A0A3Q0KU46_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A3Q0KU46, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 56 aa.

						>A0A3Q0KU46_SCHMA|A0A3Q0KU46
MLVSCVVLRLVSLAHCRASIAQWLEHWSSKPGVGSSILPGGSAFALTLNWDHVQVV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.7	Confident	78.8	Confident	198 Å²	198	118.6 Å²	118.6	98%	0.975	64%	0.638	S	S	*	*				0	-57.2	0	-65.6	171.6	95.8	0	0	111.6	V3 S4 C5	M1-V3 PolarHBondContact O-N 2.82Å; M1-S4 WeakPolarHBondContact O-CB 3.37Å; M1-S4 PolarHBondContact O-N 3.15Å; M1-S4 VanDerWaalsContact O-N 3.16Å; M1-C5 PolarHBondContact O-N 3.48Å; M1-C5 PolarHBondContact O-SG 3.2Å
2	L	75.9	Confident	78.9	Confident	149 Å²	149	114.7 Å²	114.7	78%	0.78	63%	0.626	S	S	*	*	H	α-helix	trans	-54.8	-45.5	-179.2	-67.6	172.8	0	0	0	114.2	S4 C5 V6	L2-S4 VanDerWaalsContact C-N 3.34Å; L2-S4 PolarHBondContact O-N 2.77Å; L2-C5 WeakPolarHBondContact O-CB 2.83Å; L2-C5 PolarHBondContact O-N 3.38Å; L2-V6 WeakPolarHBondContact O-CG2 3.14Å; L2-V6 PolarHBondContact O-N 2.77Å
3	V	78	Confident	78.7	Confident	113 Å²	113	115.1 Å²	115.1	69%	0.685	63%	0.626	S	S	*	*	H	α-helix	trans	-58.7	-46.1	178.3	-179.4	0	0	0	0	111.3	M1 C5 V6 V7	M1-V3 PolarHBondContact O-N 2.82Å; V3-C5 VanDerWaalsContact C-N 3.33Å; V3-C5 PolarHBondContact O-N 3.2Å; V3-V6 PolarHBondContact O-N 3.17Å; V3-V7 HydrophobicContact CG1-CG2 4.46Å; V3-V7 WeakPolarHBondContact O-CG2 3.4Å; V3-V7 PolarHBondContact O-N 2.88Å
4	S	81.6	Confident	78.7	Confident	71 Å²	71	111.1 Å²	111.1	50%	0.497	62%	0.617	S	S	.	*	H	α-helix	trans	-59.9	-43.8	177	-49	0	0	0	0	111.3	M1 L2 V6 V7 L8	M1-S4 WeakPolarHBondContact O-CB 3.37Å; M1-S4 PolarHBondContact O-N 3.15Å; M1-S4 VanDerWaalsContact O-N 3.16Å; L2-S4 VanDerWaalsContact C-N 3.34Å; L2-S4 PolarHBondContact O-N 2.77Å; S4-V6 PolarHBondContact O-N 2.86Å; S4-V7 PolarHBondContact O-N 3.48Å; S4-L8 WeakPolarHBondContact O-CB 3.46Å; S4-L8 VanDerWaalsContact O-CD1 3.29Å; S4-L8 WeakPolarHBondContact O-CD1 3.13Å; S4-L8 PolarHBondContact O-N 3.21Å
5	C	79.2	Confident	78.6	Confident	76 Å²	76	112.3 Å²	112.3	51%	0.514	62%	0.616	S	S	.	*	H	α-helix	trans	-60.4	-43.8	177.4	-61.7	0	0	0	0	112.2	M1 L2 V3 L8 R9	M1-C5 PolarHBondContact O-N 3.48Å; M1-C5 PolarHBondContact O-SG 3.2Å; L2-C5 WeakPolarHBondContact O-CB 2.83Å; L2-C5 PolarHBondContact O-N 3.38Å; V3-C5 VanDerWaalsContact C-N 3.33Å; V3-C5 PolarHBondContact O-N 3.2Å; C5-L8 PolarHBondContact O-N 2.88Å; C5-R9 VanDerWaalsContact O-CG 3.27Å; C5-R9 WeakPolarHBondContact O-CG 3.27Å; C5-R9 PolarHBondContact O-N 3.49Å
6	V	84.6	Confident	78.6	Confident	87 Å²	87	109.4 Å²	109.4	53%	0.527	61%	0.605	S	S	.	*	H	α-helix	trans	-65.5	-44.6	179.2	176.2	0	0	0	0	110.8	L2 V3 S4 L8 R9 L10	L2-V6 WeakPolarHBondContact O-CG2 3.14Å; L2-V6 PolarHBondContact O-N 2.77Å; V3-V6 PolarHBondContact O-N 3.17Å; S4-V6 PolarHBondContact O-N 2.86Å; V6-L8 PolarHBondContact O-N 3.48Å; V6-R9 PolarHBondContact O-N 2.81Å; V6-L10 HydrophobicContact CG1-CD1 3.91Å; V6-L10 HydrophobicContact CG1-CG 4.39Å; V6-L10 WeakPolarHBondContact O-CG 3.35Å; V6-L10 PolarHBondContact O-N 2.83Å
7	V	80.7	Confident	78.7	Confident	80 Å²	80	114.6 Å²	114.6	49%	0.485	61%	0.613	S	S	.	*	H	α-helix	trans	-61.6	-46	177.8	173.9	0	0	0	0	111	V3 S4 R9 L10 V11	V3-V7 HydrophobicContact CG1-CG2 4.46Å; V3-V7 WeakPolarHBondContact O-CG2 3.4Å; V3-V7 PolarHBondContact O-N 2.88Å; S4-V7 PolarHBondContact O-N 3.48Å; V7-R9 VanDerWaalsContact C-N 3.32Å; V7-R9 PolarHBondContact O-N 3.31Å; V7-L10 PolarHBondContact O-N 3.2Å; V7-V11 HydrophobicContact CG1-CG2 4.25Å; V7-V11 WeakPolarHBondContact O-CB 3.49Å; V7-V11 VanDerWaalsContact O-CG2 3.31Å; V7-V11 WeakPolarHBondContact O-CG2 3.39Å; V7-V11 PolarHBondContact O-N 2.99Å
8	L	77.8	Confident	78.5	Confident	126 Å²	126	111.5 Å²	111.5	66%	0.66	61%	0.606	S	S	*	*	H	α-helix	trans	-58.5	-42.5	176.7	-95.1	128.9	0	0	0	112.2	S4 C5 V6 S12	S4-L8 WeakPolarHBondContact O-CB 3.46Å; S4-L8 VanDerWaalsContact O-CD1 3.29Å; S4-L8 WeakPolarHBondContact O-CD1 3.13Å; S4-L8 PolarHBondContact O-N 3.21Å; C5-L8 PolarHBondContact O-N 2.88Å; V6-L8 PolarHBondContact O-N 3.48Å; L8-S12 VanDerWaalsContact O-CB 3.32Å; L8-S12 WeakPolarHBondContact O-CB 3.3Å; L8-S12 PolarHBondContact O-N 3.23Å
9	R	80.8	Confident	78.4	Confident	207 Å²	207	108.7 Å²	108.7	78%	0.781	60%	0.596	S	S	*	*	H	α-helix	trans	-65.6	-43.4	177.5	-71.1	-71.6	-170.7	169.4	3.9	112.1	C5 V6 V7 S12 L13	C5-R9 VanDerWaalsContact O-CG 3.27Å; C5-R9 WeakPolarHBondContact O-CG 3.27Å; C5-R9 PolarHBondContact O-N 3.49Å; V6-R9 PolarHBondContact O-N 2.81Å; V7-R9 VanDerWaalsContact C-N 3.32Å; V7-R9 PolarHBondContact O-N 3.31Å; R9-S12 PolarHBondContact O-N 3.37Å; R9-L13 WeakPolarHBondContact O-CB 3.33Å; R9-L13 PolarHBondContact O-N 2.97Å
10	L	78.6	Confident	78.2	Confident	106 Å²	106	105.8 Å²	105.8	56%	0.555	58%	0.579	S	S	*	*	H	α-helix	trans	-65.4	-43.6	178.2	-72.3	171.7	0	0	0	111.9	V6 V7 L13 A14	V6-L10 HydrophobicContact CG1-CD1 3.91Å; V6-L10 HydrophobicContact CG1-CG 4.39Å; V6-L10 WeakPolarHBondContact O-CG 3.35Å; V6-L10 PolarHBondContact O-N 2.83Å; V7-L10 PolarHBondContact O-N 3.2Å; L10-L13 PolarHBondContact O-N 3.3Å; L10-A14 WeakPolarHBondContact O-CB 3.25Å; L10-A14 PolarHBondContact O-N 3.3Å
11	V	76.3	Confident	78	Confident	92 Å²	92	102.8 Å²	102.8	56%	0.558	57%	0.568	S	S	*	*	H	α-helix	trans	-63	-44.5	176	171.7	0	0	0	0	110.7	V7 L13 A14 H15	V7-V11 HydrophobicContact CG1-CG2 4.25Å; V7-V11 WeakPolarHBondContact O-CB 3.49Å; V7-V11 VanDerWaalsContact O-CG2 3.31Å; V7-V11 WeakPolarHBondContact O-CG2 3.39Å; V7-V11 PolarHBondContact O-N 2.99Å; V11-L13 VanDerWaalsContact C-N 3.35Å; V11-L13 PolarHBondContact O-N 2.91Å; V11-A14 PolarHBondContact O-N 3.44Å; V11-H15 WeakPolarHBondContact O-CB 3.43Å; V11-H15 PolarHBondContact O-N 3.27Å
12	S	79.2	Confident	78	Confident	71 Å²	71	100.1 Å²	100.1	50%	0.497	55%	0.553	S	S	.	*	H	α-helix	trans	-61.3	-43.4	177.2	-168.8	0	0	0	0	111.7	L8 R9 H15 C16	L8-S12 VanDerWaalsContact O-CB 3.32Å; L8-S12 WeakPolarHBondContact O-CB 3.3Å; L8-S12 PolarHBondContact O-N 3.23Å; R9-S12 PolarHBondContact O-N 3.37Å; S12-H15 PolarHBondContact O-N 2.91Å; S12-C16 PolarHBondContact O-N 3.43Å; S12-C16 PolarHBondContact O-SG 3.46Å
13	L	77.2	Confident	77.9	Confident	120 Å²	120	98.7 Å²	98.7	63%	0.628	54%	0.537	S	S	*	.	H	α-helix	trans	-65.6	-43.5	178.6	-177.2	63.7	0	0	0	111.7	R9 L10 V11 H15 C16 R17	R9-L13 WeakPolarHBondContact O-CB 3.33Å; R9-L13 PolarHBondContact O-N 2.97Å; L10-L13 PolarHBondContact O-N 3.3Å; V11-L13 VanDerWaalsContact C-N 3.35Å; V11-L13 PolarHBondContact O-N 2.91Å; L13-H15 VanDerWaalsContact C-N 3.35Å; L13-C16 PolarHBondContact O-N 2.89Å; L13-R17 WeakPolarHBondContact O-CB 3.46Å; L13-R17 PolarHBondContact O-N 2.94Å
14	A	78.3	Confident	77.8	Confident	60 Å²	60	98 Å²	98	50%	0.496	53%	0.529	S	S	.	.	H	α-helix	trans	-63.3	-40.9	177.2	0	0	0	0	0	111.8	L10 V11 R17 A18	L10-A14 WeakPolarHBondContact O-CB 3.25Å; L10-A14 PolarHBondContact O-N 3.3Å; V11-A14 PolarHBondContact O-N 3.44Å; A14-R17 PolarHBondContact O-N 3.4Å; A14-A18 WeakPolarHBondContact O-CB 3.5Å; A14-A18 PolarHBondContact O-N 3.01Å
15	H	77.3	Confident	77.1	Confident	129 Å²	129	100.6 Å²	100.6	60%	0.597	53%	0.534	S	S	*	.	H	α-helix	trans	-64	-46.5	176.5	-165.2	115	0	0	0	111.1	V11 S12 L13 R17 A18 S19	V11-H15 WeakPolarHBondContact O-CB 3.43Å; V11-H15 PolarHBondContact O-N 3.27Å; S12-H15 PolarHBondContact O-N 2.91Å; L13-H15 VanDerWaalsContact C-N 3.35Å; H15-R17 VanDerWaalsContact C-N 3.31Å; H15-R17 PolarHBondContact O-N 3.23Å; H15-A18 PolarHBondContact O-N 3.18Å; H15-S19 PolarHBondContact O-N 3.4Å; H15-S19 PolarHBondContact O-OG 3.43Å
16	C	78.7	Confident	76.7	Confident	66 Å²	66	102.8 Å²	102.8	45%	0.446	54%	0.536	S	S	.	.	H	α-helix	trans	-57.1	-46.7	174.7	-69.2	0	0	0	0	111	S12 L13 A18 S19 I20	S12-C16 PolarHBondContact O-N 3.43Å; S12-C16 PolarHBondContact O-SG 3.46Å; L13-C16 PolarHBondContact O-N 2.89Å; C16-A18 PolarHBondContact O-N 3.4Å; C16-S19 PolarHBondContact O-N 2.99Å; C16-I20 WeakPolarHBondContact O-CD1 3.35Å; C16-I20 WeakPolarHBondContact O-CG1 3.36Å; C16-I20 PolarHBondContact O-N 2.89Å
17	R	79.9	Confident	75.8	Confident	197 Å²	197	104.9 Å²	104.9	74%	0.743	54%	0.535	S	S	*	.	H	α-helix	trans	-62.8	-39.8	179.7	-171	171.4	177.7	-96.4	-0.5	112.6	L13 A14 H15 I20 A21	L13-R17 WeakPolarHBondContact O-CB 3.46Å; L13-R17 PolarHBondContact O-N 2.94Å; A14-R17 PolarHBondContact O-N 3.4Å; H15-R17 VanDerWaalsContact C-N 3.31Å; H15-R17 PolarHBondContact O-N 3.23Å; R17-I20 PolarHBondContact O-N 3.44Å; R17-A21 WeakPolarHBondContact O-CB 3.45Å; R17-A21 PolarHBondContact O-N 3.07Å
18	A	75.4	Confident	74.9	Confident	59 Å²	59	105.9 Å²	105.9	49%	0.488	55%	0.545	S	S	.	.	H	α-helix	trans	-65.4	-44.1	176.1	0	0	0	0	0	111.8	A14 H15 C16 I20 A21 Q22	A14-A18 WeakPolarHBondContact O-CB 3.5Å; A14-A18 PolarHBondContact O-N 3.01Å; H15-A18 PolarHBondContact O-N 3.18Å; C16-A18 PolarHBondContact O-N 3.4Å; A18-I20 VanDerWaalsContact C-N 3.33Å; A18-I20 PolarHBondContact O-N 3.33Å; A18-A21 PolarHBondContact O-N 2.95Å; A18-Q22 WeakPolarHBondContact O-CB 3.21Å; A18-Q22 PolarHBondContact O-N 3.37Å
19	S	76.3	Confident	74	Confident	59 Å²	59	104.3 Å²	104.3	41%	0.413	55%	0.545	S	S	.	.	H	α-helix	trans	-63.2	-38.5	176.2	-61.7	0	0	0	0	112.3	H15 C16 W23	H15-S19 PolarHBondContact O-N 3.4Å; H15-S19 PolarHBondContact O-OG 3.43Å; C16-S19 PolarHBondContact O-N 2.99Å; S19-W23 VanDerWaalsContact O-CB 3.3Å; S19-W23 WeakPolarHBondContact O-CB 3.14Å; S19-W23 PolarHBondContact O-N 2.91Å
20	I	75.8	Confident	72.7	Confident	50 Å²	50	100.5 Å²	100.5	26%	0.256	53%	0.534	S	S	.	.	H	α-helix	trans	-68.4	-43.7	175.7	-63.6	155.4	0	0	0	110.8	C16 R17 A18 Q22 W23 L24 W50	C16-I20 WeakPolarHBondContact O-CD1 3.35Å; C16-I20 WeakPolarHBondContact O-CG1 3.36Å; C16-I20 PolarHBondContact O-N 2.89Å; R17-I20 PolarHBondContact O-N 3.44Å; A18-I20 VanDerWaalsContact C-N 3.33Å; A18-I20 PolarHBondContact O-N 3.33Å; I20-Q22 VanDerWaalsContact C-N 3.35Å; I20-W23 PolarHBondContact O-N 3.43Å; I20-L24 HydrophobicContact CG2-CD1 4.13Å; I20-L24 HydrophobicContact CG2-CG 4.4Å; I20-L24 WeakPolarHBondContact O-CB 3.29Å; I20-L24 WeakPolarHBondContact O-CG 3.49Å; I20-L24 PolarHBondContact O-N 3.25Å; I20-W50 HydrophobicContact CD1-CH2 3.25Å; I20-W50 HydrophobicContact CD1-CZ2 3.51Å; I20-W50 HydrophobicContact CD1-CZ3 4.29Å; I20-W50 HydrophobicContact CG1-CH2 4.05Å; I20-W50 HydrophobicContact CG1-CZ2 3.8Å; I20-W50 HydrophobicContact CG2-CZ2 4.25Å
21	A	74	Confident	71.2	Confident	42 Å²	42	101 Å²	101	35%	0.347	54%	0.544	S	S	.	.	H	α-helix	trans	-59.9	-47.7	176.6	0	0	0	0	0	110.6	R17 A18 W23 L24 E25	R17-A21 WeakPolarHBondContact O-CB 3.45Å; R17-A21 PolarHBondContact O-N 3.07Å; A18-A21 PolarHBondContact O-N 2.95Å; A21-W23 VanDerWaalsContact C-N 3.31Å; A21-W23 PolarHBondContact O-N 3.22Å; A21-L24 PolarHBondContact O-N 3.49Å; A21-E25 WeakPolarHBondContact O-CB 3.32Å; A21-E25 WeakPolarHBondContact O-CG 3.37Å; A21-E25 PolarHBondContact O-N 3.17Å
22	Q	73.5	Confident	69.9	Low	143 Å²	143	100.1 Å²	100.1	67%	0.668	55%	0.553	S	S	*	*	H	α-helix	trans	-61.6	-38.9	176	-173.2	-178.5	-50.2	0	0	112.1	A18 I20 E25 H26	A18-Q22 WeakPolarHBondContact O-CB 3.21Å; A18-Q22 PolarHBondContact O-N 3.37Å; I20-Q22 VanDerWaalsContact C-N 3.35Å; Q22-E25 PolarHBondContact O-N 2.95Å; Q22-H26 VanDerWaalsContact O-CB 3.27Å; Q22-H26 WeakPolarHBondContact O-CB 3.4Å; Q22-H26 PolarHBondContact O-N 2.9Å
23	W	74	Confident	68.6	Low	118 Å²	118	101.6 Å²	101.6	45%	0.447	56%	0.559	S	S	.	*	H	α-helix	trans	-63.9	-47	175.1	-171.6	84.5	0	0	0	110.8	S19 I20 A21 E25 H26 W27	S19-W23 VanDerWaalsContact O-CB 3.3Å; S19-W23 WeakPolarHBondContact O-CB 3.14Å; S19-W23 PolarHBondContact O-N 2.91Å; I20-W23 PolarHBondContact O-N 3.43Å; A21-W23 VanDerWaalsContact C-N 3.31Å; A21-W23 PolarHBondContact O-N 3.22Å; W23-E25 PolarHBondContact O-N 3.42Å; W23-H26 WeakPolarHBondContact O-CB 3.45Å; W23-H26 PolarHBondContact O-N 3.23Å; W23-W27 AromaticContact CD1-NE1 3.42Å; W23-W27 AromaticContact CD2-CD1 3.36Å; W23-W27 AromaticContact CD2-NE1 3.28Å; W23-W27 VanDerWaalsContact CD2-NE1 3.28Å; W23-W27 AromaticContact CE2-CD1 3.44Å; W23-W27 VanDerWaalsContact CE2-CD1 3.44Å; W23-W27 AromaticContact CE2-CE2 3.89Å; W23-W27 AromaticContact CE2-NE1 2.87Å; W23-W27 AromaticContact CE3-CD1 3.62Å; W23-W27 AromaticContact CE3-NE1 3.97Å; W23-W27 AromaticContact CG-CD1 3.85Å; W23-W27 AromaticContact CG-NE1 3.63Å; W23-W27 AromaticContact CH2-CD1 3.94Å; W23-W27 AromaticContact CH2-NE1 3.93Å; W23-W27 AromaticContact CZ2-CD1 3.73Å; W23-W27 AromaticContact CZ2-CE2 3.94Å; W23-W27 HydrophobicContact CZ2-CZ2 4.41Å; W23-W27 AromaticContact CZ2-NE1 3.24Å; W23-W27 AromaticContact CZ3-CD1 3.9Å; W23-W27 AromaticContact NE1-CD1 3.89Å; W23-W27 AromaticContact NE1-CE2 3.89Å; W23-W27 AromaticContact NE1-NE1 2.97Å; W23-W27 PolarHBondContact O-N 3.37Å
24	L	74.6	Confident	67	Low	98 Å²	98	99.6 Å²	99.6	51%	0.513	57%	0.567	S	S	.	*	H	α-helix	trans	-62.6	-41.7	176	-72.8	174.4	0	0	0	112.3	I20 A21 H26 W27 S28	I20-L24 HydrophobicContact CG2-CD1 4.13Å; I20-L24 HydrophobicContact CG2-CG 4.4Å; I20-L24 WeakPolarHBondContact O-CB 3.29Å; I20-L24 WeakPolarHBondContact O-CG 3.49Å; I20-L24 PolarHBondContact O-N 3.25Å; A21-L24 PolarHBondContact O-N 3.49Å; L24-H26 VanDerWaalsContact C-N 3.31Å; L24-H26 PolarHBondContact O-N 2.94Å; L24-W27 PolarHBondContact O-N 3.49Å; L24-S28 WeakPolarHBondContact O-CB 3.31Å; L24-S28 PolarHBondContact O-N 3.36Å
25	E	67.4	Low	65.4	Low	127 Å²	127	101 Å²	101	59%	0.593	57%	0.573	S	S	*	*	H	α-helix	trans	-63.3	-38.9	174.7	-73.9	-177.1	103.6	0	0	111.4	A21 Q22 W23 S28 S29	A21-E25 WeakPolarHBondContact O-CB 3.32Å; A21-E25 WeakPolarHBondContact O-CG 3.37Å; A21-E25 PolarHBondContact O-N 3.17Å; Q22-E25 PolarHBondContact O-N 2.95Å; W23-E25 PolarHBondContact O-N 3.42Å; E25-S28 PolarHBondContact O-N 3.46Å; E25-S29 WeakPolarHBondContact O-CB 3.35Å; E25-S29 PolarHBondContact O-N 2.96Å; E25-S29 PolarHBondContact O-OG 3.35Å
26	H	71.2	Confident	63.9	Low	122 Å²	122	100.2 Å²	100.2	57%	0.565	58%	0.582	S	S	*	*	H	α-helix	trans	-62.1	-43.2	174.9	178.6	76.1	0	0	0	112.1	Q22 W23 L24	Q22-H26 VanDerWaalsContact O-CB 3.27Å; Q22-H26 WeakPolarHBondContact O-CB 3.4Å; Q22-H26 PolarHBondContact O-N 2.9Å; W23-H26 WeakPolarHBondContact O-CB 3.45Å; W23-H26 PolarHBondContact O-N 3.23Å; L24-H26 VanDerWaalsContact C-N 3.31Å; L24-H26 PolarHBondContact O-N 2.94Å
27	W	65.3	Low	62.7	Low	131 Å²	131	104.1 Å²	104.1	50%	0.496	60%	0.597	S	S	.	*	H	α-helix	trans	-77.6	-33.1	177.7	-64.8	109.2	0	0	0	113.2	W23 L24 K30	W23-W27 AromaticContact CD1-NE1 3.42Å; W23-W27 AromaticContact CD2-CD1 3.36Å; W23-W27 AromaticContact CD2-NE1 3.28Å; W23-W27 VanDerWaalsContact CD2-NE1 3.28Å; W23-W27 AromaticContact CE2-CD1 3.44Å; W23-W27 VanDerWaalsContact CE2-CD1 3.44Å; W23-W27 AromaticContact CE2-CE2 3.89Å; W23-W27 AromaticContact CE2-NE1 2.87Å; W23-W27 AromaticContact CE3-CD1 3.62Å; W23-W27 AromaticContact CE3-NE1 3.97Å; W23-W27 AromaticContact CG-CD1 3.85Å; W23-W27 AromaticContact CG-NE1 3.63Å; W23-W27 AromaticContact CH2-CD1 3.94Å; W23-W27 AromaticContact CH2-NE1 3.93Å; W23-W27 AromaticContact CZ2-CD1 3.73Å; W23-W27 AromaticContact CZ2-CE2 3.94Å; W23-W27 HydrophobicContact CZ2-CZ2 4.41Å; W23-W27 AromaticContact CZ2-NE1 3.24Å; W23-W27 AromaticContact CZ3-CD1 3.9Å; W23-W27 AromaticContact NE1-CD1 3.89Å; W23-W27 AromaticContact NE1-CE2 3.89Å; W23-W27 AromaticContact NE1-NE1 2.97Å; W23-W27 PolarHBondContact O-N 3.37Å; L24-W27 PolarHBondContact O-N 3.49Å; W27-K30 PolarHBondContact O-N 3.34Å
28	S	61.2	Low	61.1	Low	101 Å²	101	102.3 Å²	102.3	71%	0.706	60%	0.601	S	S	*	*	H	α-helix	trans	-69.8	-36	176.6	-174.9	0	0	0	0	111.4	L24 E25 K30	L24-S28 WeakPolarHBondContact O-CB 3.31Å; L24-S28 PolarHBondContact O-N 3.36Å; E25-S28 PolarHBondContact O-N 3.46Å; S28-K30 PolarHBondContact O-N 3.27Å; S28-K30 VanDerWaalsContact O-N 3.15Å
29	S	59.5	Low	59.6	Low	92 Å²	92	105.7 Å²	105.7	64%	0.643	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	17.4	176	-55.9	0	0	0	0	113.6	E25 P31	E25-S29 WeakPolarHBondContact O-CB 3.35Å; E25-S29 PolarHBondContact O-N 2.96Å; E25-S29 PolarHBondContact O-OG 3.35Å; S29-P31 WeakPolarHBondContact O-CD 3.27Å
30	K	52.7	Low	58.4	Low	127 Å²	127	106 Å²	106	55%	0.552	63%	0.63	S	S	*	*			trans	-98.8	74.1	165.8	-160.7	155.4	-179.2	167.9	0	109.2	W27 S28 G32 V33	W27-K30 PolarHBondContact O-N 3.34Å; S28-K30 PolarHBondContact O-N 3.27Å; S28-K30 VanDerWaalsContact O-N 3.15Å; K30-G32 PolarHBondContact O-N 3.49Å; K30-V33 HydrophobicContact CD-CG2 4.26Å; K30-V33 HydrophobicContact CG-CG2 4.16Å
31	P	48.6	Very low	57.1	Low	118 Å²	118	106.3 Å²	106.3	77%	0.766	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.8	116.2	171	31	-32.9	0	0	0	107.4	S29	S29-P31 WeakPolarHBondContact O-CD 3.27Å
32	G	49.1	Very low	56.2	Low	72 Å²	72	109.2 Å²	109.2	74%	0.742	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.3	46	157.2	0	0	0	0	0	117.1	K30 G34	K30-G32 PolarHBondContact O-N 3.49Å; G32-G34 PolarHBondContact O-N 2.94Å
33	V	50.6	Low	55.2	Low	103 Å²	103	106 Å²	106	62%	0.624	66%	0.662	S	S	*	*			trans	-83.9	76.2	138.9	-159.1	0	0	0	0	107.2	K30 S35	K30-V33 HydrophobicContact CD-CG2 4.26Å; K30-V33 HydrophobicContact CG-CG2 4.16Å; V33-S35 PolarHBondContact O-N 3.49Å
34	G	44.4	Very low	54.1	Low	78 Å²	78	107.2 Å²	107.2	80%	0.804	67%	0.671	S	S	*	*			trans	-63.7	77.9	162.1	0	0	0	0	0	108.8	G32	G32-G34 PolarHBondContact O-N 2.94Å
35	S	44.8	Very low	53	Low	90 Å²	90	105.4 Å²	105.4	63%	0.629	67%	0.67	S	S	*	*			trans	-119.6	84.9	166.9	-161.4	0	0	0	0	106.7	V33 I37	V33-S35 PolarHBondContact O-N 3.49Å; S35-I37 PolarHBondContact O-N 3.36Å
36	S	46.2	Very low	52.4	Low	111 Å²	111	104.3 Å²	104.3	78%	0.776	67%	0.667	S	S	*	*			trans	-32.4	121.3	156.1	-63.4	0	0	0	0	109.6
37	I	52.6	Low	51.4	Low	148 Å²	148	103.2 Å²	103.2	76%	0.759	67%	0.669	S	S	*	*			trans	-174.8	103.6	144.5	-84.5	141.1	0	0	0	106.2	S35	S35-I37 PolarHBondContact O-N 3.36Å
38	L	45.2	Very low	50.8	Low	159 Å²	159	102.6 Å²	102.6	83%	0.832	68%	0.676	S	S	*	*			trans	82.6	115.7	153.1	-60.9	162.8	0	0	0	119.4
39	P	45.8	Very low	50.3	Low	130 Å²	130	102.8 Å²	102.8	84%	0.844	67%	0.668	S	S	*	*	S	Bend	trans	-85.4	140	-176.2	35.6	-32.2	0	0	0	111.4
40	G	49.7	Very low	49.8	Very low	65 Å²	65	103.9 Å²	103.9	67%	0.67	66%	0.658	S	S	*	*	S	Bend	trans	113.5	-14.2	155.2	0	0	0	0	0	118.5
41	G	48.7	Very low	49.4	Very low	58 Å²	58	103.3 Å²	103.3	60%	0.598	66%	0.661	S	S	*	*	S	Bend	trans	-95.9	-43.6	-173	0	0	0	0	0	116.6
42	S	54.6	Low	49.4	Very low	103 Å²	103	105 Å²	105	72%	0.72	66%	0.659	S	S	*	*	H	α-helix	trans	-93.9	-20.8	-158.9	-54	0	0	0	0	115.5
43	A	53.2	Low	49.5	Very low	75 Å²	75	105.8 Å²	105.8	62%	0.62	65%	0.649	S	S	*	*	H	α-helix	trans	-72.9	-35	178.9	0	0	0	0	0	112.2
44	F	51.3	Low	49.4	Very low	143 Å²	143	108 Å²	108	63%	0.627	65%	0.653	S	S	*	*	H	α-helix	trans	-73.9	-25.9	179.3	-71.4	-79.1	0	0	0	113.2	L46 T47 L48	F44-L46 VanDerWaalsContact C-N 3.32Å; F44-L46 PolarHBondContact O-N 3.42Å; F44-T47 PolarHBondContact O-N 3.39Å; F44-L48 WeakPolarHBondContact O-CB 3.29Å; F44-L48 WeakPolarHBondContact O-CG 3.45Å; F44-L48 PolarHBondContact O-N 2.99Å
45	A	51.3	Low	49.2	Very low	60 Å²	60	110 Å²	110	50%	0.496	65%	0.649	S	S	.	*	H	α-helix	trans	-65	-35.9	177.7	0	0	0	0	0	112.2	N49	A45-N49 VanDerWaalsContact O-CB 3.25Å; A45-N49 WeakPolarHBondContact O-CB 3.42Å; A45-N49 PolarHBondContact O-N 3.44Å; A45-N49 VanDerWaalsContact O-N 3.07Å
46	L	54.7	Low	49	Very low	104 Å²	104	115.3 Å²	115.3	55%	0.545	68%	0.677	S	S	.	*	H	α-helix	trans	-73.7	-36.9	178.3	-66.4	174	0	0	0	112.1	F44 W50	F44-L46 VanDerWaalsContact C-N 3.32Å; F44-L46 PolarHBondContact O-N 3.42Å; L46-W50 PolarHBondContact O-N 3.26Å
47	T	49.4	Very low	49.1	Very low	99 Å²	99	115.6 Å²	115.6	61%	0.607	67%	0.672	S	S	*	*	H	α-helix	trans	-69.5	-43	177.5	-52.3	0	0	0	0	111.7	F44 N49 W50 D51	F44-T47 PolarHBondContact O-N 3.39Å; T47-N49 VanDerWaalsContact C-N 3.35Å; T47-W50 PolarHBondContact O-N 3.17Å; T47-D51 PolarHBondContact O-N 3.41Å
48	L	53.5	Low	48.9	Very low	119 Å²	119	113.8 Å²	113.8	62%	0.623	67%	0.668	S	S	*	*	H	α-helix	trans	-69.5	-32.3	177.2	-69.7	172.2	0	0	0	112.5	F44 D51 H52	F44-L48 WeakPolarHBondContact O-CB 3.29Å; F44-L48 WeakPolarHBondContact O-CG 3.45Å; F44-L48 PolarHBondContact O-N 2.99Å; L48-D51 PolarHBondContact O-N 3.16Å; L48-H52 PolarHBondContact O-N 3.27Å
49	N	49.6	Very low	49.1	Very low	104 Å²	104	111.3 Å²	111.3	56%	0.556	66%	0.659	S	S	*	*	H	α-helix	trans	-68	-37.2	177	-164.4	-103	0	0	0	111.9	A45 T47 H52 V53	A45-N49 VanDerWaalsContact O-CB 3.25Å; A45-N49 WeakPolarHBondContact O-CB 3.42Å; A45-N49 PolarHBondContact O-N 3.44Å; A45-N49 VanDerWaalsContact O-N 3.07Å; T47-N49 VanDerWaalsContact C-N 3.35Å; N49-H52 PolarHBondContact O-N 3.06Å; N49-V53 VanDerWaalsContact O-CG2 3.29Å; N49-V53 WeakPolarHBondContact O-CG2 3.45Å; N49-V53 PolarHBondContact O-N 3.02Å
50	W	49	Very low	49.3	Very low	115 Å²	115	110.2 Å²	110.2	44%	0.436	65%	0.648	S	S	.	*	H	α-helix	trans	-70.6	-32.3	176.5	-96.8	107.1	0	0	0	114.3	I20 L46 T47 H52 V53	I20-W50 HydrophobicContact CD1-CH2 3.25Å; I20-W50 HydrophobicContact CD1-CZ2 3.51Å; I20-W50 HydrophobicContact CD1-CZ3 4.29Å; I20-W50 HydrophobicContact CG1-CH2 4.05Å; I20-W50 HydrophobicContact CG1-CZ2 3.8Å; I20-W50 HydrophobicContact CG2-CZ2 4.25Å; L46-W50 PolarHBondContact O-N 3.26Å; T47-W50 PolarHBondContact O-N 3.17Å; W50-H52 VanDerWaalsContact C-N 3.33Å; W50-V53 PolarHBondContact O-N 3.07Å
51	D	45.1	Very low	49.3	Very low	115 Å²	115	113.1 Å²	113.1	62%	0.615	65%	0.646	S	S	*	*	H	α-helix	trans	-66.5	-39.7	173.1	-161.5	-109	0	0	0	110.8	T47 L48 V53 Q54	T47-D51 PolarHBondContact O-N 3.41Å; L48-D51 PolarHBondContact O-N 3.16Å; D51-V53 VanDerWaalsContact C-N 3.31Å; D51-V53 PolarHBondContact O-N 3.33Å; D51-Q54 PolarHBondContact O-N 3.31Å
52	H	48.2	Very low	49.4	Very low	155 Å²	155	116.7 Å²	116.7	72%	0.718	65%	0.649	S	S	*	*	H	α-helix	trans	-72.2	-19.7	179.7	-132.7	-85	0	0	0	114.5	L48 N49 W50	L48-H52 PolarHBondContact O-N 3.27Å; N49-H52 PolarHBondContact O-N 3.06Å; W50-H52 VanDerWaalsContact C-N 3.33Å
53	V	50.7	Low	49	Very low	87 Å²	87	117.7 Å²	117.7	53%	0.527	64%	0.644	S	S	.	*	H	α-helix	trans	-87.5	-14.6	178.4	176	0	0	0	0	112.2	N49 W50 D51	N49-V53 VanDerWaalsContact O-CG2 3.29Å; N49-V53 WeakPolarHBondContact O-CG2 3.45Å; N49-V53 PolarHBondContact O-N 3.02Å; W50-V53 PolarHBondContact O-N 3.07Å; D51-V53 VanDerWaalsContact C-N 3.31Å; D51-V53 PolarHBondContact O-N 3.33Å
54	Q	49.1	Very low	48.7	Very low	150 Å²	150	121 Å²	121	70%	0.701	65%	0.646	S	S	*	*	S	Bend	trans	-92	3.6	178.3	-71.4	-172.1	72.2	0	0	114.7	D51	D51-Q54 PolarHBondContact O-N 3.31Å
55	V	39.6	Very low	48.4	Very low	121 Å²	121	119.2 Å²	119.2	73%	0.733	65%	0.648	S	S	*	*			trans	-114.9	47.9	178.2	-163.3	0	0	0	0	112.3
56	V	41.1	Very low	48.2	Very low	201 Å²	201	124.5 Å²	124.5	100%	1.218	66%	0.662	S	S	*	*			trans	-137.8	0	161.8	174.4	0	0	0	0	108.7

Retrieved 56 of 56 residues in 11.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).