A0A3Q0KU97_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A3Q0KU97, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 63 aa.

						>A0A3Q0KU97_SCHMA|A0A3Q0KU97
MLSTKTGADKKFQTRLFVITVSTQSFTETILSIHSVILFQGIRNELDLMWPHLKNYRESPSFW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.3	Low	72.8	Confident	226 Å²	226	120.6 Å²	120.6	100%	1.113	66%	0.658	S	S	*	*				0	21.3	0	-150.8	169.4	168.8	0	0	113.6
2	L	53	Low	74.5	Confident	159 Å²	159	121.4 Å²	121.4	83%	0.832	65%	0.651	S	S	*	*			trans	-102.4	-7.3	-177.1	-100.6	107.6	0	0	0	115.5
3	S	56.4	Low	76	Confident	107 Å²	107	120.1 Å²	120.1	75%	0.748	64%	0.638	S	S	*	*	H	α-helix	trans	-83.7	-18.1	-172.5	-164.7	0	0	0	0	114.5
4	T	59.6	Low	77.3	Confident	107 Å²	107	117.7 Å²	117.7	66%	0.656	63%	0.631	S	S	*	*	H	α-helix	trans	-88	-29.4	-173.5	53.4	0	0	0	0	114.1	T6 G7 A8	T4-T6 PolarHBondContact O-N 3.4Å; T4-G7 PolarHBondContact O-N 2.86Å; T4-A8 PolarHBondContact O-N 3.04Å; T4-A8 VanDerWaalsContact O-N 3.17Å
5	K	62.9	Low	78.6	Confident	169 Å²	169	121.1 Å²	121.1	74%	0.735	63%	0.631	S	S	*	*	H	α-helix	trans	-66.4	-39.1	-176.3	-70.7	-171.4	176.7	-176.2	0	112.5	D9	K5-D9 WeakPolarHBondContact O-CB 3.44Å; K5-D9 PolarHBondContact O-N 3.44Å; K5-D9 VanDerWaalsContact O-N 3.13Å
6	T	77.4	Confident	79.6	Confident	85 Å²	85	119.2 Å²	119.2	52%	0.521	62%	0.621	S	S	.	*	H	α-helix	trans	-72.2	-36.9	-179.7	54.1	0	0	0	0	112.5	T4 K10	T4-T6 PolarHBondContact O-N 3.4Å; T6-K10 WeakPolarHBondContact O-CB 3.3Å; T6-K10 VanDerWaalsContact O-CG 3.31Å; T6-K10 WeakPolarHBondContact O-CG 3.4Å; T6-K10 PolarHBondContact O-N 3.07Å
7	G	84	Confident	80.6	Confident	41 Å²	41	120.5 Å²	120.5	42%	0.423	62%	0.621	S	S	.	*	H	α-helix	trans	-66.5	-41.2	175.9	0	0	0	0	0	112.7	T4 K11	T4-G7 PolarHBondContact O-N 2.86Å; G7-K11 VanDerWaalsContact O-CB 3.31Å; G7-K11 WeakPolarHBondContact O-CB 3.36Å; G7-K11 PolarHBondContact O-N 3.36Å
8	A	84.8	Confident	81.4	Confident	62 Å²	62	118.1 Å²	118.1	51%	0.512	61%	0.613	S	S	.	*	H	α-helix	trans	-65	-44.1	176.4	0	0	0	0	0	112.1	T4 K11 F12	T4-A8 PolarHBondContact O-N 3.04Å; T4-A8 VanDerWaalsContact O-N 3.17Å; A8-K11 PolarHBondContact O-N 3.22Å; A8-F12 WeakPolarHBondContact O-CB 3.29Å; A8-F12 PolarHBondContact O-N 3.42Å
9	D	90	Very high	82.2	Confident	83 Å²	83	117.2 Å²	117.2	44%	0.444	61%	0.607	S	S	.	*	H	α-helix	trans	-62.8	-48.5	177.2	-177.8	56.3	0	0	0	111.9	K5 K11 F12 Q13	K5-D9 WeakPolarHBondContact O-CB 3.44Å; K5-D9 PolarHBondContact O-N 3.44Å; K5-D9 VanDerWaalsContact O-N 3.13Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.89Å; D9-F12 WeakPolarHBondContact O-CB 3.32Å; D9-F12 PolarHBondContact O-N 3.3Å; D9-F12 VanDerWaalsContact O-N 3.11Å; D9-Q13 WeakPolarHBondContact O-CG 3.47Å; D9-Q13 PolarHBondContact O-N 3.44Å; D9-Q13 PolarHBondContact OD1-NE2 3.43Å; D9-Q13 PolarHBondContact OD2-NE2 3.09Å
10	K	91.3	Very high	83	Confident	141 Å²	141	115.1 Å²	115.1	61%	0.613	60%	0.6	S	S	*	*	H	α-helix	trans	-56.9	-44.8	173.9	-74	179.2	179.3	-174.3	0	112	T6 F12 Q13 T14	T6-K10 WeakPolarHBondContact O-CB 3.3Å; T6-K10 VanDerWaalsContact O-CG 3.31Å; T6-K10 WeakPolarHBondContact O-CG 3.4Å; T6-K10 PolarHBondContact O-N 3.07Å; K10-F12 VanDerWaalsContact C-N 3.33Å; K10-F12 PolarHBondContact O-N 3.35Å; K10-Q13 PolarHBondContact O-N 2.98Å; K10-T14 PolarHBondContact O-N 3.19Å; K10-T14 PolarHBondContact O-OG1 3.29Å
11	K	91.3	Very high	83.6	Confident	147 Å²	147	112.8 Å²	112.8	64%	0.639	59%	0.591	S	S	*	*	H	α-helix	trans	-62.3	-40.4	177.2	-174.6	177.6	-178	178.8	0	111.7	G7 A8 D9 R15	G7-K11 VanDerWaalsContact O-CB 3.31Å; G7-K11 WeakPolarHBondContact O-CB 3.36Å; G7-K11 PolarHBondContact O-N 3.36Å; A8-K11 PolarHBondContact O-N 3.22Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.89Å; K11-R15 VanDerWaalsContact O-CG 3.3Å; K11-R15 WeakPolarHBondContact O-CG 3.25Å; K11-R15 PolarHBondContact O-N 3.03Å; K11-R15 VanDerWaalsContact O-N 3.1Å
12	F	93.6	Very high	85.8	Confident	130 Å²	130	105.4 Å²	105.4	57%	0.57	56%	0.562	S	S	*	*	H	α-helix	trans	-65.5	-47.7	175.9	178.2	-99.7	0	0	0	111.6	A8 D9 K10 T14 R15 L16	A8-F12 WeakPolarHBondContact O-CB 3.29Å; A8-F12 PolarHBondContact O-N 3.42Å; D9-F12 WeakPolarHBondContact O-CB 3.32Å; D9-F12 PolarHBondContact O-N 3.3Å; D9-F12 VanDerWaalsContact O-N 3.11Å; K10-F12 VanDerWaalsContact C-N 3.33Å; K10-F12 PolarHBondContact O-N 3.35Å; F12-T14 VanDerWaalsContact C-N 3.35Å; F12-T14 PolarHBondContact O-N 2.9Å; F12-R15 PolarHBondContact O-N 2.78Å; F12-R15 VanDerWaalsContact O-N 3.13Å; F12-L16 HydrophobicContact CE1-CD2 4.48Å; F12-L16 PolarHBondContact O-N 3.21Å
13	Q	93.3	Very high	87.8	Confident	104 Å²	104	101.6 Å²	101.6	49%	0.486	55%	0.545	S	S	.	.	H	α-helix	trans	-58.9	-43.2	176.6	-71.2	175.1	4.6	0	0	112.1	D9 K10 R15 L16 F17	D9-Q13 WeakPolarHBondContact O-CG 3.47Å; D9-Q13 PolarHBondContact O-N 3.44Å; D9-Q13 PolarHBondContact OD1-NE2 3.43Å; D9-Q13 PolarHBondContact OD2-NE2 3.09Å; K10-Q13 PolarHBondContact O-N 2.98Å; Q13-R15 PolarHBondContact O-N 2.95Å; Q13-L16 PolarHBondContact O-N 2.9Å; Q13-F17 WeakPolarHBondContact O-CB 3.46Å; Q13-F17 PolarHBondContact O-N 3.38Å
14	T	94.8	Very high	89.7	Confident	87 Å²	87	101.7 Å²	101.7	53%	0.534	53%	0.534	S	S	.	.	H	α-helix	trans	-61.8	-43	174.8	-58.2	0	0	0	0	111.7	K10 F12 F17 V18	K10-T14 PolarHBondContact O-N 3.19Å; K10-T14 PolarHBondContact O-OG1 3.29Å; F12-T14 VanDerWaalsContact C-N 3.35Å; F12-T14 PolarHBondContact O-N 2.9Å; T14-F17 PolarHBondContact O-N 3.44Å; T14-V18 WeakPolarHBondContact O-CG2 3.45Å; T14-V18 PolarHBondContact O-N 2.94Å
15	R	95.8	Very high	91.5	Very high	168 Å²	168	99.6 Å²	99.6	63%	0.634	52%	0.523	S	S	*	.	H	α-helix	trans	-63.8	-42.7	176.3	-71.2	177.5	76.4	-172.6	5	111.9	K11 F12 Q13 V18 I19	K11-R15 VanDerWaalsContact O-CG 3.3Å; K11-R15 WeakPolarHBondContact O-CG 3.25Å; K11-R15 PolarHBondContact O-N 3.03Å; K11-R15 VanDerWaalsContact O-N 3.1Å; F12-R15 PolarHBondContact O-N 2.78Å; F12-R15 VanDerWaalsContact O-N 3.13Å; Q13-R15 PolarHBondContact O-N 2.95Å; R15-V18 PolarHBondContact O-N 3.05Å; R15-I19 VanDerWaalsContact O-CG1 3.29Å; R15-I19 WeakPolarHBondContact O-CG1 3.46Å; R15-I19 PolarHBondContact O-N 2.86Å
16	L	96	Very high	93.1	Very high	91 Å²	91	97.9 Å²	97.9	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-62.7	-44.1	176.8	-176.1	64.5	0	0	0	110.9	F12 Q13 V18 I19 T20	F12-L16 HydrophobicContact CE1-CD2 4.48Å; F12-L16 PolarHBondContact O-N 3.21Å; Q13-L16 PolarHBondContact O-N 2.9Å; L16-V18 PolarHBondContact O-N 2.89Å; L16-I19 PolarHBondContact O-N 3.29Å; L16-T20 PolarHBondContact O-N 2.91Å; L16-T20 PolarHBondContact O-OG1 3.31Å
17	F	96	Very high	94	Very high	141 Å²	141	97.1 Å²	97.1	62%	0.618	51%	0.511	S	S	*	.	H	α-helix	trans	-58.4	-47.4	175.4	177.9	-100.6	0	0	0	112.2	Q13 T14 I19 T20 V21	Q13-F17 WeakPolarHBondContact O-CB 3.46Å; Q13-F17 PolarHBondContact O-N 3.38Å; T14-F17 PolarHBondContact O-N 3.44Å; F17-I19 PolarHBondContact O-N 3.38Å; F17-T20 PolarHBondContact O-N 3.19Å; F17-V21 HydrophobicContact CD1-CG2 4.31Å; F17-V21 HydrophobicContact CD2-CG2 4.22Å; F17-V21 HydrophobicContact CE1-CG2 3.91Å; F17-V21 HydrophobicContact CE2-CG2 3.8Å; F17-V21 HydrophobicContact CG-CG2 4.46Å; F17-V21 HydrophobicContact CZ-CG2 3.64Å; F17-V21 WeakPolarHBondContact O-CG2 3.41Å; F17-V21 PolarHBondContact O-N 2.86Å
18	V	95.7	Very high	94.7	Very high	78 Å²	78	100.2 Å²	100.2	47%	0.473	52%	0.515	S	S	.	.	H	α-helix	trans	-59.9	-45.7	177.1	171.6	0	0	0	0	110.9	T14 R15 L16 T20 V21 S22	T14-V18 WeakPolarHBondContact O-CG2 3.45Å; T14-V18 PolarHBondContact O-N 2.94Å; R15-V18 PolarHBondContact O-N 3.05Å; L16-V18 PolarHBondContact O-N 2.89Å; V18-T20 PolarHBondContact O-N 3.38Å; V18-V21 PolarHBondContact O-N 3.44Å; V18-S22 WeakPolarHBondContact O-CB 3.47Å; V18-S22 PolarHBondContact O-N 3.44Å; V18-S22 PolarHBondContact O-OG 3.42Å
19	I	96.7	Very high	95.3	Very high	100 Å²	100	100.5 Å²	100.5	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-60.5	-45.3	177.5	-68.6	165.7	0	0	0	110.9	R15 L16 F17 S22 T23	R15-I19 VanDerWaalsContact O-CG1 3.29Å; R15-I19 WeakPolarHBondContact O-CG1 3.46Å; R15-I19 PolarHBondContact O-N 2.86Å; L16-I19 PolarHBondContact O-N 3.29Å; F17-I19 PolarHBondContact O-N 3.38Å; I19-S22 PolarHBondContact O-N 3.43Å; I19-T23 VanDerWaalsContact O-CB 3.31Å; I19-T23 WeakPolarHBondContact O-CB 3.19Å; I19-T23 PolarHBondContact O-N 3.48Å; I19-T23 PolarHBondContact O-OG1 2.78Å
20	T	96.6	Very high	95.6	Very high	76 Å²	76	100.7 Å²	100.7	47%	0.466	51%	0.511	S	S	.	.	H	α-helix	trans	-61.9	-49.3	179.4	-59.9	0	0	0	0	111.4	L16 F17 V18 S22 T23 Q24	L16-T20 PolarHBondContact O-N 2.91Å; L16-T20 PolarHBondContact O-OG1 3.31Å; F17-T20 PolarHBondContact O-N 3.19Å; V18-T20 PolarHBondContact O-N 3.38Å; T20-S22 PolarHBondContact O-N 3.35Å; T20-T23 PolarHBondContact O-N 2.84Å; T20-Q24 WeakPolarHBondContact O-CB 3.33Å; T20-Q24 PolarHBondContact O-N 2.97Å
21	V	96.2	Very high	95.9	Very high	66 Å²	66	99.4 Å²	99.4	40%	0.4	51%	0.51	S	S	.	.	H	α-helix	trans	-63.8	-42.6	179.7	173	0	0	0	0	111.1	F17 V18 Q24 S25	F17-V21 HydrophobicContact CD1-CG2 4.31Å; F17-V21 HydrophobicContact CD2-CG2 4.22Å; F17-V21 HydrophobicContact CE1-CG2 3.91Å; F17-V21 HydrophobicContact CE2-CG2 3.8Å; F17-V21 HydrophobicContact CG-CG2 4.46Å; F17-V21 HydrophobicContact CZ-CG2 3.64Å; F17-V21 WeakPolarHBondContact O-CG2 3.41Å; F17-V21 PolarHBondContact O-N 2.86Å; V18-V21 PolarHBondContact O-N 3.44Å; V21-Q24 PolarHBondContact O-N 3.27Å; V21-S25 WeakPolarHBondContact O-CB 3.2Å; V21-S25 PolarHBondContact O-N 2.92Å
22	S	95.7	Very high	96.2	Very high	72 Å²	72	95.6 Å²	95.6	50%	0.503	50%	0.502	S	S	.	.	H	α-helix	trans	-64.1	-40.7	176	-64.7	0	0	0	0	112.3	V18 I19 T20 S25 F26	V18-S22 WeakPolarHBondContact O-CB 3.47Å; V18-S22 PolarHBondContact O-N 3.44Å; V18-S22 PolarHBondContact O-OG 3.42Å; I19-S22 PolarHBondContact O-N 3.43Å; T20-S22 PolarHBondContact O-N 3.35Å; S22-S25 PolarHBondContact O-N 3.2Å; S22-F26 WeakPolarHBondContact O-CB 3.2Å; S22-F26 PolarHBondContact O-N 2.88Å
23	T	96.2	Very high	96.4	Very high	78 Å²	78	93.6 Å²	93.6	48%	0.479	50%	0.496	S	S	.	.	H	α-helix	trans	-67.2	-41.5	178.5	-56.1	0	0	0	0	111.2	I19 T20 F26 T27	I19-T23 VanDerWaalsContact O-CB 3.31Å; I19-T23 WeakPolarHBondContact O-CB 3.19Å; I19-T23 PolarHBondContact O-N 3.48Å; I19-T23 PolarHBondContact O-OG1 2.78Å; T20-T23 PolarHBondContact O-N 2.84Å; T23-F26 PolarHBondContact O-N 3.44Å; T23-T27 WeakPolarHBondContact O-CB 3.35Å; T23-T27 PolarHBondContact O-N 2.88Å; T23-T27 PolarHBondContact O-OG1 2.9Å
24	Q	96.2	Very high	96.6	Very high	109 Å²	109	93.9 Å²	93.9	51%	0.509	50%	0.497	S	S	.	.	H	α-helix	trans	-62.7	-50	175.5	-178.3	178.1	-15.2	0	0	111	T20 V21 F26 T27 E28	T20-Q24 WeakPolarHBondContact O-CB 3.33Å; T20-Q24 PolarHBondContact O-N 2.97Å; V21-Q24 PolarHBondContact O-N 3.27Å; Q24-F26 VanDerWaalsContact C-N 3.3Å; Q24-F26 PolarHBondContact O-N 3.33Å; Q24-T27 WeakPolarHBondContact O-CB 3.25Å; Q24-T27 PolarHBondContact O-N 3.42Å; Q24-T27 VanDerWaalsContact O-N 3.11Å; Q24-E28 WeakPolarHBondContact CG-OE1 3.3Å; Q24-E28 PolarHBondContact NE2-OE1 3.41Å; Q24-E28 WeakPolarHBondContact O-CG 3.39Å; Q24-E28 PolarHBondContact O-N 3Å
25	S	96.3	Very high	96.7	Very high	63 Å²	63	91.8 Å²	91.8	44%	0.441	49%	0.486	S	S	.	.	H	α-helix	trans	-59.9	-40.1	178.3	178.5	0	0	0	0	112.4	V21 S22 T29	V21-S25 WeakPolarHBondContact O-CB 3.2Å; V21-S25 PolarHBondContact O-N 2.92Å; S22-S25 PolarHBondContact O-N 3.2Å; S25-T29 WeakPolarHBondContact O-CB 3.37Å; S25-T29 PolarHBondContact O-N 3.22Å; S25-T29 PolarHBondContact O-OG1 3.48Å
26	F	96.8	Very high	96.8	Very high	133 Å²	133	88 Å²	88	58%	0.583	48%	0.482	S	S	*	.	H	α-helix	trans	-62.5	-46.4	174.1	-178.9	-101.8	0	0	0	111.5	S22 T23 Q24 E28 T29 I30	S22-F26 WeakPolarHBondContact O-CB 3.2Å; S22-F26 PolarHBondContact O-N 2.88Å; T23-F26 PolarHBondContact O-N 3.44Å; Q24-F26 VanDerWaalsContact C-N 3.3Å; Q24-F26 PolarHBondContact O-N 3.33Å; F26-E28 PolarHBondContact O-N 2.87Å; F26-T29 WeakPolarHBondContact O-CB 3.46Å; F26-T29 PolarHBondContact O-N 3.31Å; F26-I30 HydrophobicContact CD1-CG1 4.22Å; F26-I30 HydrophobicContact CE1-CD1 4.37Å; F26-I30 HydrophobicContact CE1-CG1 3.82Å; F26-I30 HydrophobicContact CE2-CD1 4.21Å; F26-I30 HydrophobicContact CE2-CG1 4.26Å; F26-I30 HydrophobicContact CZ-CD1 3.89Å; F26-I30 HydrophobicContact CZ-CG1 3.84Å; F26-I30 WeakPolarHBondContact O-CG1 3.38Å; F26-I30 PolarHBondContact O-N 2.91Å
27	T	97.3	Very high	96.8	Very high	69 Å²	69	89 Å²	89	42%	0.423	49%	0.486	S	S	.	.	H	α-helix	trans	-60.3	-45.9	178.4	-55.3	0	0	0	0	111.5	T23 Q24 T29 I30 L31	T23-T27 WeakPolarHBondContact O-CB 3.35Å; T23-T27 PolarHBondContact O-N 2.88Å; T23-T27 PolarHBondContact O-OG1 2.9Å; Q24-T27 WeakPolarHBondContact O-CB 3.25Å; Q24-T27 PolarHBondContact O-N 3.42Å; Q24-T27 VanDerWaalsContact O-N 3.11Å; T27-T29 VanDerWaalsContact C-N 3.31Å; T27-T29 PolarHBondContact O-N 3.48Å; T27-I30 PolarHBondContact O-N 3.41Å; T27-L31 HydrophobicContact CG2-CD1 4.2Å; T27-L31 WeakPolarHBondContact O-CG 3.35Å; T27-L31 PolarHBondContact O-N 2.68Å
28	E	97.2	Very high	96.8	Very high	106 Å²	106	86.8 Å²	86.8	50%	0.495	48%	0.48	S	S	.	.	H	α-helix	trans	-61.4	-39.4	176.2	-71.9	171.6	-174	0	0	111.8	Q24 F26 L31 S32	Q24-E28 WeakPolarHBondContact CG-OE1 3.3Å; Q24-E28 PolarHBondContact NE2-OE1 3.41Å; Q24-E28 WeakPolarHBondContact O-CG 3.39Å; Q24-E28 PolarHBondContact O-N 3Å; F26-E28 PolarHBondContact O-N 2.87Å; E28-L31 PolarHBondContact O-N 3.03Å; E28-S32 VanDerWaalsContact O-CB 3.29Å; E28-S32 WeakPolarHBondContact O-CB 3.28Å; E28-S32 PolarHBondContact O-N 2.9Å
29	T	97.8	Very high	96.9	Very high	69 Å²	69	89.4 Å²	89.4	42%	0.423	49%	0.486	S	S	.	.	H	α-helix	trans	-63.2	-46	175.7	-58.5	0	0	0	0	111.3	S25 F26 T27 S32 I33	S25-T29 WeakPolarHBondContact O-CB 3.37Å; S25-T29 PolarHBondContact O-N 3.22Å; S25-T29 PolarHBondContact O-OG1 3.48Å; F26-T29 WeakPolarHBondContact O-CB 3.46Å; F26-T29 PolarHBondContact O-N 3.31Å; T27-T29 VanDerWaalsContact C-N 3.31Å; T27-T29 PolarHBondContact O-N 3.48Å; T29-S32 PolarHBondContact O-N 3.42Å; T29-I33 HydrophobicContact CG2-CD1 3.92Å; T29-I33 WeakPolarHBondContact O-CG1 3.44Å; T29-I33 PolarHBondContact O-N 3.27Å
30	I	97.7	Very high	96.9	Very high	86 Å²	86	89.4 Å²	89.4	44%	0.441	48%	0.484	S	S	.	.	H	α-helix	trans	-62.9	-44.8	177.8	-65.7	-61.9	0	0	0	111.1	F26 T27 S32 I33 H34	F26-I30 HydrophobicContact CD1-CG1 4.22Å; F26-I30 HydrophobicContact CE1-CD1 4.37Å; F26-I30 HydrophobicContact CE1-CG1 3.82Å; F26-I30 HydrophobicContact CE2-CD1 4.21Å; F26-I30 HydrophobicContact CE2-CG1 4.26Å; F26-I30 HydrophobicContact CZ-CD1 3.89Å; F26-I30 HydrophobicContact CZ-CG1 3.84Å; F26-I30 WeakPolarHBondContact O-CG1 3.38Å; F26-I30 PolarHBondContact O-N 2.91Å; T27-I30 PolarHBondContact O-N 3.41Å; I30-S32 VanDerWaalsContact C-N 3.34Å; I30-S32 PolarHBondContact O-N 3.41Å; I30-I33 PolarHBondContact O-N 3.22Å; I30-H34 WeakPolarHBondContact O-CB 3.4Å; I30-H34 PolarHBondContact O-N 2.97Å
31	L	97.4	Very high	96.9	Very high	114 Å²	114	87.2 Å²	87.2	60%	0.597	48%	0.476	S	S	*	.	H	α-helix	trans	-62.6	-41	176.9	-71.6	173.5	0	0	0	111.9	T27 E28 H34 S35	T27-L31 HydrophobicContact CG2-CD1 4.2Å; T27-L31 WeakPolarHBondContact O-CG 3.35Å; T27-L31 PolarHBondContact O-N 2.68Å; E28-L31 PolarHBondContact O-N 3.03Å; L31-H34 PolarHBondContact O-N 3.44Å; L31-S35 WeakPolarHBondContact O-CB 3.32Å; L31-S35 PolarHBondContact O-N 2.97Å
32	S	97.8	Very high	96.9	Very high	67 Å²	67	89 Å²	89	47%	0.469	48%	0.482	S	S	.	.	H	α-helix	trans	-61	-51.1	176.1	-178.5	0	0	0	0	111.4	E28 T29 I30 H34 S35 V36	E28-S32 VanDerWaalsContact O-CB 3.29Å; E28-S32 WeakPolarHBondContact O-CB 3.28Å; E28-S32 PolarHBondContact O-N 2.9Å; T29-S32 PolarHBondContact O-N 3.42Å; I30-S32 VanDerWaalsContact C-N 3.34Å; I30-S32 PolarHBondContact O-N 3.41Å; S32-H34 VanDerWaalsContact C-N 3.35Å; S32-H34 PolarHBondContact O-N 3.34Å; S32-S35 PolarHBondContact O-N 2.89Å; S32-S35 PolarHBondContact O-OG 3.45Å; S32-V36 WeakPolarHBondContact O-CG2 3.48Å; S32-V36 PolarHBondContact O-N 2.94Å
33	I	97.7	Very high	96.8	Very high	89 Å²	89	94 Å²	94	46%	0.456	49%	0.49	S	S	.	.	H	α-helix	trans	-59.7	-46.3	177.5	-67.4	166.7	0	0	0	110.9	T29 I30 S35 V36 I37	T29-I33 HydrophobicContact CG2-CD1 3.92Å; T29-I33 WeakPolarHBondContact O-CG1 3.44Å; T29-I33 PolarHBondContact O-N 3.27Å; I30-I33 PolarHBondContact O-N 3.22Å; I33-S35 VanDerWaalsContact C-N 3.31Å; I33-S35 PolarHBondContact O-N 3.47Å; I33-V36 PolarHBondContact O-N 2.94Å; I33-I37 HydrophobicContact CG2-CD1 3.83Å; I33-I37 HydrophobicContact CG2-CG1 4.48Å; I33-I37 WeakPolarHBondContact O-CG1 3.03Å; I33-I37 PolarHBondContact O-N 2.77Å
34	H	96.4	Very high	96.8	Very high	109 Å²	109	94.6 Å²	94.6	51%	0.505	49%	0.49	S	S	.	.	H	α-helix	trans	-60.4	-42.6	179.3	-168.6	88.5	0	0	0	111.5	I30 L31 S32 V36 I37 L38	I30-H34 WeakPolarHBondContact O-CB 3.4Å; I30-H34 PolarHBondContact O-N 2.97Å; L31-H34 PolarHBondContact O-N 3.44Å; S32-H34 VanDerWaalsContact C-N 3.35Å; S32-H34 PolarHBondContact O-N 3.34Å; H34-V36 PolarHBondContact O-N 3.43Å; H34-I37 PolarHBondContact O-N 3.19Å; H34-L38 VanDerWaalsContact CD2-CD1 3.44Å; H34-L38 WeakPolarHBondContact CD2-CD1 3.4Å; H34-L38 WeakPolarHBondContact NE2-CD1 3.33Å; H34-L38 WeakPolarHBondContact O-CG 3.48Å; H34-L38 PolarHBondContact O-N 2.71Å
35	S	97.4	Very high	96.8	Very high	44 Å²	44	95.6 Å²	95.6	31%	0.308	50%	0.495	S	S	.	.	H	α-helix	trans	-60.9	-44.8	176.4	77.5	0	0	0	0	111.7	L31 S32 I33 I37 L38 F39	L31-S35 WeakPolarHBondContact O-CB 3.32Å; L31-S35 PolarHBondContact O-N 2.97Å; S32-S35 PolarHBondContact O-N 2.89Å; S32-S35 PolarHBondContact O-OG 3.45Å; I33-S35 VanDerWaalsContact C-N 3.31Å; I33-S35 PolarHBondContact O-N 3.47Å; S35-I37 VanDerWaalsContact C-N 3.34Å; S35-I37 PolarHBondContact O-N 2.79Å; S35-L38 PolarHBondContact O-N 2.94Å; S35-F39 WeakPolarHBondContact O-CB 3.42Å; S35-F39 WeakPolarHBondContact O-CD2 3.37Å; S35-F39 PolarHBondContact O-N 3.11Å
36	V	96.8	Very high	96.8	Very high	89 Å²	89	97.1 Å²	97.1	54%	0.539	50%	0.498	S	S	.	.	H	α-helix	trans	-60.6	-44	177.7	172.5	0	0	0	0	111	S32 I33 H34 F39 Q40	S32-V36 WeakPolarHBondContact O-CG2 3.48Å; S32-V36 PolarHBondContact O-N 2.94Å; I33-V36 PolarHBondContact O-N 2.94Å; H34-V36 PolarHBondContact O-N 3.43Å; V36-F39 PolarHBondContact O-N 3.46Å; V36-Q40 WeakPolarHBondContact O-CB 3.36Å; V36-Q40 PolarHBondContact O-N 2.92Å
37	I	96.9	Very high	96.7	Very high	111 Å²	111	96.5 Å²	96.5	57%	0.569	50%	0.5	S	S	*	.	H	α-helix	trans	-62.4	-46.4	177.8	-67.2	167.9	0	0	0	110.8	I33 H34 S35 Q40 G41	I33-I37 HydrophobicContact CG2-CD1 3.83Å; I33-I37 HydrophobicContact CG2-CG1 4.48Å; I33-I37 WeakPolarHBondContact O-CG1 3.03Å; I33-I37 PolarHBondContact O-N 2.77Å; H34-I37 PolarHBondContact O-N 3.19Å; S35-I37 VanDerWaalsContact C-N 3.34Å; S35-I37 PolarHBondContact O-N 2.79Å; I37-Q40 PolarHBondContact O-N 3.36Å; I37-G41 PolarHBondContact O-N 2.89Å
38	L	96.6	Very high	96.6	Very high	95 Å²	95	99.3 Å²	99.3	50%	0.497	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-46.3	177.6	-72	178	0	0	0	111.8	H34 S35 Q40 G41 I42	H34-L38 VanDerWaalsContact CD2-CD1 3.44Å; H34-L38 WeakPolarHBondContact CD2-CD1 3.4Å; H34-L38 WeakPolarHBondContact NE2-CD1 3.33Å; H34-L38 WeakPolarHBondContact O-CG 3.48Å; H34-L38 PolarHBondContact O-N 2.71Å; S35-L38 PolarHBondContact O-N 2.94Å; L38-Q40 VanDerWaalsContact C-N 3.32Å; L38-Q40 PolarHBondContact O-N 2.93Å; L38-G41 PolarHBondContact O-N 3.27Å; L38-I42 WeakPolarHBondContact O-CG1 3.43Å; L38-I42 PolarHBondContact O-N 3.44Å
39	F	96.7	Very high	96.5	Very high	132 Å²	132	99.2 Å²	99.2	58%	0.579	51%	0.513	S	S	*	.	H	α-helix	trans	-64.4	-37.1	178	-79	-63.6	0	0	0	112.2	S35 V36 R43	S35-F39 WeakPolarHBondContact O-CB 3.42Å; S35-F39 WeakPolarHBondContact O-CD2 3.37Å; S35-F39 PolarHBondContact O-N 3.11Å; V36-F39 PolarHBondContact O-N 3.46Å; F39-R43 WeakPolarHBondContact O-CB 3.45Å; F39-R43 VanDerWaalsContact O-CG 3.3Å; F39-R43 WeakPolarHBondContact O-CG 3.31Å; F39-R43 PolarHBondContact O-N 3.48Å
40	Q	97.4	Very high	96.3	Very high	101 Å²	101	103.4 Å²	103.4	47%	0.472	52%	0.521	S	S	.	.	H	α-helix	trans	-66.8	-40.6	174.1	-170.5	62.6	52.1	0	0	111.2	V36 I37 L38 R43 N44	V36-Q40 WeakPolarHBondContact O-CB 3.36Å; V36-Q40 PolarHBondContact O-N 2.92Å; I37-Q40 PolarHBondContact O-N 3.36Å; L38-Q40 VanDerWaalsContact C-N 3.32Å; L38-Q40 PolarHBondContact O-N 2.93Å; Q40-R43 PolarHBondContact O-N 3.49Å; Q40-N44 PolarHBondContact NE2-OD1 2.9Å; Q40-N44 WeakPolarHBondContact O-CB 3.29Å; Q40-N44 PolarHBondContact O-N 3.27Å; Q40-N44 PolarHBondContact O-ND2 2.88Å; Q40-N44 PolarHBondContact O-OD1 2.9Å
41	G	96.1	Very high	96	Very high	29 Å²	29	102.4 Å²	102.4	30%	0.299	52%	0.52	S	S	.	.	H	α-helix	trans	-57.3	-52.2	173.7	0	0	0	0	0	111.9	I37 L38 R43 N44 E45	I37-G41 PolarHBondContact O-N 2.89Å; L38-G41 PolarHBondContact O-N 3.27Å; G41-R43 PolarHBondContact O-N 3.46Å; G41-N44 PolarHBondContact O-N 3.47Å; G41-E45 WeakPolarHBondContact O-CG 3.32Å; G41-E45 PolarHBondContact O-N 2.9Å
42	I	96	Very high	95.7	Very high	103 Å²	103	103.2 Å²	103.2	53%	0.528	52%	0.521	S	S	.	.	H	α-helix	trans	-61	-43.4	177.3	-65.7	167.1	0	0	0	111.3	L38 N44 E45 L46	L38-I42 WeakPolarHBondContact O-CG1 3.43Å; L38-I42 PolarHBondContact O-N 3.44Å; I42-N44 VanDerWaalsContact C-N 3.34Å; I42-N44 PolarHBondContact O-N 3.02Å; I42-E45 PolarHBondContact O-N 3.43Å; I42-L46 VanDerWaalsContact O-CB 3.28Å; I42-L46 WeakPolarHBondContact O-CB 3.43Å; I42-L46 PolarHBondContact O-N 3Å
43	R	95	Very high	95.3	Very high	178 Å²	178	104 Å²	104	67%	0.672	52%	0.519	S	S	*	.	H	α-helix	trans	-62.2	-41.6	176.7	-78.2	-172.5	-167.2	-139.4	6.6	111.8	F39 Q40 G41 L46 D47	F39-R43 WeakPolarHBondContact O-CB 3.45Å; F39-R43 VanDerWaalsContact O-CG 3.3Å; F39-R43 WeakPolarHBondContact O-CG 3.31Å; F39-R43 PolarHBondContact O-N 3.48Å; Q40-R43 PolarHBondContact O-N 3.49Å; G41-R43 PolarHBondContact O-N 3.46Å; R43-L46 PolarHBondContact O-N 3.48Å; R43-D47 VanDerWaalsContact O-CB 3.25Å; R43-D47 WeakPolarHBondContact O-CB 3.47Å; R43-D47 PolarHBondContact O-N 2.89Å
44	N	96.4	Very high	94.9	Very high	91 Å²	91	105 Å²	105	49%	0.487	52%	0.52	S	S	.	.	H	α-helix	trans	-65.6	-43.9	178.1	-69.4	-11.1	0	0	0	111.5	Q40 G41 I42 D47 L48	Q40-N44 PolarHBondContact NE2-OD1 2.9Å; Q40-N44 WeakPolarHBondContact O-CB 3.29Å; Q40-N44 PolarHBondContact O-N 3.27Å; Q40-N44 PolarHBondContact O-ND2 2.88Å; Q40-N44 PolarHBondContact O-OD1 2.9Å; G41-N44 PolarHBondContact O-N 3.47Å; I42-N44 VanDerWaalsContact C-N 3.34Å; I42-N44 PolarHBondContact O-N 3.02Å; N44-D47 PolarHBondContact O-N 3.45Å; N44-L48 WeakPolarHBondContact O-CB 3.43Å; N44-L48 PolarHBondContact O-N 3.01Å
45	E	95.6	Very high	94.5	Very high	129 Å²	129	104.7 Å²	104.7	60%	0.603	52%	0.522	S	S	*	.	H	α-helix	trans	-63	-43.6	175.8	-73.8	179.7	-169.4	0	0	111.3	G41 I42 L48 M49	G41-E45 WeakPolarHBondContact O-CG 3.32Å; G41-E45 PolarHBondContact O-N 2.9Å; I42-E45 PolarHBondContact O-N 3.43Å; E45-L48 PolarHBondContact O-N 2.91Å; E45-M49 WeakPolarHBondContact O-CB 3.32Å; E45-M49 VanDerWaalsContact O-CG 3.25Å; E45-M49 WeakPolarHBondContact O-CG 3.44Å; E45-M49 PolarHBondContact O-N 2.88Å
46	L	95.2	Very high	93.9	Very high	96 Å²	96	109.2 Å²	109.2	50%	0.503	53%	0.533	S	S	.	.	H	α-helix	trans	-64.3	-45.1	176.9	-177.5	63.7	0	0	0	111.6	I42 R43 L48 M49 W50	I42-L46 VanDerWaalsContact O-CB 3.28Å; I42-L46 WeakPolarHBondContact O-CB 3.43Å; I42-L46 PolarHBondContact O-N 3Å; R43-L46 PolarHBondContact O-N 3.48Å; L46-L48 VanDerWaalsContact C-N 3.29Å; L46-L48 PolarHBondContact O-N 3.27Å; L46-M49 CarbonylContact O-C 3.59Å; L46-M49 PolarHBondContact O-N 3.33Å; L46-W50 WeakPolarHBondContact O-CA 3.39Å; L46-W50 WeakPolarHBondContact O-CB 3.29Å; L46-W50 PolarHBondContact O-N 3.1Å
47	D	96.1	Very high	93.3	Very high	119 Å²	119	113.1 Å²	113.1	64%	0.636	54%	0.538	S	S	*	.	H	α-helix	trans	-62.3	-38.2	178	-168	53.6	0	0	0	111.4	R43 N44 P51	R43-D47 VanDerWaalsContact O-CB 3.25Å; R43-D47 WeakPolarHBondContact O-CB 3.47Å; R43-D47 PolarHBondContact O-N 2.89Å; N44-D47 PolarHBondContact O-N 3.45Å; D47-P51 WeakPolarHBondContact O-CD 3.36Å
48	L	95.6	Very high	92.9	Very high	128 Å²	128	114 Å²	114	67%	0.67	54%	0.54	S	S	*	.	H	α-helix	trans	-65.5	-43.2	173.1	-175.8	69.7	0	0	0	112.2	N44 E45 L46 H52	N44-L48 WeakPolarHBondContact O-CB 3.43Å; N44-L48 PolarHBondContact O-N 3.01Å; E45-L48 PolarHBondContact O-N 2.91Å; L46-L48 VanDerWaalsContact C-N 3.29Å; L46-L48 PolarHBondContact O-N 3.27Å; L48-H52 PolarHBondContact O-CD2 3.38Å
49	M	94.8	Very high	92.4	Very high	104 Å²	104	111.2 Å²	111.2	51%	0.512	53%	0.529	S	S	.	.	H	α-helix	trans	-76.5	-23.5	-179.6	-69.8	179.6	73.3	0	0	113.1	E45 L46 H52 L53	E45-M49 WeakPolarHBondContact O-CB 3.32Å; E45-M49 VanDerWaalsContact O-CG 3.25Å; E45-M49 WeakPolarHBondContact O-CG 3.44Å; E45-M49 PolarHBondContact O-N 2.88Å; L46-M49 CarbonylContact O-C 3.59Å; L46-M49 PolarHBondContact O-N 3.33Å; M49-H52 WeakPolarHBondContact O-CB 3.37Å; M49-H52 PolarHBondContact O-N 3.39Å; M49-L53 HydrophobicContact CB-CD1 4.47Å; M49-L53 WeakPolarHBondContact O-CG 3.36Å; M49-L53 PolarHBondContact O-N 3.13Å
50	W	94	Very high	91.5	Very high	158 Å²	158	110.8 Å²	110.8	60%	0.598	54%	0.539	S	S	*	.	H	α-helix	trans	-58.7	-45.2	-170.5	180	-111.8	0	0	0	114.2	L46 H52 L53 K54	L46-W50 WeakPolarHBondContact O-CA 3.39Å; L46-W50 WeakPolarHBondContact O-CB 3.29Å; L46-W50 PolarHBondContact O-N 3.1Å; W50-H52 VanDerWaalsContact C-N 3.3Å; W50-H52 PolarHBondContact O-N 2.98Å; W50-L53 PolarHBondContact O-N 2.85Å; W50-K54 WeakPolarHBondContact O-CB 3.3Å; W50-K54 PolarHBondContact O-N 3.34Å
51	P	91.2	Very high	90.8	Very high	65 Å²	65	110.1 Å²	110.1	42%	0.422	55%	0.546	S	S	.	.	H	α-helix	trans	-60.7	-38.1	174.1	-23.6	34	0	0	0	112.8	D47 K54 N55	D47-P51 WeakPolarHBondContact O-CD 3.36Å; P51-K54 PolarHBondContact O-N 3.49Å; P51-N55 WeakPolarHBondContact O-CB 3.33Å; P51-N55 PolarHBondContact O-N 3.41Å; P51-N55 PolarHBondContact O-ND2 3.37Å
52	H	90.4	Very high	89.5	Confident	131 Å²	131	113 Å²	113	61%	0.606	55%	0.55	S	S	*	.	H	α-helix	trans	-66.8	-42.1	177.9	-62.2	-73.8	0	0	0	111.4	L48 M49 W50 K54 N55 Y56	L48-H52 PolarHBondContact O-CD2 3.38Å; M49-H52 WeakPolarHBondContact O-CB 3.37Å; M49-H52 PolarHBondContact O-N 3.39Å; W50-H52 VanDerWaalsContact C-N 3.3Å; W50-H52 PolarHBondContact O-N 2.98Å; H52-K54 VanDerWaalsContact C-N 3.34Å; H52-N55 PolarHBondContact O-N 2.9Å; H52-Y56 WeakPolarHBondContact O-CB 3.37Å; H52-Y56 PolarHBondContact O-N 2.85Å
53	L	90.1	Very high	88.3	Confident	83 Å²	83	120.6 Å²	120.6	44%	0.435	57%	0.572	S	S	.	*	H	α-helix	trans	-63.5	-40.4	174.3	-67.2	173.9	0	0	0	111.7	M49 W50 Y56 R57	M49-L53 HydrophobicContact CB-CD1 4.47Å; M49-L53 WeakPolarHBondContact O-CG 3.36Å; M49-L53 PolarHBondContact O-N 3.13Å; W50-L53 PolarHBondContact O-N 2.85Å; L53-Y56 PolarHBondContact O-N 3.46Å; L53-R57 PolarHBondContact O-N 3Å
54	K	87.9	Confident	87.9	Confident	111 Å²	111	117.7 Å²	117.7	48%	0.483	57%	0.567	S	S	.	*	H	α-helix	trans	-62.5	-49.4	175.6	-172.2	-173.1	179.3	-165.3	0	111.5	W50 P51 H52 Y56 R57 E58	W50-K54 WeakPolarHBondContact O-CB 3.3Å; W50-K54 PolarHBondContact O-N 3.34Å; P51-K54 PolarHBondContact O-N 3.49Å; H52-K54 VanDerWaalsContact C-N 3.34Å; K54-Y56 VanDerWaalsContact C-N 3.3Å; K54-Y56 PolarHBondContact O-N 3.11Å; K54-R57 WeakPolarHBondContact O-CB 3.47Å; K54-R57 PolarHBondContact O-N 3.35Å; K54-E58 WeakPolarHBondContact CE-OE1 3.49Å; K54-E58 PolarHBondContact O-N 2.97Å; K54-E58 VanDerWaalsContact O-N 3.09Å
55	N	89	Confident	87.5	Confident	101 Å²	101	119.1 Å²	119.1	54%	0.54	57%	0.571	S	S	.	*	H	α-helix	trans	-63.5	-37.9	178.5	-67.6	-19.5	0	0	0	111.7	P51 H52 R57 E58 S59	P51-N55 WeakPolarHBondContact O-CB 3.33Å; P51-N55 PolarHBondContact O-N 3.41Å; P51-N55 PolarHBondContact O-ND2 3.37Å; H52-N55 PolarHBondContact O-N 2.9Å; N55-R57 VanDerWaalsContact C-N 3.35Å; N55-E58 PolarHBondContact O-N 2.9Å; N55-S59 PolarHBondContact O-N 2.89Å; N55-S59 VanDerWaalsContact O-N 3.07Å
56	Y	85.1	Confident	87	Confident	139 Å²	139	118.6 Å²	118.6	55%	0.545	57%	0.57	S	S	.	*	H	α-helix	trans	-61.2	-43.5	174.7	-175.7	-108.8	0	0	0	111.4	H52 L53 K54 E58 S59 F62	H52-Y56 WeakPolarHBondContact O-CB 3.37Å; H52-Y56 PolarHBondContact O-N 2.85Å; L53-Y56 PolarHBondContact O-N 3.46Å; K54-Y56 VanDerWaalsContact C-N 3.3Å; K54-Y56 PolarHBondContact O-N 3.11Å; Y56-E58 VanDerWaalsContact C-N 3.32Å; Y56-E58 PolarHBondContact O-N 3.46Å; Y56-S59 VanDerWaalsContact O-CB 3.3Å; Y56-S59 WeakPolarHBondContact O-CB 3.31Å; Y56-S59 PolarHBondContact O-N 3.13Å; Y56-F62 AromaticContact CD1-CD2 3.43Å; Y56-F62 HydrophobicContact CD1-CD2 3.43Å; Y56-F62 VanDerWaalsContact CD1-CD2 3.43Å; Y56-F62 AromaticContact CD1-CE2 3.54Å; Y56-F62 HydrophobicContact CD1-CE2 3.54Å; Y56-F62 AromaticContact CE1-CD2 3.32Å; Y56-F62 HydrophobicContact CE1-CD2 3.32Å; Y56-F62 AromaticContact CE1-CE2 3.44Å; Y56-F62 HydrophobicContact CE1-CE2 3.44Å; Y56-F62 VanDerWaalsContact CE1-CE2 3.44Å; Y56-F62 HydrophobicContact CG-CD2 4.25Å; Y56-F62 WeakPolarHBondContact O-CB 3.49Å; Y56-F62 WeakPolarHBondContact O-CD2 3.31Å
57	R	84.4	Confident	86.5	Confident	171 Å²	171	119.9 Å²	119.9	65%	0.645	57%	0.574	S	S	*	*	H	α-helix	trans	-63.1	-34.5	175.7	-177.6	-176.5	177.9	-147.9	-0.9	113.5	L53 K54 N55 S59 F62	L53-R57 PolarHBondContact O-N 3Å; K54-R57 WeakPolarHBondContact O-CB 3.47Å; K54-R57 PolarHBondContact O-N 3.35Å; N55-R57 VanDerWaalsContact C-N 3.35Å; R57-S59 VanDerWaalsContact C-N 3.32Å; R57-F62 HydrophobicContact CG-CD1 4.44Å; R57-F62 HydrophobicContact CG-CE1 4.22Å
58	E	88	Confident	86	Confident	129 Å²	129	119.9 Å²	119.9	60%	0.603	57%	0.57	S	S	*	*	H	α-helix	trans	-82.6	-9.7	178.7	-69.3	175.8	-169.8	0	0	113	K54 N55 Y56	K54-E58 WeakPolarHBondContact CE-OE1 3.49Å; K54-E58 PolarHBondContact O-N 2.97Å; K54-E58 VanDerWaalsContact O-N 3.09Å; N55-E58 PolarHBondContact O-N 2.9Å; Y56-E58 VanDerWaalsContact C-N 3.32Å; Y56-E58 PolarHBondContact O-N 3.46Å
59	S	85.2	Confident	85.3	Confident	38 Å²	38	119.4 Å²	119.4	27%	0.266	56%	0.563	S	S	.	*	S	Bend	trans	-64.9	136.6	178	-175.4	0	0	0	0	110.9	N55 Y56 R57 S61 F62	N55-S59 PolarHBondContact O-N 2.89Å; N55-S59 VanDerWaalsContact O-N 3.07Å; Y56-S59 VanDerWaalsContact O-CB 3.3Å; Y56-S59 WeakPolarHBondContact O-CB 3.31Å; Y56-S59 PolarHBondContact O-N 3.13Å; R57-S59 VanDerWaalsContact C-N 3.32Å; S59-S61 PolarHBondContact O-N 3.02Å; S59-S61 PolarHBondContact OG-N 3.17Å; S59-S61 PolarHBondContact OG-OG 3.5Å; S59-F62 VanDerWaalsContact O-CB 3.29Å; S59-F62 WeakPolarHBondContact O-CB 3.44Å; S59-F62 PolarHBondContact O-N 3.49Å
60	P	79.1	Confident	84.6	Confident	123 Å²	123	120.5 Å²	120.5	80%	0.799	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-23.6	172	-25	33.6	0	0	0	113.9	F62	P60-F62 VanDerWaalsContact C-N 3.31Å
61	S	82.7	Confident	83.9	Confident	87 Å²	87	117.6 Å²	117.6	61%	0.608	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-3.4	178.1	67.4	0	0	0	0	114.8	S59	S59-S61 PolarHBondContact O-N 3.02Å; S59-S61 PolarHBondContact OG-N 3.17Å; S59-S61 PolarHBondContact OG-OG 3.5Å
62	F	67.9	Low	83.3	Confident	88 Å²	88	122 Å²	122	39%	0.386	58%	0.576	S	S	.	*			trans	-80.8	-27.9	-178	-173.2	-95.3	0	0	0	113.2	Y56 R57 S59 P60	Y56-F62 AromaticContact CD1-CD2 3.43Å; Y56-F62 HydrophobicContact CD1-CD2 3.43Å; Y56-F62 VanDerWaalsContact CD1-CD2 3.43Å; Y56-F62 AromaticContact CD1-CE2 3.54Å; Y56-F62 HydrophobicContact CD1-CE2 3.54Å; Y56-F62 AromaticContact CE1-CD2 3.32Å; Y56-F62 HydrophobicContact CE1-CD2 3.32Å; Y56-F62 AromaticContact CE1-CE2 3.44Å; Y56-F62 HydrophobicContact CE1-CE2 3.44Å; Y56-F62 VanDerWaalsContact CE1-CE2 3.44Å; Y56-F62 HydrophobicContact CG-CD2 4.25Å; Y56-F62 WeakPolarHBondContact O-CB 3.49Å; Y56-F62 WeakPolarHBondContact O-CD2 3.31Å; R57-F62 HydrophobicContact CG-CD1 4.44Å; R57-F62 HydrophobicContact CG-CE1 4.22Å; S59-F62 VanDerWaalsContact O-CB 3.29Å; S59-F62 WeakPolarHBondContact O-CB 3.44Å; S59-F62 PolarHBondContact O-N 3.49Å; P60-F62 VanDerWaalsContact C-N 3.31Å
63	W	69.8	Low	82.7	Confident	263 Å²	263	121.2 Å²	121.2	100%	0.996	57%	0.573	S	S	*	*			trans	-97.3	0	176.1	-62.2	100.2	0	0	0	110.6

Retrieved 63 of 63 residues in 81 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).