A0A3Q0KU37_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A3Q0KU37, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 53 aa.

						>A0A3Q0KU37_SCHMA|A0A3Q0KU37
MEICALVWSGLEALRACFEILNLLLAEVGKAILPGVRRSRFRSGNPDNGFLER
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.2	Confident	89.8	Confident	199 Å²	199	111.5 Å²	111.5	98%	0.98	61%	0.607	S	S	*	*				0	-48.3	0	-63.5	-54.4	-81.8	0	0	111.8	I3 C4 A5	M1-I3 PolarHBondContact O-N 2.83Å; M1-C4 WeakPolarHBondContact O-CB 3.46Å; M1-C4 PolarHBondContact O-N 2.88Å; M1-A5 PolarHBondContact O-N 3.49Å
2	E	82	Confident	90.3	Very high	174 Å²	174	109.2 Å²	109.2	81%	0.813	59%	0.588	S	S	*	*	H	α-helix	trans	-59.3	-42.4	-177.5	-62.7	-179.9	164.1	0	0	114.2	C4 A5 L6	E2-C4 VanDerWaalsContact C-N 3.32Å; E2-C4 PolarHBondContact O-N 3.36Å; E2-A5 PolarHBondContact O-N 3.13Å; E2-L6 PolarHBondContact O-N 2.67Å
3	I	88.2	Confident	90.6	Very high	133 Å²	133	105 Å²	105	68%	0.682	58%	0.578	S	S	*	*	H	α-helix	trans	-61.1	-41.5	177.1	-59.3	172.2	0	0	0	111	M1 A5 L6 V7	M1-I3 PolarHBondContact O-N 2.83Å; I3-A5 VanDerWaalsContact C-N 3.32Å; I3-A5 PolarHBondContact O-N 2.69Å; I3-L6 PolarHBondContact O-N 2.95Å; I3-V7 HydrophobicContact CG2-CG2 4.35Å; I3-V7 WeakPolarHBondContact O-CG2 3.43Å; I3-V7 PolarHBondContact O-N 2.8Å
4	C	89.4	Confident	91	Very high	89 Å²	89	104.4 Å²	104.4	60%	0.601	57%	0.573	S	S	*	*	H	α-helix	trans	-63.6	-39.5	178.1	-55.2	0	0	0	0	111.5	M1 E2 V7 W8	M1-C4 WeakPolarHBondContact O-CB 3.46Å; M1-C4 PolarHBondContact O-N 2.88Å; E2-C4 VanDerWaalsContact C-N 3.32Å; E2-C4 PolarHBondContact O-N 3.36Å; C4-V7 PolarHBondContact O-N 2.68Å; C4-W8 VanDerWaalsContact O-CB 3.32Å; C4-W8 WeakPolarHBondContact O-CB 3.04Å; C4-W8 PolarHBondContact O-N 3.21Å
5	A	91	Very high	91.4	Very high	61 Å²	61	107.7 Å²	107.7	50%	0.504	57%	0.574	S	S	.	*	H	α-helix	trans	-65.6	-39.6	176.3	0	0	0	0	0	112	M1 E2 I3 W8 S9	M1-A5 PolarHBondContact O-N 3.49Å; E2-A5 PolarHBondContact O-N 3.13Å; I3-A5 VanDerWaalsContact C-N 3.32Å; I3-A5 PolarHBondContact O-N 2.69Å; A5-W8 PolarHBondContact O-N 3.4Å; A5-S9 WeakPolarHBondContact O-CB 3.36Å; A5-S9 PolarHBondContact O-N 3.44Å; A5-S9 PolarHBondContact O-OG 2.74Å
6	L	92.7	Very high	91.7	Very high	126 Å²	126	103.8 Å²	103.8	66%	0.66	56%	0.561	S	S	*	*	H	α-helix	trans	-65.9	-42.9	175.8	-173.7	69.3	0	0	0	112.3	E2 I3 S9 G10	E2-L6 PolarHBondContact O-N 2.67Å; I3-L6 PolarHBondContact O-N 2.95Å; L6-S9 PolarHBondContact O-OG 2.86Å; L6-G10 PolarHBondContact O-N 2.67Å
7	V	92.5	Very high	92	Very high	86 Å²	86	101.8 Å²	101.8	52%	0.521	56%	0.556	S	S	.	*	H	α-helix	trans	-64.8	-43.9	176.6	173.1	0	0	0	0	110.3	I3 C4 G10 L11	I3-V7 HydrophobicContact CG2-CG2 4.35Å; I3-V7 WeakPolarHBondContact O-CG2 3.43Å; I3-V7 PolarHBondContact O-N 2.8Å; C4-V7 PolarHBondContact O-N 2.68Å; V7-G10 PolarHBondContact O-N 2.82Å; V7-L11 HydrophobicContact CG1-CD1 4.27Å; V7-L11 WeakPolarHBondContact O-CG 3.26Å; V7-L11 PolarHBondContact O-N 3.04Å
8	W	94.2	Very high	92.3	Very high	167 Å²	167	103.1 Å²	103.1	63%	0.633	56%	0.555	S	S	*	*	H	α-helix	trans	-61.5	-49.1	177.4	-176.8	-95	0	0	0	112.2	C4 A5 G10 L11 E12	C4-W8 VanDerWaalsContact O-CB 3.32Å; C4-W8 WeakPolarHBondContact O-CB 3.04Å; C4-W8 PolarHBondContact O-N 3.21Å; A5-W8 PolarHBondContact O-N 3.4Å; W8-G10 VanDerWaalsContact C-N 3.27Å; W8-G10 PolarHBondContact O-N 3.14Å; W8-L11 PolarHBondContact O-N 3.22Å; W8-L11 VanDerWaalsContact O-N 3.14Å; W8-E12 WeakPolarHBondContact CZ2-OE1 3.47Å; W8-E12 PolarHBondContact O-N 3.06Å
9	S	92.9	Very high	92.6	Very high	63 Å²	63	103.1 Å²	103.1	44%	0.441	55%	0.552	S	S	.	*	H	α-helix	trans	-62.7	-35.8	177.7	65.9	0	0	0	0	112.2	A5 L6 E12 A13	A5-S9 WeakPolarHBondContact O-CB 3.36Å; A5-S9 PolarHBondContact O-N 3.44Å; A5-S9 PolarHBondContact O-OG 2.74Å; L6-S9 PolarHBondContact O-OG 2.86Å; S9-E12 PolarHBondContact O-N 2.79Å; S9-A13 WeakPolarHBondContact O-CB 2.97Å; S9-A13 PolarHBondContact O-N 2.84Å
10	G	92.8	Very high	92.8	Very high	32 Å²	32	103.1 Å²	103.1	33%	0.33	55%	0.55	S	S	.	*	H	α-helix	trans	-62.5	-42.1	172.5	0	0	0	0	0	113.2	L6 V7 W8 A13 L14	L6-G10 PolarHBondContact O-N 2.67Å; V7-G10 PolarHBondContact O-N 2.82Å; W8-G10 VanDerWaalsContact C-N 3.27Å; W8-G10 PolarHBondContact O-N 3.14Å; G10-A13 PolarHBondContact O-N 3.4Å; G10-L14 WeakPolarHBondContact O-CG 3.12Å; G10-L14 PolarHBondContact O-N 2.99Å
11	L	95.4	Very high	93	Very high	97 Å²	97	102.5 Å²	102.5	51%	0.508	55%	0.547	S	S	.	.	H	α-helix	trans	-67.3	-40	176.7	-70.9	173.8	0	0	0	112.3	V7 W8 L14 R15	V7-L11 HydrophobicContact CG1-CD1 4.27Å; V7-L11 WeakPolarHBondContact O-CG 3.26Å; V7-L11 PolarHBondContact O-N 3.04Å; W8-L11 PolarHBondContact O-N 3.22Å; W8-L11 VanDerWaalsContact O-N 3.14Å; L11-L14 PolarHBondContact O-N 3.44Å; L11-R15 WeakPolarHBondContact O-CB 3.27Å; L11-R15 PolarHBondContact O-N 3.48Å
12	E	96	Very high	93.9	Very high	83 Å²	83	98 Å²	98	39%	0.388	53%	0.526	S	S	.	.	H	α-helix	trans	-63.9	-42.4	174.4	-73.4	-62.5	155.3	0	0	111.5	W8 S9 L14 R15 A16	W8-E12 WeakPolarHBondContact CZ2-OE1 3.47Å; W8-E12 PolarHBondContact O-N 3.06Å; S9-E12 PolarHBondContact O-N 2.79Å; E12-L14 VanDerWaalsContact C-N 3.35Å; E12-L14 PolarHBondContact O-N 3.22Å; E12-R15 PolarHBondContact O-N 3.46Å; E12-A16 PolarHBondContact O-N 3.45Å
13	A	94.8	Very high	94.5	Very high	55 Å²	55	95.4 Å²	95.4	46%	0.455	52%	0.518	S	S	.	.	H	α-helix	trans	-60.7	-44.2	174.3	0	0	0	0	0	111.6	S9 G10 A16 C17	S9-A13 WeakPolarHBondContact O-CB 2.97Å; S9-A13 PolarHBondContact O-N 2.84Å; G10-A13 PolarHBondContact O-N 3.4Å; A13-A16 PolarHBondContact O-N 3.36Å; A13-C17 PolarHBondContact O-N 2.9Å; A13-C17 PolarHBondContact O-SG 3.27Å
14	L	96.1	Very high	94.8	Very high	97 Å²	97	93.8 Å²	93.8	51%	0.508	51%	0.51	S	S	.	.	H	α-helix	trans	-61.3	-44.4	175.4	-77.2	169.1	0	0	0	111.9	G10 L11 E12 A16 C17 F18	G10-L14 WeakPolarHBondContact O-CG 3.12Å; G10-L14 PolarHBondContact O-N 2.99Å; L11-L14 PolarHBondContact O-N 3.44Å; E12-L14 VanDerWaalsContact C-N 3.35Å; E12-L14 PolarHBondContact O-N 3.22Å; L14-A16 PolarHBondContact O-N 2.97Å; L14-C17 WeakPolarHBondContact O-CB 3.35Å; L14-C17 PolarHBondContact O-N 3.33Å; L14-F18 WeakPolarHBondContact O-CD2 3.42Å; L14-F18 PolarHBondContact O-N 2.95Å
15	R	97.3	Very high	95	Very high	154 Å²	154	95 Å²	95	58%	0.581	51%	0.51	S	S	*	.	H	α-helix	trans	-58.7	-48.4	177.1	-176.3	-177.8	-175.3	133.7	4.7	111.3	L11 E12 C17 F18 E19	L11-R15 WeakPolarHBondContact O-CB 3.27Å; L11-R15 PolarHBondContact O-N 3.48Å; E12-R15 PolarHBondContact O-N 3.46Å; R15-C17 VanDerWaalsContact C-N 3.28Å; R15-C17 PolarHBondContact O-N 3.39Å; R15-F18 PolarHBondContact O-N 3.28Å; R15-F18 VanDerWaalsContact O-N 3.14Å; R15-E19 IonicContact NE-OE1 3.19Å; R15-E19 PolarHBondContact NE-OE1 2.68Å; R15-E19 WeakPolarHBondContact O-CG 3.41Å; R15-E19 PolarHBondContact O-N 2.86Å
16	A	96	Very high	94.9	Very high	45 Å²	45	94.5 Å²	94.5	37%	0.372	51%	0.506	S	S	.	.	H	α-helix	trans	-58.9	-41	176.7	0	0	0	0	0	111.7	E12 A13 L14 E19 I20	E12-A16 PolarHBondContact O-N 3.45Å; A13-A16 PolarHBondContact O-N 3.36Å; L14-A16 PolarHBondContact O-N 2.97Å; A16-E19 PolarHBondContact O-N 3.04Å; A16-I20 VanDerWaalsContact O-CG1 3.3Å; A16-I20 WeakPolarHBondContact O-CG1 3.48Å; A16-I20 PolarHBondContact O-N 3.11Å
17	C	97.2	Very high	94.8	Very high	70 Å²	70	93.7 Å²	93.7	47%	0.473	50%	0.498	S	S	.	.	H	α-helix	trans	-61.4	-44.4	174.3	-68.2	0	0	0	0	112.5	A13 L14 R15 I20 L21	A13-C17 PolarHBondContact O-N 2.9Å; A13-C17 PolarHBondContact O-SG 3.27Å; L14-C17 WeakPolarHBondContact O-CB 3.35Å; L14-C17 PolarHBondContact O-N 3.33Å; R15-C17 VanDerWaalsContact C-N 3.28Å; R15-C17 PolarHBondContact O-N 3.39Å; C17-I20 PolarHBondContact O-N 2.89Å; C17-L21 WeakPolarHBondContact O-CB 3.5Å; C17-L21 VanDerWaalsContact O-CG 3.27Å; C17-L21 WeakPolarHBondContact O-CG 3.45Å; C17-L21 PolarHBondContact O-N 3.37Å
18	F	96.8	Very high	94.5	Very high	125 Å²	125	93.1 Å²	93.1	55%	0.548	50%	0.495	S	S	.	.	H	α-helix	trans	-64.6	-38.2	177.2	-80.4	-67.5	0	0	0	112.6	L14 R15 L21 N22	L14-F18 WeakPolarHBondContact O-CD2 3.42Å; L14-F18 PolarHBondContact O-N 2.95Å; R15-F18 PolarHBondContact O-N 3.28Å; R15-F18 VanDerWaalsContact O-N 3.14Å; F18-L21 PolarHBondContact O-N 3.37Å; F18-N22 WeakPolarHBondContact O-CB 3.27Å; F18-N22 PolarHBondContact O-N 3Å; F18-N22 PolarHBondContact O-ND2 3.03Å; F18-N22 VanDerWaalsContact O-ND2 3.11Å
19	E	97.1	Very high	94	Very high	103 Å²	103	86.4 Å²	86.4	48%	0.481	48%	0.478	S	S	.	.	H	α-helix	trans	-62.9	-45.4	175.5	-72.9	177.4	-170.3	0	0	111.2	R15 A16 N22 L23	R15-E19 IonicContact NE-OE1 3.19Å; R15-E19 PolarHBondContact NE-OE1 2.68Å; R15-E19 WeakPolarHBondContact O-CG 3.41Å; R15-E19 PolarHBondContact O-N 2.86Å; A16-E19 PolarHBondContact O-N 3.04Å; E19-N22 PolarHBondContact O-N 2.95Å; E19-L23 WeakPolarHBondContact O-CG 3.36Å; E19-L23 PolarHBondContact O-N 3.37Å
20	I	96.6	Very high	93.5	Very high	102 Å²	102	89.8 Å²	89.8	52%	0.523	49%	0.485	S	S	.	.	H	α-helix	trans	-62.5	-44.8	175.3	-66.1	165.4	0	0	0	111	A16 C17 N22 L23 L24	A16-I20 VanDerWaalsContact O-CG1 3.3Å; A16-I20 WeakPolarHBondContact O-CG1 3.48Å; A16-I20 PolarHBondContact O-N 3.11Å; C17-I20 PolarHBondContact O-N 2.89Å; I20-N22 VanDerWaalsContact C-N 3.35Å; I20-N22 PolarHBondContact O-N 3.49Å; I20-L23 PolarHBondContact O-N 3.14Å; I20-L24 HydrophobicContact CG2-CD1 4.07Å; I20-L24 HydrophobicContact CG2-CG 4.47Å; I20-L24 WeakPolarHBondContact O-CG 3.38Å; I20-L24 PolarHBondContact O-N 2.96Å
21	L	96.9	Very high	92.9	Very high	92 Å²	92	92 Å²	92	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-61.4	-41.9	177.9	-76.3	169.5	0	0	0	112.1	C17 F18 L24 L25	C17-L21 WeakPolarHBondContact O-CB 3.5Å; C17-L21 VanDerWaalsContact O-CG 3.27Å; C17-L21 WeakPolarHBondContact O-CG 3.45Å; C17-L21 PolarHBondContact O-N 3.37Å; F18-L21 PolarHBondContact O-N 3.37Å; L21-L24 PolarHBondContact O-N 3.2Å; L21-L25 WeakPolarHBondContact O-CB 3.41Å; L21-L25 WeakPolarHBondContact O-CG 3.37Å; L21-L25 PolarHBondContact O-N 3.19Å
22	N	95.4	Very high	91.9	Very high	103 Å²	103	93.1 Å²	93.1	55%	0.551	51%	0.505	S	S	*	.	H	α-helix	trans	-65.6	-38.5	177.4	-78.7	-38.2	0	0	0	112.2	F18 E19 I20 L25 A26	F18-N22 WeakPolarHBondContact O-CB 3.27Å; F18-N22 PolarHBondContact O-N 3Å; F18-N22 PolarHBondContact O-ND2 3.03Å; F18-N22 VanDerWaalsContact O-ND2 3.11Å; E19-N22 PolarHBondContact O-N 2.95Å; I20-N22 VanDerWaalsContact C-N 3.35Å; I20-N22 PolarHBondContact O-N 3.49Å; N22-L25 PolarHBondContact O-N 2.98Å; N22-A26 WeakPolarHBondContact O-CB 3.15Å; N22-A26 PolarHBondContact O-N 3.14Å
23	L	95.7	Very high	90.3	Very high	120 Å²	120	93.5 Å²	93.5	63%	0.628	51%	0.509	S	S	*	.	H	α-helix	trans	-63.4	-45.6	173.4	-73.2	170.2	0	0	0	111.4	E19 I20 L25 A26 E27	E19-L23 WeakPolarHBondContact O-CG 3.36Å; E19-L23 PolarHBondContact O-N 3.37Å; I20-L23 PolarHBondContact O-N 3.14Å; L23-L25 PolarHBondContact O-N 3.46Å; L23-A26 WeakPolarHBondContact O-CB 3.39Å; L23-A26 PolarHBondContact O-N 2.96Å; L23-E27 PolarHBondContact O-N 3.38Å
24	L	93.7	Very high	88.6	Confident	100 Å²	100	96.4 Å²	96.4	52%	0.524	52%	0.523	S	S	.	.	H	α-helix	trans	-61.7	-43.3	176.5	-71.3	172.6	0	0	0	111.8	I20 L21 A26 E27 V28	I20-L24 HydrophobicContact CG2-CD1 4.07Å; I20-L24 HydrophobicContact CG2-CG 4.47Å; I20-L24 WeakPolarHBondContact O-CG 3.38Å; I20-L24 PolarHBondContact O-N 2.96Å; L21-L24 PolarHBondContact O-N 3.2Å; L24-A26 VanDerWaalsContact C-N 3.31Å; L24-A26 PolarHBondContact O-N 3.43Å; L24-E27 PolarHBondContact O-N 2.93Å; L24-V28 WeakPolarHBondContact O-CB 3.42Å; L24-V28 VanDerWaalsContact O-CG2 3.27Å; L24-V28 WeakPolarHBondContact O-CG2 3.48Å; L24-V28 PolarHBondContact O-N 3.27Å
25	L	93	Very high	86.8	Confident	113 Å²	113	94.8 Å²	94.8	59%	0.592	53%	0.53	S	S	*	.	H	α-helix	trans	-61.6	-38.8	175.4	-79	164.8	0	0	0	112.1	L21 N22 L23 G29	L21-L25 WeakPolarHBondContact O-CB 3.41Å; L21-L25 WeakPolarHBondContact O-CG 3.37Å; L21-L25 PolarHBondContact O-N 3.19Å; N22-L25 PolarHBondContact O-N 2.98Å; L23-L25 PolarHBondContact O-N 3.46Å; L25-G29 PolarHBondContact O-N 3.33Å
26	A	90.5	Very high	84.8	Confident	51 Å²	51	92.3 Å²	92.3	42%	0.421	53%	0.531	S	S	.	.	H	α-helix	trans	-65.8	-42.2	175.9	0	0	0	0	0	111.9	N22 L23 L24 G29 K30	N22-A26 WeakPolarHBondContact O-CB 3.15Å; N22-A26 PolarHBondContact O-N 3.14Å; L23-A26 WeakPolarHBondContact O-CB 3.39Å; L23-A26 PolarHBondContact O-N 2.96Å; L24-A26 VanDerWaalsContact C-N 3.31Å; L24-A26 PolarHBondContact O-N 3.43Å; A26-G29 PolarHBondContact O-N 3.47Å; A26-K30 WeakPolarHBondContact O-CG 3.3Å; A26-K30 PolarHBondContact O-N 3.02Å
27	E	89	Confident	82.8	Confident	109 Å²	109	100.5 Å²	100.5	51%	0.509	55%	0.553	S	S	.	*	H	α-helix	trans	-65.9	-44.4	175.3	-70.5	-54.1	134.2	0	0	112.1	L23 L24 G29 K30 A31	L23-E27 PolarHBondContact O-N 3.38Å; L24-E27 PolarHBondContact O-N 2.93Å; E27-G29 VanDerWaalsContact C-N 3.32Å; E27-G29 PolarHBondContact O-N 2.93Å; E27-K30 WeakPolarHBondContact O-CB 3.4Å; E27-K30 PolarHBondContact O-N 2.97Å; E27-K30 IonicContact OE1-NZ 2.68Å; E27-K30 PolarHBondContact OE1-NZ 3.46Å; E27-K30 IonicContact OE2-NZ 3.81Å; E27-A31 PolarHBondContact O-N 2.98Å
28	V	86.3	Confident	80.6	Confident	74 Å²	74	107.7 Å²	107.7	45%	0.448	57%	0.57	S	S	.	*	H	α-helix	trans	-61.3	-41.7	173.8	170.3	0	0	0	0	110.8	L24 K30 A31 I32	L24-V28 WeakPolarHBondContact O-CB 3.42Å; L24-V28 VanDerWaalsContact O-CG2 3.27Å; L24-V28 WeakPolarHBondContact O-CG2 3.48Å; L24-V28 PolarHBondContact O-N 3.27Å; V28-K30 VanDerWaalsContact C-N 3.32Å; V28-K30 PolarHBondContact O-N 2.88Å; V28-A31 PolarHBondContact O-N 3.24Å; V28-A31 VanDerWaalsContact O-N 3.14Å; V28-I32 HydrophobicContact CG1-CD1 3.38Å; V28-I32 HydrophobicContact CG1-CG1 3.99Å; V28-I32 WeakPolarHBondContact O-CB 3.44Å; V28-I32 WeakPolarHBondContact O-CG1 3.37Å; V28-I32 PolarHBondContact O-N 2.95Å
29	G	83.8	Confident	78.4	Confident	26 Å²	26	105.9 Å²	105.9	27%	0.268	57%	0.573	S	S	.	*	H	α-helix	trans	-59.3	-40.3	175.8	0	0	0	0	0	112.5	L25 A26 E27 L33	L25-G29 PolarHBondContact O-N 3.33Å; A26-G29 PolarHBondContact O-N 3.47Å; E27-G29 VanDerWaalsContact C-N 3.32Å; E27-G29 PolarHBondContact O-N 2.93Å; G29-L33 WeakPolarHBondContact O-CA 3.42Å; G29-L33 WeakPolarHBondContact O-CB 3.49Å; G29-L33 VanDerWaalsContact O-CG 3.26Å; G29-L33 WeakPolarHBondContact O-CG 3.41Å; G29-L33 PolarHBondContact O-N 3.36Å
30	K	83.5	Confident	76.2	Confident	135 Å²	135	110.6 Å²	110.6	59%	0.587	59%	0.587	S	S	*	*	H	α-helix	trans	-65.1	-41.5	173.4	-66.9	168	-169	170.6	0	112	A26 E27 V28	A26-K30 WeakPolarHBondContact O-CG 3.3Å; A26-K30 PolarHBondContact O-N 3.02Å; E27-K30 WeakPolarHBondContact O-CB 3.4Å; E27-K30 PolarHBondContact O-N 2.97Å; E27-K30 IonicContact OE1-NZ 2.68Å; E27-K30 PolarHBondContact OE1-NZ 3.46Å; E27-K30 IonicContact OE2-NZ 3.81Å; V28-K30 VanDerWaalsContact C-N 3.32Å; V28-K30 PolarHBondContact O-N 2.88Å
31	A	79.4	Confident	74	Confident	77 Å²	77	114.5 Å²	114.5	64%	0.636	60%	0.6	S	S	*	*	H	α-helix	trans	-69.9	-39.6	-179.4	0	0	0	0	0	112.8	E27 V28 P34	E27-A31 PolarHBondContact O-N 2.98Å; V28-A31 PolarHBondContact O-N 3.24Å; V28-A31 VanDerWaalsContact O-N 3.14Å; A31-P34 WeakPolarHBondContact O-CD 3.44Å
32	I	75.1	Confident	71.6	Confident	122 Å²	122	121.4 Å²	121.4	63%	0.626	62%	0.62	S	S	*	*	H	α-helix	trans	-82.1	-30.8	-179.2	-63.6	180	0	0	0	111.7	V28 P34	V28-I32 HydrophobicContact CG1-CD1 3.38Å; V28-I32 HydrophobicContact CG1-CG1 3.99Å; V28-I32 WeakPolarHBondContact O-CB 3.44Å; V28-I32 WeakPolarHBondContact O-CG1 3.37Å; V28-I32 PolarHBondContact O-N 2.95Å; I32-P34 WeakPolarHBondContact O-CD 3.33Å
33	L	61.3	Low	69.7	Low	91 Å²	91	121 Å²	121	48%	0.476	63%	0.625	S	S	.	*			trans	-106.8	58.8	-177.2	-48.4	170.7	0	0	0	113.9	G29 G35 V36	G29-L33 WeakPolarHBondContact O-CA 3.42Å; G29-L33 WeakPolarHBondContact O-CB 3.49Å; G29-L33 VanDerWaalsContact O-CG 3.26Å; G29-L33 WeakPolarHBondContact O-CG 3.41Å; G29-L33 PolarHBondContact O-N 3.36Å; L33-G35 PolarHBondContact O-N 3.32Å; L33-V36 HydrophobicContact CB-CB 4.02Å; L33-V36 HydrophobicContact CB-CG2 4.05Å; L33-V36 HydrophobicContact CD1-CB 4.39Å; L33-V36 HydrophobicContact CD1-CG2 4.17Å; L33-V36 HydrophobicContact CD2-CB 4.38Å; L33-V36 HydrophobicContact CD2-CG2 3.5Å; L33-V36 VanDerWaalsContact CD2-CG2 3.5Å; L33-V36 HydrophobicContact CG-CB 4.48Å; L33-V36 HydrophobicContact CG-CG2 4.09Å
34	P	59.4	Low	67.6	Low	115 Å²	115	117.9 Å²	117.9	75%	0.747	62%	0.622	S	S	*	*	S	Bend	trans	-63.5	-23.7	157.5	-11.2	24.2	0	0	0	111.5	A31 I32	A31-P34 WeakPolarHBondContact O-CD 3.44Å; I32-P34 WeakPolarHBondContact O-CD 3.33Å
35	G	58.1	Low	65.7	Low	63 Å²	63	117.3 Å²	117.3	65%	0.649	62%	0.619	S	S	*	*	S	Bend	trans	-96.9	-13.7	-172.4	0	0	0	0	0	116.4	L33 R37	L33-G35 PolarHBondContact O-N 3.32Å; G35-R37 PolarHBondContact O-N 2.92Å
36	V	56	Low	64.2	Low	102 Å²	102	117 Å²	117	62%	0.618	62%	0.624	S	S	*	*	S	Bend	trans	-78.9	82.1	169.4	-179.2	0	0	0	0	106.9	L33 R38	L33-V36 HydrophobicContact CB-CB 4.02Å; L33-V36 HydrophobicContact CB-CG2 4.05Å; L33-V36 HydrophobicContact CD1-CB 4.39Å; L33-V36 HydrophobicContact CD1-CG2 4.17Å; L33-V36 HydrophobicContact CD2-CB 4.38Å; L33-V36 HydrophobicContact CD2-CG2 3.5Å; L33-V36 VanDerWaalsContact CD2-CG2 3.5Å; L33-V36 HydrophobicContact CG-CB 4.48Å; L33-V36 HydrophobicContact CG-CG2 4.09Å; V36-R38 PolarHBondContact O-N 3.48Å
37	R	54.1	Low	62.9	Low	217 Å²	217	120.2 Å²	120.2	82%	0.819	63%	0.634	S	S	*	*			trans	-28.3	123.9	171.6	-63.7	179.3	-178.8	-151.8	-0.2	108.7	G35 S39	G35-R37 PolarHBondContact O-N 2.92Å; R37-S39 PolarHBondContact O-N 2.93Å
38	R	50.1	Low	61.4	Low	221 Å²	221	121.4 Å²	121.4	83%	0.834	64%	0.644	S	S	*	*			trans	-56.3	74.2	132.7	-79.2	178.6	169.8	169.3	-2.1	106.5	V36 R40	V36-R38 PolarHBondContact O-N 3.48Å; R38-R40 PolarHBondContact O-N 3.4Å
39	S	51.9	Low	59.9	Low	88 Å²	88	121.1 Å²	121.1	62%	0.615	66%	0.656	S	S	*	*			trans	-63.1	70.6	137.7	-174.5	0	0	0	0	103.7	R37 F41	R37-S39 PolarHBondContact O-N 2.93Å; S39-F41 PolarHBondContact O-N 2.99Å
40	R	50	Low	58.8	Low	202 Å²	202	128.3 Å²	128.3	76%	0.762	68%	0.68	S	S	*	*			trans	-47.4	106.3	131.4	-86.6	-176.8	-179.5	172.9	-0.3	100.2	R38 R42	R38-R40 PolarHBondContact O-N 3.4Å; R40-R42 PolarHBondContact O-N 3.26Å
41	F	49.9	Very low	57.5	Low	184 Å²	184	129.2 Å²	129.2	81%	0.807	69%	0.691	S	S	*	*			trans	-19.3	99	138.9	-82.7	-102.6	0	0	0	104.7	S39 S43	S39-F41 PolarHBondContact O-N 2.99Å; F41-S43 PolarHBondContact O-N 3.2Å
42	R	48.1	Very low	56.3	Low	236 Å²	236	134.6 Å²	134.6	89%	0.891	70%	0.703	S	S	*	*			trans	-59.9	88	150.1	-156.9	-178.8	-169.1	-166	2.6	97.4	R40 G44	R40-R42 PolarHBondContact O-N 3.26Å; R42-G44 PolarHBondContact O-N 3.2Å
43	S	54.5	Low	55.1	Low	94 Å²	94	143.3 Å²	143.3	66%	0.657	73%	0.728	S	S	*	*			trans	-44.3	95.6	151.4	163.2	0	0	0	0	99.2	F41 N45	F41-S43 PolarHBondContact O-N 3.2Å; S43-N45 PolarHBondContact O-N 3.44Å
44	G	52.3	Low	54.7	Low	55 Å²	55	146 Å²	146	57%	0.567	74%	0.74	S	S	*	*			trans	-59.9	97.4	167.5	0	0	0	0	0	99.2	R42 P46	R42-G44 PolarHBondContact O-N 3.2Å; G44-P46 WeakPolarHBondContact O-CD 3.32Å
45	N	53.3	Low	54.5	Low	89 Å²	89	147.6 Å²	147.6	48%	0.476	74%	0.74	S	S	.	*			trans	-55.6	102.3	164.3	-177.2	24.5	0	0	0	102.7	S43 D47 N48	S43-N45 PolarHBondContact O-N 3.44Å; N45-D47 PolarHBondContact O-N 3.19Å; N45-D47 VanDerWaalsContact O-N 3.13Å; N45-N48 PolarHBondContact ND2-OD1 3.18Å
46	P	61.4	Low	54.3	Low	107 Å²	107	152.3 Å²	152.3	70%	0.695	75%	0.745	S	S	*	*	G	3₁₀ helix	trans	-73	-3.8	-171.6	28.4	-24.5	0	0	0	110.8	G44 N48	G44-P46 WeakPolarHBondContact O-CD 3.32Å; P46-N48 PolarHBondContact O-N 3.4Å
47	D	62.6	Low	54.2	Low	118 Å²	118	155.2 Å²	155.2	63%	0.631	75%	0.752	S	S	*	*	G	3₁₀ helix	trans	-88.8	-3.9	-168.6	-61.9	-17.1	0	0	0	114.8	N45	N45-D47 PolarHBondContact O-N 3.19Å; N45-D47 VanDerWaalsContact O-N 3.13Å
48	N	58.2	Low	54.2	Low	133 Å²	133	151.4 Å²	151.4	71%	0.711	75%	0.748	S	S	*	*	G	3₁₀ helix	trans	-91.8	4.2	179.7	-66.5	30.5	0	0	0	113.8	N45 P46	N45-N48 PolarHBondContact ND2-OD1 3.18Å; P46-N48 PolarHBondContact O-N 3.4Å
49	G	55.5	Low	54.5	Low	68 Å²	68	146.7 Å²	146.7	70%	0.701	74%	0.743	S	S	*	*	S	Bend	trans	-105.5	-8.8	-178.2	0	0	0	0	0	116.1
50	F	60	Low	54.7	Low	177 Å²	177	150.9 Å²	150.9	78%	0.776	75%	0.752	S	S	*	*	S	Bend	trans	-90.3	-5.9	-173.5	-170.1	-104.7	0	0	0	114.3
51	L	56.3	Low	55	Low	155 Å²	155	147 Å²	147	81%	0.812	75%	0.751	S	S	*	*	S	Bend	trans	-108.9	8.1	-172.7	-70.8	174.9	0	0	0	115.9
52	E	53.3	Low	55.4	Low	189 Å²	189	143.9 Å²	143.9	88%	0.883	75%	0.746	S	S	*	*			trans	-109.9	14.5	177	-76.2	-161.6	154	0	0	115.5
53	R	50	Low	56.1	Low	306 Å²	306	135.5 Å²	135.5	100%	1.155	73%	0.733	S	S	*	*			trans	-140.6	0	164.2	-73.6	-169.6	-112.7	-119.8	-2.2	111.1

Retrieved 53 of 53 residues in 10.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).