V19-K22 PolarHBondContact O-N 3.22Å
20	F	51.6	Low	51.3	Low	115 Å²	115	104.2 Å²	104.2	50%	0.504	57%	0.566	S	S	.	*	H	α-helix	trans	-69.7	-41.5	177.9	-89.1	-88.7	0	0	112.2	Q16 L17 K22 C23 D24	Q16-F20 WeakPolarHBondContact O-CB 3.33Å; Q16-F20 VanDerWaalsContact O-CD2 3.32Å; Q16-F20 WeakPolarHBondContact O-CD2 3.33Å; Q16-F20 PolarHBondContact O-N 3.35Å; L17-F20 PolarHBondContact O-N 3.34Å; F20-K22 PolarHBondContact O-N 3.01Å; F20-C23 CarbonylContact O-C 3.45Å; F20-C23 WeakPolarHBondContact O-CA 3.23Å; F20-C23 WeakPolarHBondContact O-CB 3.37Å; F20-C23 PolarHBondContact O-N 3.39Å; F20-D24 PolarHBondContact O-N 3.46Å
21	S	50.8	Low	50	Low	70 Å²	70	108.4 Å²	108.4	49%	0.49	58%	0.581	S	S	.	*	H	α-helix	trans	-68.2	-20.9	176.8	-75.3	0	0	0	113.9	L17 C23 D24	L17-S21 WeakPolarHBondContact O-CB 3.47Å; L17-S21 PolarHBondContact O-N 2.9Å; L17-S21 PolarHBondContact O-OG 2.88Å; S21-C23 PolarHBondContact O-N 2.94Å; S21-D24 WeakPolarHBondContact CA-OD2 3.46Å
22	K	45.6	Very low	48.8	Very low	172 Å²	172	113 Å²	113	75%	0.748	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	-11.5	168	-78.3	176.9	177	164.4	113	V18 V19 F20	V18-K22 WeakPolarHBondContact O-CG 3.42Å; V18-K22 PolarHBondContact O-N 3.04Å; V19-K22 PolarHBondContact O-N 3.22Å; F20-K22 PolarHBondContact O-N 3.01Å
23	C	43	Very low	47.4	Very low	99 Å²	99	112.1 Å²	112.1	67%	0.669	61%	0.606	S	S	*	*	S	Bend	trans	-106.9	2.2	175.2	-60.4	0	0	0	113.3	F20 S21 G25	F20-C23 CarbonylContact O-C 3.45Å; F20-C23 WeakPolarHBondContact O-CA 3.23Å; F20-C23 WeakPolarHBondContact O-CB 3.37Å; F20-C23 PolarHBondContact O-N 3.39Å; S21-C23 PolarHBondContact O-N 2.94Å; C23-G25 VanDerWaalsContact C-N 3.26Å; C23-G25 PolarHBondContact O-N 3.32Å
24	D	41.9	Very low	46.1	Very low	118 Å²	118	118 Å²	118	63%	0.631	62%	0.619	S	S	*	*	S	Bend	trans	-88	17.9	179.9	-80.9	-51.5	0	0	113.6	F20 S21	F20-D24 PolarHBondContact O-N 3.46Å; S21-D24 WeakPolarHBondContact CA-OD2 3.46Å
25	G	38	Very low	45.1	Very low	48 Å²	48	117.4 Å²	117.4	50%	0.495	62%	0.623	S	S	.	*	S	Bend	trans	-128.2	117.8	176	0	0	0	0	110	C23 T27	C23-G25 VanDerWaalsContact C-N 3.26Å; C23-G25 PolarHBondContact O-N 3.32Å; G25-T27 PolarHBondContact O-N 2.96Å
26	W	36.3	Very low	44	Very low	253 Å²	253	116.2 Å²	116.2	96%	0.958	62%	0.623	S	S	*	*	S	Bend	trans	-67.9	71.2	174.5	-23.4	-63.5	0	0	109.1
27	T	33.4	Very low	43.1	Very low	109 Å²	109	120.5 Å²	120.5	67%	0.669	64%	0.643	S	S	*	*			trans	-157.1	89.7	172.9	-38.2	0	0	0	107.1	G25 T29	G25-T27 PolarHBondContact O-N 2.96Å; T27-T29 PolarHBondContact O-N 3.16Å; T27-T29 PolarHBondContact O-OG1 3.37Å
28	I	36.4	Very low	42.3	Very low	137 Å²	137	118.5 Å²	118.5	70%	0.703	63%	0.632	S	S	*	*			trans	-70.5	80.2	175.6	-60.6	168.2	0	0	107.2
29	T	33.4	Very low	41.4	Very low	116 Å²	116	119.8 Å²	119.8	71%	0.712	64%	0.64	S	S	*	*			trans	-100.6	80	166.6	-5.7	0	0	0	107.1	T27 N31	T27-T29 PolarHBondContact O-N 3.16Å; T27-T29 PolarHBondContact O-OG1 3.37Å; T29-N31 PolarHBondContact O-N 3.36Å
30	C	38.8	Very low	41	Very low	61 Å²	61	123.2 Å²	123.2	41%	0.412	66%	0.656	S	S	.	*			trans	-67.8	83.6	169.6	-80.3	0	0	0	109.1	E32 T33	C30-E32 PolarHBondContact O-N 3.38Å; C30-E32 VanDerWaalsContact O-N 3.15Å; C30-T33 WeakPolarHBondContact CB-O 3.29Å; C30-T33 PolarHBondContact SG-O 3.49Å
31	N	34.8	Very low	40.8	Very low	140 Å²	140	125.1 Å²	125.1	75%	0.749	67%	0.672	S	S	*	*	S	Bend	trans	-72.7	100.2	163	-130.8	7.5	0	0	106.5	T29 T33	T29-N31 PolarHBondContact O-N 3.36Å; N31-T33 PolarHBondContact O-N 3.14Å; N31-T33 PolarHBondContact O-OG1 3.33Å; N31-T33 VanDerWaalsContact O-OG1 3.13Å
32	E	40.2	Very low	40.6	Very low	185 Å²	185	123.3 Å²	123.3	86%	0.864	66%	0.664	S	S	*	*	S	Bend	trans	62.8	9.6	168	-51.3	-170.2	151.2	0	117.6	C30	C30-E32 PolarHBondContact O-N 3.38Å; C30-E32 VanDerWaalsContact O-N 3.15Å
33	T	36.7	Very low	40.6	Very low	107 Å²	107	123.2 Å²	123.2	66%	0.656	66%	0.664	S	S	*	*	S	Bend	trans	-135.6	106.3	175.7	13.3	0	0	0	110.5	C30 N31	C30-T33 WeakPolarHBondContact CB-O 3.29Å; C30-T33 PolarHBondContact SG-O 3.49Å; N31-T33 PolarHBondContact O-N 3.14Å; N31-T33 PolarHBondContact O-OG1 3.33Å; N31-T33 VanDerWaalsContact O-OG1 3.13Å
34	Y	41	Very low	40.9	Very low	198 Å²	198	121.2 Å²	121.2	78%	0.776	65%	0.646	S	S	*	*			trans	-63.2	127.1	-175.6	-63.7	-93.1	0	0	112.4
35	C	41.3	Very low	41	Very low	99 Å²	99	120 Å²	120	67%	0.669	65%	0.646	S	S	*	*			trans	-126.5	127.4	164.2	-81.7	0	0	0	109.3
36	C	42.8	Very low	41.3	Very low	70 Å²	70	119.6 Å²	119.6	47%	0.473	64%	0.635	S	S	.	*			trans	-83	128.3	176.2	-74.6	0	0	0	111.3	N38 C51	C36-N38 PolarHBondContact O-N 2.91Å; C36-C51 PolarHBondContact SG-SG 3.27Å
37	E	41	Very low	41.6	Very low	162 Å²	162	111.5 Å²	111.5	76%	0.757	61%	0.61	S	S	*	*			trans	-52.6	129.7	167.3	-176.2	175.1	-149.9	0	110.1
38	N	44.7	Very low	42.6	Very low	64 Å²	64	109.4 Å²	109.4	34%	0.342	61%	0.611	S	S	.	*			trans	-114.1	102.3	173.7	-173.9	64.3	0	0	109.7	C36 D40 G42 L44	C36-N38 PolarHBondContact O-N 2.91Å; N38-D40 PolarHBondContact O-N 2.99Å; N38-G42 PolarHBondContact ND2-N 3.03Å; N38-G42 PolarHBondContact ND2-O 3.23Å; N38-G42 PolarHBondContact OD1-O 2.88Å; N38-L44 WeakPolarHBondContact OD1-CD1 3.42Å
39	T	40.5	Very low	42.9	Very low	111 Å²	111	111 Å²	111	68%	0.681	62%	0.615	S	S	*	*			trans	-62.4	111.1	169.1	-35.6	0	0	0	108.6	N41	T39-N41 VanDerWaalsContact C-N 3.28Å; T39-N41 PolarHBondContact O-N 3.12Å
40	D	48.7	Very low	43.6	Very low	153 Å²	153	113.3 Å²	113.3	82%	0.818	61%	0.612	S	S	*	*	S	Bend	trans	53	-16.2	163.4	-80.3	-103.9	0	0	122.1	N38	N38-D40 PolarHBondContact O-N 2.99Å
41	N	46.7	Very low	43.9	Very low	156 Å²	156	113.1 Å²	113.1	83%	0.834	61%	0.61	S	S	*	*	S	Bend	trans	-142.8	34.7	-161.7	-106.8	30	0	0	119.1	T39	T39-N41 VanDerWaalsContact C-N 3.28Å; T39-N41 PolarHBondContact O-N 3.12Å
42	G	47.3	Very low	44.5	Very low	32 Å²	32	109.9 Å²	109.9	33%	0.33	60%	0.599	S	S	.	*			trans	140.6	110.7	171.4	0	0	0	0	115.9	N38 L44	N38-G42 PolarHBondContact ND2-N 3.03Å; N38-G42 PolarHBondContact ND2-O 3.23Å; N38-G42 PolarHBondContact OD1-O 2.88Å; G42-L44 PolarHBondContact O-N 2.9Å; G42-L44 VanDerWaalsContact O-N 3.12Å
43	K	46.9	Very low	44.7	Very low	170 Å²	170	104.9 Å²	104.9	74%	0.739	59%	0.589	S	S	*	*			trans	-50.8	113.7	-179.9	-61.1	177.1	179.8	-174.7	111.8
44	L	47.5	Very low	45	Very low	57 Å²	57	103 Å²	103	30%	0.298	58%	0.58	S	S	.	*			trans	-90	130.8	166.4	-78.9	112.2	0	0	109.8	N38 G42 S54	N38-L44 WeakPolarHBondContact OD1-CD1 3.42Å; G42-L44 PolarHBondContact O-N 2.9Å; G42-L44 VanDerWaalsContact O-N 3.12Å; L44-S54 VanDerWaalsContact CD2-N 3.32Å
45	C	45.1	Very low	45.2	Very low	93 Å²	93	96.2 Å²	96.2	63%	0.628	56%	0.557	S	S	*	*			trans	-107.6	130.8	165.8	-66.5	0	0	0	107.9
46	C	43.9	Very low	45.5	Very low	39 Å²	39	96.8 Å²	96.8	26%	0.264	56%	0.562	S	S	.	*			trans	-90.2	141.9	174.2	-52.4	0	0	0	109.8	C51	C46-C51 HydrophobicContact CB-CB 4.05Å; C46-C51 WeakPolarHBondContact CB-SG 3.32Å; C46-C51 WeakPolarHBondContact SG-CB 3.45Å; C46-C51 CovalentContact SG-SG 2.05Å; C46-C51 PolarHBondContact SG-SG 2.99Å
47	D	43.8	Very low	45.5	Very low	82 Å²	82	97.1 Å²	97.1	44%	0.439	56%	0.559	S	S	.	*	B	Isolated β-bridge	trans	-113.7	102.8	173.3	-173	38.5	0	0	107.8	Y50	D47-Y50 PolarHBondContact N-O 3.44Å
48	G	53	Low	45.9	Very low	66 Å²	66	96.8 Å²	96.8	68%	0.68	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.8	-139.7	-174.8	0	0	0	0	113.7	Y50	G48-Y50 PolarHBondContact O-N 3.41Å
49	E	44	Very low	46.2	Very low	171 Å²	171	100.7 Å²	100.7	80%	0.799	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74	-4.5	178.6	-68.6	-175	136.1	0	113.6
50	Y	46.2	Very low	46.8	Very low	164 Å²	164	99.3 Å²	99.3	64%	0.643	56%	0.562	S	S	*	*	B	Isolated β-bridge	trans	-119.3	116.3	-173.9	-56.2	-85.6	0	0	110.5	D47 G48 S52	D47-Y50 PolarHBondContact N-O 3.44Å; G48-Y50 PolarHBondContact O-N 3.41Å; Y50-S52 VanDerWaalsContact C-N 3.32Å; Y50-S52 PolarHBondContact O-N 3Å
51	C	46.2	Very low	46.9	Very low	56 Å²	56	94.6 Å²	94.6	38%	0.378	54%	0.536	S	S	.	.			trans	-77.7	88.9	165.8	-61.3	0	0	0	108.3	C36 C46 A53	C36-C51 PolarHBondContact SG-SG 3.27Å; C46-C51 HydrophobicContact CB-CB 4.05Å; C46-C51 WeakPolarHBondContact CB-SG 3.32Å; C46-C51 WeakPolarHBondContact SG-CB 3.45Å; C46-C51 CovalentContact SG-SG 2.05Å; C46-C51 PolarHBondContact SG-SG 2.99Å; C51-A53 PolarHBondContact O-N 3.26Å; C51-A53 VanDerWaalsContact O-N 3.14Å
52	S	46.8	Very low	47.2	Very low	72 Å²	72	90.4 Å²	90.4	50%	0.503	52%	0.517	S	S	.	.			trans	-76.8	101.2	176.9	-66.2	0	0	0	109.4	Y50	Y50-S52 VanDerWaalsContact C-N 3.32Å; Y50-S52 PolarHBondContact O-N 3Å
53	A	45.1	Very low	47.5	Very low	80 Å²	80	95.1 Å²	95.1	66%	0.661	53%	0.528	S	S	*	.			trans	28.1	118.4	157.6	0	0	0	0	118.5	C51 I55	C51-A53 PolarHBondContact O-N 3.26Å; C51-A53 VanDerWaalsContact O-N 3.14Å; A53-I55 PolarHBondContact O-N 3.37Å
54	S	42.9	Very low	47.9	Very low	68 Å²	68	90.4 Å²	90.4	48%	0.476	51%	0.508	S	S	.	.			trans	-1.3	92.9	154.6	178.5	0	0	0	114.7	L44 S56	L44-S54 VanDerWaalsContact CD2-N 3.32Å; S54-S56 PolarHBondContact O-N 3.48Å
55	I	46.1	Very low	48.2	Very low	55 Å²	55	92.8 Å²	92.8	28%	0.282	52%	0.518	S	S	.	.			trans	-80.3	84.1	167	-59.3	174.1	0	0	106.2	A53 N57 D60 L61	A53-I55 PolarHBondContact O-N 3.37Å; I55-N57 VanDerWaalsContact CG2-O 3.27Å; I55-N57 WeakPolarHBondContact CG2-O 3.28Å; I55-N57 PolarHBondContact O-N 2.77Å; I55-D60 HydrophobicContact CG2-CB 4.07Å; I55-L61 HydrophobicContact CD1-CD1 4.03Å; I55-L61 HydrophobicContact CG2-CB 4.05Å
56	S	45.7	Very low	48.7	Very low	111 Å²	111	93.4 Å²	93.4	78%	0.776	51%	0.512	S	S	*	.			trans	-71.2	-8.7	175.9	52.5	0	0	0	113	S54	S54-S56 PolarHBondContact O-N 3.48Å
57	N	43	Very low	49.4	Very low	78 Å²	78	96.4 Å²	96.4	42%	0.417	53%	0.525	S	S	.	.			trans	-127.9	119.2	-173.4	-146.8	-21.2	0	0	111.9	I55 Q59 D60 L61	I55-N57 VanDerWaalsContact CG2-O 3.27Å; I55-N57 WeakPolarHBondContact CG2-O 3.28Å; I55-N57 PolarHBondContact O-N 2.77Å; N57-Q59 PolarHBondContact O-N 3.18Å; N57-D60 PolarHBondContact O-N 3.41Å; N57-L61 PolarHBondContact O-N 2.79Å
58	H	49.9	Very low	49.9	Very low	155 Å²	155	94.9 Å²	94.9	72%	0.718	52%	0.517	S	S	*	.	H	α-helix	trans	-57.3	-21.2	-178.7	-152.7	-73.5	0	0	112.9	T62	H58-T62 PolarHBondContact O-OG1 3.45Å
59	Q	52.2	Low	50	Low	145 Å²	145	97.1 Å²	97.1	68%	0.678	51%	0.512	S	S	*	.	H	α-helix	trans	-74.2	-34.5	175.8	-65.8	-174.8	-25.9	0	113	N57 T62 K63	N57-Q59 PolarHBondContact O-N 3.18Å; Q59-T62 PolarHBondContact O-N 3.49Å; Q59-K63 PolarHBondContact O-N 2.05Å
60	D	51.9	Low	50.4	Low	83 Å²	83	95.2 Å²	95.2	44%	0.444	51%	0.505	S	S	.	.	H	α-helix	trans	-76.5	-29.3	178.5	-76.4	-44.3	0	0	112	I55 N57 T62 K63 H64	I55-D60 HydrophobicContact CG2-CB 4.07Å; N57-D60 PolarHBondContact O-N 3.41Å; D60-T62 VanDerWaalsContact C-N 3.25Å; D60-T62 PolarHBondContact O-N 3.44Å; D60-K63 PolarHBondContact O-N 3.14Å; D60-H64 WeakPolarHBondContact O-CB 3.44Å; D60-H64 PolarHBondContact O-N 3.39Å
61	L	50.9	Low	50.6	Low	53 Å²	53	91.5 Å²	91.5	28%	0.277	50%	0.503	S	S	.	.	H	α-helix	trans	-59.6	-39.9	171.1	-172.6	64.8	0	0	111.2	I55 N57 H64 Q65	I55-L61 HydrophobicContact CD1-CD1 4.03Å; I55-L61 HydrophobicContact CG2-CB 4.05Å; N57-L61 PolarHBondContact O-N 2.79Å; L61-H64 PolarHBondContact O-N 3.28Å; L61-Q65 WeakPolarHBondContact O-CB 3.27Å; L61-Q65 WeakPolarHBondContact O-CG 3.35Å; L61-Q65 PolarHBondContact O-N 3.26Å
62	T	52.6	Low	50.9	Low	68 Å²	68	96.3 Å²	96.3	42%	0.417	52%	0.518	S	S	.	.	H	α-helix	trans	-68.2	-41.1	-179.3	-47.7	0	0	0	110.9	H58 Q59 D60 Q66	H58-T62 PolarHBondContact O-OG1 3.45Å; Q59-T62 PolarHBondContact O-N 3.49Å; D60-T62 VanDerWaalsContact C-N 3.25Å; D60-T62 PolarHBondContact O-N 3.44Å; T62-Q66 WeakPolarHBondContact O-CB 3.21Å; T62-Q66 WeakPolarHBondContact O-CG 3.34Å; T62-Q66 PolarHBondContact O-N 3.48Å
63	K	54.4	Low	51	Low	131 Å²	131	101 Å²	101	57%	0.57	53%	0.529	S	S	*	.	H	α-helix	trans	-66.6	-40.8	174	-78.1	-179.1	-177	174.5	112.2	Q59 D60 Q66 N67	Q59-K63 PolarHBondContact O-N 2.05Å; D60-K63 PolarHBondContact O-N 3.14Å; K63-Q66 PolarHBondContact O-N 3.04Å; K63-N67 WeakPolarHBondContact O-CB 3.4Å; K63-N67 VanDerWaalsContact O-CG 3.31Å; K63-N67 PolarHBondContact O-N 3.11Å
64	H	55.1	Low	50.8	Low	71 Å²	71	105.8 Å²	105.8	33%	0.329	54%	0.535	S	S	.	.	H	α-helix	trans	-66.5	-43.1	178.7	-167.8	58.1	0	0	111.5	D60 L61 Q66 N67 L68	D60-H64 WeakPolarHBondContact O-CB 3.44Å; D60-H64 PolarHBondContact O-N 3.39Å; L61-H64 PolarHBondContact O-N 3.28Å; H64-Q66 PolarHBondContact O-N 2.96Å; H64-N67 PolarHBondContact O-N 3.13Å; H64-L68 WeakPolarHBondContact O-CB 3.15Å; H64-L68 WeakPolarHBondContact O-CG 3.14Å; H64-L68 PolarHBondContact O-N 3.21Å
65	Q	53.5	Low	50.8	Low	108 Å²	108	111.5 Å²	111.5	51%	0.505	55%	0.552	S	S	.	*	H	α-helix	trans	-63.8	-38.8	172.4	-75.3	-168.4	-19.3	0	112.7	L61 L68 L69	L61-Q65 WeakPolarHBondContact O-CB 3.27Å; L61-Q65 WeakPolarHBondContact O-CG 3.35Å; L61-Q65 PolarHBondContact O-N 3.26Å; Q65-L68 PolarHBondContact O-N 3.39Å; Q65-L69 WeakPolarHBondContact O-CB 3.4Å; Q65-L69 WeakPolarHBondContact O-CD1 3.33Å; Q65-L69 VanDerWaalsContact O-CG 3.23Å; Q65-L69 WeakPolarHBondContact O-CG 3.31Å; Q65-L69 PolarHBondContact O-N 2.77Å
66	Q	56.9	Low	50.5	Low	105 Å²	105	115.7 Å²	115.7	49%	0.491	57%	0.573	S	S	.	*	H	α-helix	trans	-61.9	-45.2	173.2	-79.3	174.2	-11.4	0	111.3	T62 K63 H64 L68 L69 M70	T62-Q66 WeakPolarHBondContact O-CB 3.21Å; T62-Q66 WeakPolarHBondContact O-CG 3.34Å; T62-Q66 PolarHBondContact O-N 3.48Å; K63-Q66 PolarHBondContact O-N 3.04Å; H64-Q66 PolarHBondContact O-N 2.96Å; Q66-L68 PolarHBondContact O-N 2.84Å; Q66-L69 PolarHBondContact O-N 3.33Å; Q66-M70 WeakPolarHBondContact O-CB 3.37Å; Q66-M70 WeakPolarHBondContact O-CG 3.41Å; Q66-M70 PolarHBondContact O-N 2.89Å
67	N	56.6	Low	50.2	Low	102 Å²	102	121 Å²	121	55%	0.545	59%	0.59	S	S	.	*	H	α-helix	trans	-65.1	-38	177.8	-73	-13.2	0	0	112.4	K63 H64 M70 S71	K63-N67 WeakPolarHBondContact O-CB 3.4Å; K63-N67 VanDerWaalsContact O-CG 3.31Å; K63-N67 PolarHBondContact O-N 3.11Å; H64-N67 PolarHBondContact O-N 3.13Å; N67-M70 PolarHBondContact O-N 2.98Å; N67-S71 PolarHBondContact O-N 2.85Å; N67-S71 PolarHBondContact O-OG 2.75Å
68	L	55.8	Low	50.6	Low	50 Å²	50	123.2 Å²	123.2	26%	0.262	60%	0.599	S	S	.	*	H	α-helix	trans	-65.4	-40.6	173.7	-81.5	158.6	0	0	112.3	H64 Q65 Q66 M70 S71 K72	H64-L68 WeakPolarHBondContact O-CB 3.15Å; H64-L68 WeakPolarHBondContact O-CG 3.14Å; H64-L68 PolarHBondContact O-N 3.21Å; Q65-L68 PolarHBondContact O-N 3.39Å; Q66-L68 PolarHBondContact O-N 2.84Å; L68-M70 VanDerWaalsContact C-N 3.33Å; L68-S71 PolarHBondContact O-N 3.15Å; L68-K72 WeakPolarHBondContact O-CG 3.37Å; L68-K72 PolarHBondContact O-N 3.43Å
69	L	54.7	Low	50.6	Low	113 Å²	113	121.5 Å²	121.5	59%	0.592	59%	0.593	S	S	*	*	H	α-helix	trans	-67.5	-34.3	175.1	-73.8	164.4	0	0	111.9	Q65 Q66 K73	Q65-L69 WeakPolarHBondContact O-CB 3.4Å; Q65-L69 WeakPolarHBondContact O-CD1 3.33Å; Q65-L69 VanDerWaalsContact O-CG 3.23Å; Q65-L69 WeakPolarHBondContact O-CG 3.31Å; Q65-L69 PolarHBondContact O-N 2.77Å; Q66-L69 PolarHBondContact O-N 3.33Å; L69-K73 PolarHBondContact O-N 3.48Å; L69-K73 VanDerWaalsContact O-N 3.13Å
70	M	52.5	Low	50.5	Low	131 Å²	131	120.2 Å²	120.2	65%	0.645	59%	0.588	S	S	*	*	H	α-helix	trans	-68.2	-42.9	173.1	-66.4	-79.5	-161.7	0	111.1	Q66 N67 L68 K73 F74	Q66-M70 WeakPolarHBondContact O-CB 3.37Å; Q66-M70 WeakPolarHBondContact O-CG 3.41Å; Q66-M70 PolarHBondContact O-N 2.89Å; N67-M70 PolarHBondContact O-N 2.98Å; L68-M70 VanDerWaalsContact C-N 3.33Å; M70-K73 PolarHBondContact O-N 3.28Å; M70-F74 PolarHBondContact O-N 3.38Å
71	S	51.2	Low	50.5	Low	86 Å²	86	122.4 Å²	122.4	60%	0.601	60%	0.597	S	S	*	*	H	α-helix	trans	-66.8	-34.9	176.4	-75.6	0	0	0	113.2	N67 L68 F74	N67-S71 PolarHBondContact O-N 2.85Å; N67-S71 PolarHBondContact O-OG 2.75Å; L68-S71 PolarHBondContact O-N 3.15Å; S71-F74 PolarHBondContact O-N 2.88Å
72	K	50.8	Low	50.4	Low	157 Å²	157	126.7 Å²	126.7	68%	0.683	62%	0.617	S	S	*	*	H	α-helix	trans	-73	-29.1	174.6	-73.7	-174.7	-179.8	-177	113	L68 F74	L68-K72 WeakPolarHBondContact O-CG 3.37Å; L68-K72 PolarHBondContact O-N 3.43Å; K72-F74 VanDerWaalsContact C-N 3.34Å
73	K	48.5	Very low	50.3	Low	171 Å²	171	130.6 Å²	130.6	74%	0.743	63%	0.63	S	S	*	*	H	α-helix	trans	-74	-21.9	173.8	-83.1	-174.1	172.2	-176.5	113.7	L69 M70	L69-K73 PolarHBondContact O-N 3.48Å; L69-K73 VanDerWaalsContact O-N 3.13Å; M70-K73 PolarHBondContact O-N 3.28Å
74	F	42.6	Very low	50	Low	180 Å²	180	130.6 Å²	130.6	79%	0.789	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-4.7	177	-114.5	-90.5	0	0	114.5	M70 S71 K72	M70-F74 PolarHBondContact O-N 3.38Å; S71-F74 PolarHBondContact O-N 2.88Å; K72-F74 VanDerWaalsContact C-N 3.34Å
75	K	42	Very low	49.6	Very low	189 Å²	189	135.2 Å²	135.2	82%	0.822	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.8	26.5	177.4	-148.9	171.5	-175.1	175.8	113.4
76	I	39.6	Very low	49.3	Very low	143 Å²	143	137.4 Å²	137.4	73%	0.733	67%	0.67	S	S	*	*			trans	-125.6	70.1	172.1	-51	174.9	0	0	107.4
77	I	40.3	Very low	48.6	Very low	222 Å²	222	140.4 Å²	140.4	100%	1.138	69%	0.687	S	S	*	*			trans	-135.5	0	155.1	-61	179.3	0	0	105.3

Retrieved 77 of 77 residues in 36.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).